Slovak University of Technology
in Bratislava
Faculty of Civil Engineering
and
Slovak Society of Mechanics SAS
11 t h International Conference
on
New Trends in Statics and Dynamics
of Buildings
Conference Proceedings
October 3 – 4, 2013 Bratislava
Proceedings of
11th International Conference on
New Trends in Statics and Dynamics of
Buildings
Edited by
Norbert Jendželovský
Alžbeta Grmanová
Published by
Slovak University of Technology in Bratislava
Authors of contributions are responsible for
the statements or opinions expressed in the
papers.
All papers have been reproduced from camera
ready manuscripts supplied by authors.
All rights reserved. No part of this publication
may be reproduced, stored in retrieval system
or transmitted in any form or by any means,
without permission of the publisher.
Copyright © Slovak University of Technology
in Bratislava
Printing: 100 copies, 275 pages
Edition 2013
ISBN 978-80-227-4040-1
PREFACE
Welcome to the 11th International Conference "New Trends in Statics and Dynamics of
Buildings" in Bratislava, Slovakia.
The purpose of this conference is to provide a forum for scientists and experts for getting the
recent knowledge in topic technologies and development of the numerical methods in the statics
and dynamics of buildings and discussing actual problems in theoretical and experimental trends
in structural analysis.
The conference is focused to major problems in research and development in following areas:
x Seismic Behavior of Structures,
x Aeroelasticity of Structures,
x Thermomechanics and Fire Resistance,
x Structure-Subgrade Interaction,
x Optimization of Structures,
x Life Span and Safety of Structures,
x Damage and Crash of Structures,
x Diagnostics and Experimental Analysis.
The aim of this conference is to enhance the efficiency and quality of building structures,
their safety and reliability.
The conference is organized by Faculty of Civil Engineering at Slovak University of
Technology in Bratislava and Slovak Society of Mechanics at Slovak Academy of Science in
Bratislava.
The Organizing Committee expresses sincere thanks and appreciation to the authors,
participants and all others, who contributed to the organization of the conference.
We hope you will enjoy your staying in Bratislava and you will benefit from the new
knowledge presented and discussed during the conference.
Prof. Ing. Norbert Jendželovský, PhD.
Chairman of the Conference
Scientific committee:
Chairman:
Jendželovský Norbert
Slovak University of Technology Bratislava, Slovakia
Members:
Benþat Ján
Györgyi József
Janas Petr
Králik Juraj
Máca JiĜí
Melcer Jozef
Novák Drahomír
Partov Doncho
Ravinger Ján
Skrzypczyk Jerzy
Sokol Milan
University of Žilina, Slovakia
Budapest University of Technology and Economics, Hungary
VŠB-Technical University of Ostrava, Czech Republic
Slovak University of Technology Bratislava, Slovakia
Czech Technical University in Prague, Czech Republic
University of Žilina, Slovakia
Brno University of Technology, Czech Republic
Higher School of Civil Engineering (VSU) Sofia, Bulgaria
Slovak University of Technology Bratislava, Slovakia
Silesian University of Technology, Gliwice, Poland
Slovak University of Technology Bratislava, Slovakia
Conference organized by:
Slovak University of Technology in Bratislava
Faculty of Civil Engineering
Department of Structural Mechanics
and
Slovak Society for Mechanics SAV, Bratislava
Organizing committee:
Jendželovský Norbert
Grmanová Alžbeta
Ivánková OĐga
Chairman
Secretary
Reviewers of the papers published in the Proceedings:
Dický Jozef, Hubová OĐga, Ivánková OĐga, Jendželovský Norbert, Koleková Yvonna, Koneþná
Lenka, Králik Juraj, Marton Pavol, Mistríková Zora, Prekop ďubomír, Psotný Martin, Ravinger
Ján, Sokol Milan, Tvrdá Katarína, Véghová Ivana.
Proceedings of the 11th International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
TABLE OF CONTENTS
ďubomír Baláž, Eduard Vyskoþ
NÁVRH A ZHOTOVENIE ŠTRKOVÉHO PODKLADU S OHďADOM NA KVALITU PODLOŽIA
..............................
Witold BasiĔski
THE ANALYSIS OF THE CHANGE OF THE SHEAR ANGLE SIN
GIRDERS WITH THE SUPPORT STIFF RIB AND SEMIRIGID
..............................
Aleksandra Belina
ANALIZA WPàYWU ĝCIAN MUROWANYCH NA SZTYWNOĝû KONSTRUKCJI
SZKIELETOWEJ
..............................
Ján Benþat, Mária Stehlíková
DYNAMIC RESPONSE OF BUILDINGS AND STRUCTURES DUE TO INDUSTRIAL
MACHINERY EFFECTS
..............................
Miriam Brzáþová, Yvonna Koleková
BENDING RESISTANCE OF CURVED BEAMS ACCORDING TO EUROCODE STN EN 1993
..............................
Robert Cybulski
NUMERICAL MODEL OF DOUBLY CORRUGATED THIN-WALLED ELEMENTS
BASED ON 3D OPTICAL SCANNING
..............................
Syzmon DawczyĔski
MODEL OF INTERACTIVE SYSTEM: CONCRETE FOUNDATION – MINING SUBSOIL
..............................
Szymon DawczyĔski, Janusz Brol, Katarzyna Adamczyk
REUSE OF PRECAST STRUCTURAL ELEMENTS
..............................
Ivo Demjan, Michal Tomko
EXPERIMENTÁLNE OVEROVANIE HOMOGENITY ŽELEZOBETÓNOVÝCH STčPOV
..............................
Lidia Fedorowicz, Iwona Pokorska-Silva
THE ROLE OF ENERGY-EFFICIENT CONSTRUCTION IN CONTEMPORARY
ENGINEERING DESIGN
..............................
Jan Fedorowicz, Leszek Sáowik
INTERPRETATION OF THE BEHAVIOR OF A SYSTEM BUILDING
OBJECT - DIFFICULT SUBSOIL IN MODERN NUMERICAL MODELING
..............................
Tomáš Ficker
NETRADIýNÍ DIAGNOSTIKA PEVNOSTI V TLAKU BETONOVÝCH MATERIÁLģ
..............................
Tomáš Ficker
STABILITA ZÁKLADOVÝCH PěECHODģ MEZI BETONEM A HORNINOVÝM PODLOŽÍM
..............................
I
1
5
9
13
17
21
25
27
31
35
39
43
45
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Wojciech Gilewski, Anna Al Sabouni-Zawadzka
STEROWANIE WàASNOĝCIAMI STRUKTUR PàYTOWYCH
TYPU TENSEGRITY ZA POMOCĄ SAMONAPRĉĩEē
..............................
Marcin Górski, Agnieszka Knoppik-Wróbel, Marcin Kozáowski
ACTIVE MONITORING WITH USE OF SMART STRUCTURES BASED ON HIGH-STRENGTH
FIBRE COMPOSITES AS A METHOD OF STRUCTURAL ELEMENTS OPTIMISATION
..............................
Grzegorz Gremza
SHEAR AND BENDING CAPACITY OF COMPOSITE STEEL-CONCRETE BEAMS
..............................
Grzegorz Gremza
PARTIALLY ENCASED COMPOSITE STEEL-CONCRETE BEAMS EXPOSED TO TORSION
..............................
József Györgyi
STABILITY AND ACCURACY OF DYNAMIC CALCULATION OF STRUCTURES
..............................
Michal HoĐko, Jozef Dický
OPTIMALIZÁCIA BETÓNOVEJ DOSKY MOSTA POUŽITÍM PRVKU SOLID65
..............................
Miloš Hüttner, JiĜí Máca, Petr Fajman
EFEKTIVITA POSTUPģ METODY DYNAMICKÉ RELAXACE PěI ANALÝZE
LANOVÝCH SOUSTAV
..............................
Norbert Jendželovský, ďubomír Baláž
VLASTNÉ FREKVENCIE OCEďOVÝCH NÁDRŽÍ
..............................
Norbert Jendželovský, SoĖa Medvecká
ANALÝZA VÝŠKOVEJ BUDOVY OD HORIZONTÁLNYCH SÍL
..............................
Marta Kadela, Leszek Chomacki
INFLUENCE OF SOIL TYPE ON THE STRESSES IN THE BUILDING STRUCTURE
IN FACE OF MINING EXPLOITATION
..............................
Piotr Kanty, Jerzy SĊkowski
THE INFLUENCE OF STONE COLUMNS FORMATION TECHNIQUE
ON THE CONSOLIDATION TIME OF THE SURROUNDING SOIL
..............................
Andrzej Kasprzak
PROPOZYCJA KLASYFIKACJI KONSTRUKCJI TYPU TENSEGRITY
..............................
Bernard Kotala, Marek WĊglorz
NUMERICAL ANALYSES OF THIN TEXTILE REINFORCED CONCRETE PLATES
ON BASIS OF LABORATORY TESTS RESULTS
..............................
Kamila Kotrasová, Eva Kormaníková
COMPARISON OF HYDRODYNAMIC PARAMETERS OF RECTANGULAR
TANKS ACCORDING TO MODELS BY MALHOTRA AND HOUSNER
..............................
Janka Kováþiková, OĐga Ivánková
URýENIE KOEFICIENTU INTENZITY NAPÄTIA V OKOLÍ KOREĕA TRHLINY PRI I. MÓDE
..............................
Bernard Kowolik
DEFORMATION OF THE FRAME OF COLD-FORMED MEMBERS IN FIRE
..............................
II
47
51
55
59
63
67
71
73
77
81
89
93
97
101
105
109
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Bernard Kowolik
PROCEDURES OF DESIGNING METAL STRUCTURES IN FIRE
IN COMPLIANCE WITH THE NATIONAL ANNEX OF EUROCODE
..............................
Juraj Králik, Maroš Klabník
NUMERICKÉ METÓDY PRE RIEŠENIE SPOďAHLIVOSTI KONŠTRUKCIÍ
..............................
Rafal Krzywon
PROPERTIES OF STEEL REINFORCED POLYMERS IN COMPARISION
WITH OTHER FIBER REINFORCED COMPOSITES
..............................
Jan Kubošek, OldĜich Sucharda
ANALÝZA TENKÝCH DESEK METODOU SÍTÍ A VÝPOýETNÍ NÁROýNOST ÚLOHY
..............................
Monika Kubzová, OldĜich Sucharda
ANALÝZA OBLOUKU OBECNOU DEFORMAýNÍ METODOU
..............................
Jozef Melcer, Daniela Kuchárová
FREKVENýNÉ CHARAKTERISTIKY NÁKLADNÉHO VOZIDLA
..............................
Jozef Melcer, Gabriela Lajþáková
POROVNANIE VÝPOýTOVÝCH MODELOV CESTNÝCH KOMUNIKÁCIÍ
..............................
David Mikolášek, OldĜich Sucharda, JiĜí Brožovský
ANALÝZA DETAILU KOTVENÍ DěEVċNÉ KONSTRUKCE RÁMU
..............................
Zora Mistríková
INFLUENCE OF UNILATERAL FOUNDATION ON DEFLECTION
OF THE EXCENTRICALLY LOADED BEAM
..............................
J. Murín, T. Sedlár, V. Goga, J. Paulech, V. Kutiš, M. Aminbaghai, H. Mang
MEASUREMENT OF NON-UNIFORM TORSION OF CLOSED THIN-WALLED
CROSS-SECTION BEAM
..............................
Lesáaw Niewiadomski
SPACIAL GEOMETRICAL IMPERFECTIONS IN CALCULATIONS OF STEEL PLATE GIRDERS
..............................
Lesáaw Niewiadomski, Jan Zamorowski
THE INFLUENCE OF GEOMETRICAL IMPERFECTIONS OF ROOF TRUSSES
ON THE INTERNAL FORCES IN THE ELEMENTS IN THE STRUCTURE
OF THE ROOF OF AN ASSEMBLY HALL
..............................
Ivana Olekšáková, Marek Magát
MODELING OF 2D CIRCULAR CYLINDER IN ANSYS BY USING TURBULENCE MODELS.
THE EXPERIMENT PREPARATION
..............................
Pavel PadevČt, ZdenČk Bittnar, Petr Bittnar
VLIV PODMÍNEK OKOLÍ NA PROVOZUSCHOPNOST LETIŠTNÍ DRÁHY
..............................
Pavel PadevČt, Tereza Otcovská
MECHANICKÉ VLASTNOSTI CEMENTOVÉ PASTY S OBSAHEM POLÉTAVÉHO POPÍLKU
..............................
Doncho Partov, Vesselin Kantchev
COMPARISON BETWEEN EUROCODE 2, ACI 209 – R2 AND GARDNER&LOCKMAN
MODELS IN CREEP ANALYSIS OF COMPOSITE STEEL-CONCRETE SECTIONS
..............................
III
113
117
121
123
127
131
135
139
143
147
149
153
157
161
165
167
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Doncho Partov, Milen Petkov
STATIC ANALYSIS AND DESIGN OF THE BACK ANCHOR OF THE TBM,
EXCAVATED THE TUNNELS OF SOFIA METRO UNDER BUL. MARIA LUIZA
..............................
Mircea Pastrav
ROBUSTNESS OF MODIFIED SPECIAL HYBRID RC FRAMES
..............................
Stanislav Piovár, Eva Kormaníková
NUMERICAL MODELING OF SANDWICH BEAMS WITH SHORT FIBER REINFORCED
COMPOSITE FACES
..............................
ďubomír Prekop
VODOROVNE ZAġAŽENÉ PONORENÉ PILOTY
..............................
Martin Psotný
POKRITICKÉ PÔSOBENIE ŠTÍHLEJ STENY
..............................
Martin Psotný, Jozef Havran
DYNAMICKÁ ANALÝZA VÝŠKOVEJ BUDOVY NEPRAVIDELNÉHO PÔDORYSU
..............................
Ján Ravinger
STAGE FOR ECOC 2013 IN KOŠICE
..............................
OndĜej Rokoš, JiĜí Máca
ON STOCHASTIC APPROACH TO HUMAN-GRANDSTAND INTERACTION
..............................
Vladimír Šána
RESPONSE OF A SIMPLY SUPPORTED BEAM EXPOSED TO A HARMONIC FORCE
WITH A RANDOM PARAMETERS
..............................
Vladimír Šána, Michal Polák
DYNAMICKÁ ANALÝZA LÁVKY PRO PċŠÍ PěES ULICI OPATOVICKÁ
..............................
Jerzy SĊkowski, Aleksandra Siódmok
BADANIA MODELOWE WPàYWU TECHNOLOGII KATALITYCZNO-FIZYCZNEJ
NA PARAMETRY ODKSZTAàCENIOWE GRUNTU SPOISTEGO
..............................
Jerzy Skrzypczyk
NEW COMPUTATIONAL METHODOLOGY FOR CALCULATIONS WITH INTERVAL
NUMBERS
..............................
Jerzy Skrzypczyk, Aleksandra Belina
FEM ANALYSIS OF UNCERTAIN SYSTEMS WITH SMALL INTERVAL PERTURBATIONS
..............................
ďuboš Šnirc, Ján Ravinger
VIBRATION OF IMPERFECT SLENDER WEB
..............................
Milan Sokol, Lenka Koneþná
NUMERICAL MODEL OF UNDERPASS STRUCTURE CALIBRATED BY TESTS
..............................
OldĜich Sucharda, Sylva Vrublová, JiĜí Brožovský
CELKOVÁ ÚNOSNOST MALÝCH ŽELEZOBETONOVÝCH NOSNÍKģ
..............................
Gergely Szabó, József Györgyi
NUMERICAL AERODYNAMIC STUDY OF AN EXTRADOSED CONCRETE BRIDGE
IN CONSTRUCTION STAGE
..............................
IV
171
175
179
183
185
189
193
197
201
205
209
213
217
221
225
227
231
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Shota Urushadze, Ladislav Frýba
STRESS INVESTIGATIONS OF ORTHOTROPIC DECKS
..............................
235
Jakub Vašek, OldĜich Sucharda
ANALÝZA PARABOLICKÉ ěETċZOVKY
..............................
239
Ivana Véghová, Jozef Sumec
LIMIT STATE ANALYSIS OF STRUCTURES – SOME EXTREMAL THEOREMS
AND METHODS OF SOLUTIONS
..............................
243
Kristína Vráblová
VÝPOýET TRHLÍN V KRUHOVÝCH NÁDRŽIACH
..............................
247
Miroslaw Wieczorek
NUMERICAL ANALYSIS OF CONSTRUCTION OF RESIDENTIAL BUILDING TREATED
INFLUENCE OF MINING ACTIVITIES
..............................
251
Miroslaw Wieczorek
NUMERICAL ANALYSIS OF THE EFFECT OF THE UNCERTAINTY OF MECHANICAL
PARAMETERS OF THE SOIL ON THE BEHAVIOUR OF THE MASONRY STRUCTURE
OF A CHURCH SITUATED IN A MINING DISTRICT
..............................
255
David Zacho, OĐga Hubová, Peter Lobotka
SIMULATING THE NATURAL WIND IN BLWT – WIND TUNNEL IN LABORATORIES OF STU
..............................
259
Jan Zamorowski
GALERKINS METHOD APPLIED IN CALCULATIONS OF BAR SYSTEMS ACCORDING
TO THE SECOND ORDER THEORY
..............................
263
Jan Zamorowski, Leslaw Niewiadomski
NUMERICAL INVESTIGATIONS OF A SEQUENTIALLY LOADED FLAT FRAME WITH
FLEXIBLE NODES
..............................
267
OndĜej Zobal, Vít Šmilauer, ZdenČk Bittnar
OPTIMIZATION OF MIXING THE VARIOUS COMPONENTS OF FLY ASH BASED
ON THE GRAIN SIZE FOR USE IN COMPOSITE CEMENTS
..............................
271
AUTHOR INDEX
..............................
V
275
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
1È95+$ =+2729(1,(â75.29e+232'./$'8
S 2+ď$'201$.9$/,7832'/2ä,$
,QJďXERPtU%DOiå1 D,QJ(GXDUG9\VNRþ2
Abstract
In this paper are presented design and construction of a gravel base under the cylindrical tank.
.Đ~þRYpVORYi
YDOFRYiQiGUå; SRGORåLHãWUNRYêYDQN~ãPRGXOGHIRUPiFLHSRGORåLD
1
Ò92'
ProblematiNXQiYUKXD UHDOL]iFLHYDOFRYêFK QiGUåtELRSO\QRYpKRKRVSRGiUVWYDPRåQRUR]GHOLĢGRGYRFKVNXStQ:
YRGRWHVQRVĢ åHOH]REHWyQRYHM QiGUåH D NYDOLWD SRGORåLD 9 WRPWR SUtVSHYNX VD EXGHPH YHQRYDĢ SUREOpPRP
QiYUKXQiGUåtRVRELWQHV RKĐDGRPQDQHY\KQXWQ~NYDOLWXSRGORåLD
V QDãRP SUtSDGH VPH PDOL ãĢDVWLH D GRVWDOL VPH PRåQRVĢ SUHSRMHQLD WHRUHWLFNêFK ]QDORVWt D ]DSRMLĢ VD GR
SURFHVXSURMHNWXDMUHDOL]iFLHWDNHMWRQiGUåHY DUHiOLVSRORþQRVWL%LRSO\Q%XGþD spol. VURNWRUi V QDPL ~]NR
spolupracovala.
2
5,(â(1,(
=iYHUHþQi VSUiYDJHRWHFKQLFNpKRSULHVNXPX XYiG]DODDNR]HPLQ\Y SRGORåtQiGUåHMHPQR]UQQp]HPLQ\WUiedy
) NWRUêFK PRGXO GHIRUPiFLH PDO E\Ģ GR 03D 6WDWLFNê YêSRþHW QiGUåH ERO VSUDFRYDQê ãSHFLDOL]RYDQêP
SURJUDPRP .51$ .5XKRYi 1iGUå V QiVOHGQêP SRV~GHQtP NRQãWUXNFLH QD PHG]Qê VWDY ãtUN\ WUKOtQ
v SURJUDPH0DWK&$'3ULPHDXWRU,QJ%DOiåXNi]DOåHDåSULKU~ENHVWLHQD GQDPPERODãtUNDWUKOtQ
SUtSXVWQiSULþRPPRGXOGHIRUPiFLHSRGORåLDPXVHOGRVLDKQXĢQDMPHQHMKRGQRWX80 MPa.
%ROR]UHMPpåHQiYUKKU~EN\NRQãWUXNFLHSUHPRGXOGHIRUPiFLHSRGORåLDFFD03DE\YLHGRON WDNPDVtYQHM
NRQãWUXNFLLåHE\ERODSUHLQYHVWRUDQHUHQWDELOQi1DãRX~ORKRXWHGDERORQDYUKQ~ĢWDN~~SUDYXSRGORåLD aby
sme dosiahli v ~URYQL ]iNODGRYHM ãNiU\ PRGXO GHIRUPiFLH SRGORåLD DVSRĖ SRåDGRYDQêFK 03D SULþRP DOH
PXVHODE\Ģ]DEH]SHþHQiDMURYQRPHUQRVĢYODVWQRVWtSRGFHORXQiGUåRXV YQ~WRUQêPSULHPHURPP
1D ]iNODGH QDãLFK YLDFURþQêFK VN~VHQRVWt SRWYUGHQêPL PQRåVWYRP PHUDQt VPH QDYUKOL VNODGEX
ãWUNRSLHVNRYpKRYDQN~ãD VSROX PP KUXEpKRWDNDE\QD MHKRSRYUFKXEROGRVLDKQXWê PRGXOGHIRUPiFLH
SRåDGRYDQêFK80 MPa a pomer Edef,2/Edef,1 PXVHOE\ĢQDMYLDFURYQê.
1
Ing. ďXERPtU %DOiå .DWHGUD VWDYHEQHM PHFKDQLN\ 6WDYHEQHM IDNXOW\ 678 WHO 907 635 941,
e-mail.: [email protected]
2
,QJ(GXDUG9\VNRþDXWRUL]RYDQêVWDYHEQêLQåLQLHU6.6,WHO 905 468 018,
e-mail.: [email protected]
~1~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
2NUHP DEVRO~WQHj KRGQRW\ PRGXOX GHIRUPiFLH VPH SUHGStVDOL SUH NDåG~ YUVWYX SR MHM ]KXWQHQt NRQWUROQp
merania v UDVWUL [ P SULþRP QDMYlþãt UR]SW\O KRGQ{W Y UiPFL MHGQHM YUVWY\ 50 mm hrubej) nesmel
SUHNURþLĢ03D
=KRWRYLWHĐQDYLDFQDYUKROD ]DEH]SHþLOPHUDQLHPRGXOXGHIRUPiFLHQDGQHVWDYHEQHMMDP\SRYêNRSH (obr. 2, 3)
0RGXO GHIRUPiFLH VD PHUDO VWDWLFNRX GRVNRX Y strede stavebnej jamy (1 meranie v UiPFL MHGQHM YUVWY\)
a NRQWUROQpPHUDQLDY UiPFLYUVWY\URYQRPHUQRVĢ]KXWQHQLDEROL]DEH]SHþHQpG\QDPLFNRXGRVNRX4 PHUDQt
v UiPFLMHGQHMYUstvy).
Obr. 1. 1iYUKãWUNRYpKRYDQN~ãDSRGYDOFRYRXQiGUåRX
Obr. 2. =iNODGRYiãNiUDEXG~FHMYDOFRYHMQiGUåHObr. 3. 'HWDLONDãRYLWHMtORYLWHM]HPLQ\SRGORåLD
Obr. 4. 6WDWLFNi]DĢDåRYDFLDVN~ãNDGQDYêNRSX
~2~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Obr. 5. ÒGDMHR VN~ãNHD YêVOHGN\YGQHVWDYHEQHMMDP\± VWDWLFNiGRVND
Obr. 6. ÒGDMHR VN~ãNHD vêVOHGN\YGQHVWDYHEQHMMDP\± G\QDPLFNi doska
~3~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
2.1 =KRWRYHQLHãWUNRYpKRYDQN~ãD
âWUNRYê YDQN~ã KU~EN\ 1000 mm bol zhotoYHQê ]R ãW\URFK YUVWLHY V SULEOLåQRX KU~ENRX SR 50 mm. Na
vytvRUHQLH NDåGHM YUVWY\ ERO SRXåLWê ãWUN IUDNFLH - PP 9UVWY\ EROL VWULHGDYR ]KXWĖRYDQp QLHNRĐNêPL
pojazdami valca s YLEUiFLRX D EH] YLEUiFLH -HGQRWOLYp YUVWY\ ãWUNRYpKR PDWHULiOX EROL SUHNODGDQp YêVWXåQêPL
SUYNDPLNWRUpEROLQDYUKQXWpQDVSHYQHQLHD vysWXåHQLHMHGQRWOLYêFKYUVWLHYSULþRPåLDGQHGYDYêVWXåQHSUYN\
QHEROLURYQDNp NiVOHGQHERODY\KRWRYHQiVN~ãND]KXWQHQLDVWDWLFNRXD dynamickou doskou, o WHMWRVN~ãNHERO
Y\SUDFRYDQêSURWRNROV SUHVQêPLKRGQRWDPLPRGXOXGHIRUPiFLHD pomeru Edef,2/Edef,1.
Hodnoty v SRVOHGQHMYUVWYHSRWYUGHQpPHUDQtPćDOHNRSUHGþLOLQDãHRþDNiYDQLD:
Edef,2 = 113, 28 MPa
Pomer Edef,2/Edef,1 v poslednej vrstve 2,4
1D WDNWR SULSUDYHQê YDQN~ã QDVOHGRYDOD YêVWDYED SRGNODGRYHM YUVWY\ z SURVWpKR EHWyQX NWRUê WYRULO SHYQê
a rovnêSRGNODG, ]DþtP QDVOHGRYDODVWDYEDGQDYDOFRYHMQiGUåH
3
=È9(5
Z SUH]HQWRYDQêFKYêVOHGNRYD WLHåIDNWX, åHNRQãWUXNFLDãWUNRYpKRSRGNODGXMHY V~þDVQHMGREHXå]KRWRYHQi, sa
SULNOiĖDPH N ]iYHUX, åHQDãH UR]KRGQXWLHSUH WDNêWRW\SSRGORåLD D WLHå MHKRQiYUKD zhotovHQLHERORVSUiYQH
V WRPWRþDVHSUHELHKDXåYêVWDYED VDPRWQHMYDOFRYHMQiGUåHELRSO\QRYpKRKRVSRGiUVWYD
32Ć$.29$1,(
- 7HQWRSUtVSHYRNY]QLNRO]DILQDQþQHMSRGSRU\JUDQWRYHMDJHQW~U\0â65DNRSURMHNW9(*$
- 3UHSRMHQLHYHGHFNpKRYêVNXPXD staveEQHMSUD[HXPRåQLODVSRORþQRVĢ%LRSO\Q%XGþDVSROVUR
(OHNWUiUHQVNi%UDWLVODYD
=RGSRYHGQê: ,QJ9LOLDP%HQGHOâtSRYi$%UDWLVODYDWþH-mail : [email protected]
/,7(5$7Ò5$
[1]
J. Sobota: 6WDYHEQiPHFKDQLND 2. ALFA Bratislava, 1986,
[2]
Z. 0LVWUtNRYi, N. -HQGåHORYVNê 9SO\Y PRGHORY SRGORåLD QD GHIRUPiFLX D QDSlWRVĢ ]iNODGRYHM GRVN\
Civil and Environmental Engineering, Vol.3, 2007, No.2, pp. 139-148, ISSN 1336-5835.
[3]
Z. âPHUGD 9êSRþW\åHOH]REHWyQRYêFKQiGUåtD]iVREQtNĤ3UDJXe: SNTL.1974
~4~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
THE ANALYSIS OF THE CHANGE OF THE SHEAR ANGLE SIN
GIRDERS WITH THE SUPPORT STIFF RIB AND SEMIRIGID
Witold Basiński1
Abstract
The analysis of the resistance and research of corrugated web girders made of shipped elements framed with
sheet metals of end-plate connections indicates the meaning influence of support ribs on critical shearing
stresses. In corrugated web girders with support ribs can be sheet metals of end-plate connections. The present
paper shows experimental research of the influence of the bending stiffness of support sheet metals on change of
the shear angle of the web. Experimental research was conducted on two groups of models made of WTA, WTB
and WTC girders, heights: 1000 and 1500, made of shipped elements joined by end-plate connections.
The girders were loaded symmetrically by two concentrated forces. The static equilibrium paths of the shear
angle P(γ) were determined. It was demonstrated that correct designing of SIN girder ends influenced on change
sizes of the shear angle of the web and consequently raising of critical shearing stresses.
Słowa kluczowe
dźwigary SIN, kąt odkształcenia postaciowego, żebro podporowe
1
WPROWADZENIE
Analiza nośności postaciowej [1, 2, 3, 4, 5] oraz badań dźwigarów z falistym środnikiem zbudowanych
z elementów wysyłkowych obramowanych blachami połączeń doczołowych wskazuje na znaczący wpływ żeber
podporowych na krytyczne naprężenia styczne środnika dźwigarów SIN a tym samym zmianę kąta odkształcenia
postaciowego. W dźwigarach z falistym środnikiem rolę żebra podporowego pełnią blachy połączenia
doczołowego.
W tym celu przeprowadzono badania doświadczalne dwóch grup modeli wykonanych w skali 1:1 swobodnie
podpartych dźwigarów SIN złożonych z elementów wysyłkowych o wysokościach 1000 i 1500 łączonych
poprzez połączenia doczołowe. Na podstawie badań wyznaczono ścieżki równowagi statycznej kąta
odkształcenia postaciowego P(γ). Pokazano, jak wpływ sztywności giętnej podporowych blach czołowych
wpływa na zmianę wielkości kąta odkształcenia postaciowego środnika dźwigarów SIN a tym samym na
podniesienie krytycznych naprężeń stycznych.
2
BADANIA DOŚWIADCZALNE
W celu zbadania wpływu sztywności żeber podporowych na zmianę kąta odkształcenia postaciowego oraz
podniesienie krytycznych naprężeń stycznych modele badawcze podzielono na dwie grupy.
Pierwszą grupę modeli badawczych stanowiły trzy dźwigary złożone z elementów wysyłkowych o długości
3175 i 1500 mm z podporowymi blachami czołowymi grubości 25 mm spełniającymi funkcję żeber podatnych
(rys 1 a). W drugiej grupie przebadano cztery modele badawcze pokazane na rysunku 1b. Dźwigary złożono
1
Dr inż. Witold Basiński, Silesian University of Technology, 44-100 Gliwice, ul. Akademicka 5, +48 32
2371127,[email protected]
~5~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
z elementów wysyłkowych o długościach 2175 i 1500 mm. W celu zwiększenia sztywności żeber podporowych
do czołowych bach podporowych dokręcono teowniki. Boczne żebra teowe o przekroju pokazanym na rys. 1 d
przykręcano do dźwigarów bez użycia sprężenia.
Środniki modeli I i II grupy dźwigarów wykonano ze stali S235, natomiast pasy ze stali S275.
W połączeniach elementów wysyłkowych I i II grupy modeli dźwigarów dano blachy czołowe grubości 25 mm.
Elementy wysyłkowe badanych modeli dźwigarów łączono poprzez połączenia doczołowe na śruby. Doczołowe
połączenia śrubowe sprężono za pomocą śrub M 24 klasy 10.9.
a)
c)
b)
d)
Fig. 1. Modele z falistym środnikiem a) modele I grupy z blachą czołową 300x25 mm; b) modele II grupy
z blachą czołową i dokręconym teownikiem; c) obramowanie podporowe szczegół A; d) obramowanie
podporowe szczegół B
3
WYZNACZANIE ŚCIEŻEK RÓWNOWAGI STATYCZNEJ P(γ) (SPRS) KĄTA
ODKSZTAŁCENIA
POSTACIOWEGO
DŹWIGARÓW
O
FALISTYM
ŚRODNIKU Z CZOŁOWYM OBRAMOWANIEM
Zmianę kąta odkształcenia postaciowego γ falistego środnika modeli dźwigarów zobrazowano na przykładzie
ścieżek równowagi statycznej SRS P(γ). Wielkości kąta odkształcenia postaciowego γ określono na podstawie
pomiaru zmiany długości przekątnych oraz boków ramy pomiarowej (fig. 2) począwszy od obciążenia P = 0 kN
aż do wartości granicznej obciążenia.
Fig. 2. Zmiana kąta odkształcenia postaciowego γ w środniku falistym
Na rys. 3a pokazano przykładową SRS P(γ) kąta odkształcenia postaciowego modelu dźwigara M 1.21
z podporową blachą czołową 300x25 mm, a na rys. 3b z podporową blachą czołową 300x25 i dokręconym
teownikiem do czoła modelu M 2.31. Na SRS P(γ) obrazujących zmianę kąta odkształcenia postaciowego
oznaczono współrzędne punktów charakterystycznych oraz odpowiadające im nośności dźwigarów. Jako
kryterium nośności krytycznej VkRL środnika przyjęto przejście krzywej P(γ) z liniowej w nieliniową co
~6~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
odpowiadało pojawieniu się linii ukośnych załomów plastycznych w falistym środniku. SRS P(γ) sporządzono
do nośności granicznej dźwigarów.
Punkty charakterystyczne o współrzędnych P1(γ1), P2(γ2) na rys. 4 rozdzielają przedziały: 0 – P1(γ1) – przedział
liniowy czyli odwracalny zmiany kąta odkształcenia postaciowego środnika, P1(γ1) – P2(γ2) – nieliniowy
przedział zmiany kąta odkształcenia postaciowego czyli formowania się i przyrastania pól ciągnień oraz linii
załomów plastycznych w środniku. W obydwu przedziałach kumulują się przemieszczenia od zginania i od sił
poprzecznych w środniku. Przedział pomiędzy P1(γ1) – P2(γ2) jest przedziałem nośności nadkrytycznej.
W modelach z dokręconym teownikiem usztywniającym żebro podporowe nastąpiło zwiększenie przedziału
liniowej zmiany kata odkształcenia postaciowego 0 – P1(γ1) środnika co spowodowało przesunięcie
współrzędnej P1(γ1) wskazujące na zwiększenie krytycznej siły poprzecznej.
Zakres zmiany kąta odkształcenia postaciowego w zakresie dokrytycznym wyniósł w modelach z podporowym
żebrem podatnym od 0,060 do 0,080. Natomiast w modelach z żebrem usztywnionym teownikiem zwiększył się
do 0,090 i okazał się zgodny ze zwiększeniem krytycznych naprężeń stycznych sfałdowanego środnika.
W zakresie pokrytycznym zmiana kąta odkształcenia postaciowego stała się nieliniowa i zwiększała się do 10.
a)
Fig. 3. Ścieżki równowagi statycznej P(γ) modeli dźwigarów z podporową blachą czołową 300x25 mm
a) M 1.21;b) M 1.31; c) M 1.51.
4
OSZACOWANIE
KRYTYCZNYCH
NAPRĘŻEŃ
STYCZNYCH
W DŹWIGARACH SIN Z ŻEBREM PODPROWYM SZTYWNYM I PODATNYM
NA PODSTAWIE ZMIANY KĄTA ODKSZTAŁCENIA POSTACIOWEGO
Krytyczne naprężenia styczne falistego środnika stowarzyszone ze zmianą stanu równowagi falistego środnika
modeli z żebrem podporowym sztywnym i podatnym oszacowano na podstawie kąta odkształcenia
postaciowego dla współrzędnej P1(γ1) z niniejszych badań z zależności (1) [7]:
τ kr = γG ,
(1)
gdzie: γ – pomierzony kąt odkształcenia postaciowego, G – moduł odkształcalności poprzecznej równy 80 GPa.
W celu porównania naprężeń krytycznych wyznaczonych na podstawie zmiany kata odkształcenia postaciowego
oszacowano naprężenia wynikłe z pomierzonej krytycznej siły poprzecznej. Krytyczne naprężenia styczne
wyznaczono z zależności (2) [2]:
τ kr = VkRL h w t w ,
(2)
gdzie: VkRL – pomierzona krytyczna siła poprzeczna, hw – wysokość środnika, tw – grubość środnika.
Zestawienie wyników badań krytycznych naprężeń stycznych środników modeli z blachą czołową 300x25 mm;
oraz modeli II grupy z blachą czołową i dokręconym teownikiem uzyskanych na podstawie pomiaru kąta
odkształcenia postaciowego podano w tablicy 1.
~7~
11th International Conference on New Trends in Statics and Dynamics of Buildings
Środnik
hw*tw
Pas
Podporowe
żebra
czołowe
Globalna
nośność
graniczna
Ngr
Krytyczna
siła
poprzeczna
wg badań
VkRL
1
M 1.21
M 1.31
M 1.51
M 2.21
[mm]
2
1000*2,5
1000*2,5
1500*2,0
1000*2,0
[mm]
3
300x15
300x15
300x15
300x15
[kN]
5
725
745
828
621
M 2.31
1000*2,5
300x15
M 2.41
1000*3,0
300x15
M 2.51
1500*2,0
300x15
[mm]
4
300x25
300x25
300x25
300x25
+teownik
300x25
+teownik
300x25
+teownik
300x25
+teownik
Model
October 2013, Bratislava
[kN]
6
570
605
600
570
Naprężenia
krytyczne
z pomiaru
kąta
odkształcenia
postaciowego
wg [1]
[MPa]
7
102,7
96,0
90,2
119,3
Naprężenia
krytyczne
z pomiaru
krytycznej
siły
poprzecznej
wg [2]
[MPa]
8
114,0
121,0
100,0
142,5
894
740
145,9
148,0
1035
830
129,2
138,3
857
746
100,3
124,3
Tab. 1. Zestawienie krytycznych naprężeń stycznych falistego środnika uzyskanych na podstawie pomiaru kąta
odkształcenia postaciowego oraz krytycznej siły poprzecznej.
Krytyczne naprężenia styczne okazały się w modelach z dodatkowym usztywnieniem żeber podporowych od 11
do 42 % większe w stosunku do modeli żebrem podporowym podatnym. Zwiększenie sztywności podporowych
żeber czołowych skutkowało zwiększeniem zakresu zmiany kąta odkształcenia postaciowego w zakresie
dokrytycznym a tym samym wzrostem krytycznych naprężeń stycznych falistego środnika.
5
WNIOSKI
Dźwigary SIN są ustrojami wewnętrznie statycznie niewyznaczalnymi. Wymiary środnika, pasów i żeber w tym
połączeń wzajemnie wpływają na kąt odkształcenia postaciowego oraz naprężenia krytyczne.
Zwiększenie sztywności podporowych żeber czołowych wpływa na zwiększenie zakresu zmiany kąta
odkształcenia postaciowego w zakresie dokrytycznym. Powoduje zatem zwiększenie przedziału liniowej zmiany
kąta odkształcenia postaciowego 0 – P1(γ1) środnika, czyli zwiększenie krytycznej siły poprzecznej.
Zwiększenie zarówno kąta odkształcenia postaciowego jak i krytycznych naprężeń stycznych dźwigarów
z dodatkowym usztywnieniem żeber podporowych w postaci dokręconych teowników wyniosło od 11 do 42%.
PODZIĘKOWANIE
Ten artykuł został oparty na badaniach finansowanych przez Narodowe Centrum Nauki (grant No. N N506
072538)
LITERATURA
[1]
[2]
[3]
[4]
[5]
[6]
[7]
Basiński W. – Kowal Z.: Model sztywności obrotowej doczołowych połączeń odkształcalnych dźwigarów
o falistym środniku. LII Konferencja Naukowa KILIW PAN i KNPZITB. Krynica 2006, t2, p. 99 – 106.
Basiński W. – Kowal Z.: O postaciowej nośności dźwigarów z falistym środnikiem. Inżynieria
i Budownictwo 4/2008, p. 197 – 200.
Basiński W. – Kowal Z.: The impact of corrugated web stiffness on SIN girder deflections in the light of
experimental research. Proceedings of the 10th International Conference on New Trends in Statics and
Dynamics of Buildings, Bratislava, October 3-5, 2012, p. 64÷71.
Basiński W. – Kowal Z.: Wpływ sztywności blach czołowych na postaciową wytrzymałość krytyczną
dźwigarów o falistym środniku. Konstrukcje Stalowe 6/2013, p. 50 – 54.
Kowal Z.: Dźwigary blachowe z użebrowaniem pionowym i przekątnym. Zeszyty Naukowe Politechniki
Wrocławskiej. Budownictwo XXI. Wrocław 1964.
Profile z falistym środnikiem SIN. Zasady wymiarowania. Politechnika Krakowska. Kraków 2002.
PN-EN 1993-1-5. Eurokod 3: Projektowanie konstrukcji stalowych. Część 1 – 5, Blachownice. 2008.
~8~
WK
3URFHHGLQJVRIWKH ,QWHUQDWLRQDO&RQIHUHQFHRQ
1HZ7UHQGVLQ6WDWLFVDQG'\QDPLFVRI%XLOGLQJV
2FWREHU%UDWLVODYD6ORYDNLD
)DFXOW\RI&LYLO(QJLQHHULQJ678%UDWLVODYD
6ORYDN6RFLHW\RI0HFKDQLFV6$6
$1$/,=$:3à<:8ĝ&,$10852:$1<&+1$6=7<:12ĝû
.216758.&-,6=.,(/(72:(-
$%HOLQD
$EVWUDFW
,QWKHSDSHUZDVVKRZQWKHDQDO\VLVRIWKHLPSDFWRILQGLYLGXDOFRPSRQHQWVLQWKHIRUPRIORDGEHDULQJPDVRQU\
ZDOOVRQWKHRYHUDOOVWLIIQHVVRIWKHIUDPHVWUXFWXUH&RPSDUDWLYHDQDO\VLVRIGLVSODFHPHQWQRGHVZHUHWKHPDLQ
VXEMHFW7KLVLQLWLDOGHVLJQZDVWKHFRQVWUXFWLRQRIWKHURRIVXSSRUW,WZDVUHSODFHGRQVNHOHWDOVWUXFWXUHNHHSLQJ
WKHERG\RIWKHFKXUFK0RGHOHGZDOOVDVFODGGLQJZHUHUHSODFHGRQSDQHOVZKLFKFDQFDUU\ORDGV)XUWKHUPRUH
WKHDQDO\VLVRIVWLIIQHVVRIFKRVHQH[LVWLQJUHLQIRUFHGFRQFUHWHEXLOGLQJEDFNERQHGHSHQGLQJRQWKHV\VWHPDQG
PDVRQU\PDWHULDOFRRSHUDWLQJZLWKDVNHOHWRQZDVFRQGXFWHG
23,62*Ï/1<2%,(.78
$QDOL]LH V]W\ZQRĞFL SRGGDQ\ MHVW RELHNW NWyU\ MHVW EXGRZOą VDNUDOQą NRĞFLyá SZ ĝZ -DFND Z *OLZLFDFK
=DVDGQLF]D F]ĊĞü MHVW MHGQRNRQG\JQDF\MQD %XG\QHN MHVW MHGQRVHJPHQWRZ\ QLHZ\G]LHORQ\ G\ODWDFMDPL
RZ\PLDUDFKJDEDU\WRZ\FKU]XWXZSR]LRPLHSDUWHUX[P3RVDGRZLHQLHMHVW]DSURMHNWRZDQLHMDNR
EH]SRĞUHGQLH QD áDZDFK SRG ĞFLDQDPL WUyMZDUVWZRZ\PL L VWRSDFK IXQGDPHQWRZ\FK SRG UG]HQLDPL
GRVWRVRZDQ\FK GR REFLąĪHĔ :DUVWZD QRĞQD ĞFLDQ WR FHJáD SHáQD NODV\ 03D R JU P QD ]DSUDZLH
FHPHQWRZHM]GRGDWNLHPPOHNDZDSLHQQHJRPDUND03D:DUVWZDL]RODF\MQD±VW\URSLDQP:DUVWZD
OLFRZD ± FHJáD SHáQD R JUXERĞFL P FHJáD 03D ]DSUDZD 03D 3RNU\FLH ]RVWDáR Z\NRQDQH MDNR
GDFKyZNDFHUDPLF]QDQDáDWDFKGUHZQLDQ\FK*áyZQąNRQVWUXNFMĊQDZ\VWDQRZLąEHONLĪHOEHWRZHRZ\PLDUDFK
SU]HNURMX SRSU]HF]QHJR [ P ]DáDPDQH Z U]XFLH SRGSDUWH Z SXQNWDFK ]DáDPDĔ NRQVWUXNFMDPL
SU]\SRURZ\PL &DáNRZLWD UR]SLĊWRĞü EHOHN Z\QRVL P : VNUDMQ\FK SXQNWDFK EHONL RSDUWR QD VáXSDFK
ĪHOEHWRZ\FKRSU]HNURMXNRáRZ\PRĞUHGQLF\P
02'(/2:$1,(
'RDQDOL]\NRQVWUXNFMLSRVáXĪRQRVLĊSURJUDPHP$XWRGHVN5RERW6WUXFWXUDO$QDO\VLV0RGHO]RVWDáZ\NRQDQ\
Z IRUPLH ' (OHPHQWRP NRQVWUXNF\MQ\P QDGDQR FHFK\ PDWHULDáRZH FKDUDNWHU\VW\NL JHRPHWU\F]QH ZDUXQNL
SRGSDUFLD ZDUXQNL SRáąF]HQLD SRV]F]HJyOQ\FK HOHPHQWyZ QD SRGVWDZLH RSLVX WHFKQLF]QHJR RUD]
RERZLą]XMąF\FKQRUP3RáąF]HQLDSUĊWyZ]DPRGHORZDQRMDNRV]W\ZQH
3U]\PRGHORZDQLXHOHPHQWyZMDNRRNáDG]LQZDĪQ\PMHVWQDGDQLHNLHUXQNXUR]NáDGXREFLąĪHQLD5R]NáDGWHQQD
GDFKX GRNRQXMH VLĊ SR RVL < SU]\ ORNDOQ\P XNáDG]LH ZVSyáU]ĊGQ\FK : WHQ VSRVyE REFLąĪHQLD ] ZDUVWZ
Z\NRĔF]HQLRZ\FKSU]HND]DQH]RVWDá\QDSáDWZLHDQDVWĊSQHQDNROHMQHHOHPHQW\NRQVWUXNF\MQHMDNGĨZLJDU\
ZLHĔFHF]\VáXS\3U]\ĞFLDQDFKNWyUHZ\NRQDQHVą]FHJá\L]DPRGHORZDQRMDNRSU]\OHJDMąFHGRVáXSyZRUD]
EHOHN SU]\MĊW\ UR]NáDG REFLąĪHĔ MHVW UyZQLHĪ SR RVL < ZLĊF NROHMQ\PL HOHPHQWDPL SU]HQRV]ąF\PL REFLąĪHQLD
ZáDVQH RUD] ]HZQĊWU]QH ]H ĞFLDQ Vą EHONL :V]\VWNLH ]HVWDZLDQH REFLąĪHQLD REOLF]RQR MDNR REFLąĪHQLD
FKDUDNWHU\VW\F]QHLREOLF]HQLRZH
0JU HQJ $ %HOLQD $NDGHPLFND *OLZLFH 3RODQG WHOHSKRQH PRELOH PDLODOHNVDQGUDEHOLQD#SROVOSO
~9~
WK
,QWHUQDWLRQDO&RQIHUHQFHRQ1HZ7UHQGVLQ6WDWLFVDQG'\QDPLFVRI%XLOGLQJV
2FWREHU%UDWLVODYD
$1$/,=$,
$QDOL]D V]W\ZQRĞFL PD QD FHOX ]HVWDZLHQLH PDNV\PDOQ\FK SU]HPLHV]F]HĔ RUD] SRUyZQDQLH VWUHI Z NWyU\FK
Z\VWĊSXMą3U]HPLHV]F]HQLDHOHPHQWyZRGF]\W\ZDQHVąEH]LFKZ\PLDURZDQLDGODWHJRSURJUDP5RERWWUDNWXMH
HOHPHQWĪHOEHWRZ\ MDNR EHWRQRZ\ 3UDFXMH RQ SU]H] WR Z ID]LH VSUĊĪ\VWHM D QLH VSUĊĪ\VWRSODVW\F]QHM GODWHJR
ZDUWRĞFL SU]HPLHV]F]HĔQLH Vą ]JRGQH ]U]HF]\ZLVW\PL L Vą RG QLFK PQLHMV]H UD]\ 3DQHOH Vą WR HOHPHQW\
ZPRGHOXQXPHU\F]Q\PG]LĊNLNWyU\PPRĪQD]DPRGHORZDüHOHPHQW\SRZáRNRZHWDNLHMDNĞFLDQ\F]\Sá\W\
VWURSRZH :DĪQą LFK FHFKą MHVW PRĪOLZRĞü QDGDQLD LP U]HF]\ZLVW\FK ZáDĞFLZRĞFL PDWHULDáX ] NWyU\FK
Z\NRQDQHVąĞFLDQ\F]\VWURS\]DSRPRFąSDUDPHWUyZWDNLFKMDNPRGXá<RXQJD(ZVSyáF]\QQLN3RLVVRQD‫ݝ‬
ZVSyáF]\QQLN.LUFKKRIID*FLĊĪDUZáDĞFLZ\JZ\WU]\PDáRĞüREOLF]HQLRZD5:SU]\SDGNXFHJá\Z\QRV]ąRQH
RGSRZLHGQLR I N 03D Z\WU]\PDáRĞü REOLF]HQLRZD PXUX QD ĞFLVNDQLH ( 03D ‫ ݝ‬
* 03D J N1 REFLąĪHQLH SU]\áRĪRQH SRZLHU]FKQLRZR 2NáDG]LQ\ QDWRPLDVW Vą WR HOHPHQW\
ZPRGHOXQXPHU\F]Q\PNWyU\FKMHG\Q\P]DGDQLHPMHVWSU]HND]\ZDQLHSU]\áRĪRQ\FKGRQLFKREFLąĪHĔQDLQQH
HOHPHQW\NRQVWUXNF\MQHQRĞQH'RDQDOL]\Z\NRQDQ\FK]RVWDáRVLHGHPPRGHOLNRĞFLRáD
)LJ 0RGHOHNRQVWUXNFML]]D]QDF]RQ\PLÄĞFLDQDPLSDQHODPL´RUD]PRGHOQUZSURJUDPLH5RERW
:\N 3U]HPLHV]F]HQLDZĊ]áyZSRRVL;GODFDáHMNRQVWUXNFML
2Ğ;MHVWWRRĞXNLHUXQNRZDQDZ]GáXĪNRQVWUXNFML$QDOL]XMąFZ\NUHVSRZ\ĪHMPRĪQD]DXZDĪ\üLĪQDMZLĊNV]H
ZDUWRĞFL SU]HPLHV]F]HĔ SR GDQHM RVL X]\VNDQR GOD PRGHOX SLHUZV]HJR FP QDWRPLDVW QDMPQLHMV]H GOD
RVWDWQLHJRFPJG]LHOLF]ED]DPRGHORZDQ\FKSDQHOLMHVWQDMZLĊNV]D5yĪQLFDSRPLĊG]\QLPLZ\QRVL
'ODPRGHOXGUXJLHJRZDUWRĞFLVąMHG\QLHRPQLHMV]HRGQDMZLĊNV]\FK:QLPMDNRSDQHOH]DPRGHORZDQHVą
ĞFLDQ\ NWyUH XPLHMVFRZLRQH Vą SURVWRSDGOH GR RVL ; MHG\QLH Z GROQHM F]ĊĞFL NRQVWUXNFML 1DWRPLDVW GRGDQLH
ĞFLDQZJyUQHMF]ĊĞFLNRQVWUXNFMLZSRSU]HNRELHNWX]QDF]ąFR]PQLHMV]DSU]HPLHV]F]HQLDZ]JOĊGHPZDUWRĞFL
X]\VNDQ\FK GODPRGHOX ,, ± R FP F]\OL 7DNĪH ]DPRGHORZDQLH ĞFLDQ R ZáDĞFLZRĞFLDFK FHJá\ SHáQHM
ZPRGHOX REOLF]HQLRZ\P QD FDáHM Z\VRNRĞFL SURVWRSDGOH GR DQDOL]RZDQHM RVL ]PQLHMV]D SU]HPLHV]F]HQLD
~ 10 ~
WK
,QWHUQDWLRQDO&RQIHUHQFHRQ1HZ7UHQGVLQ6WDWLFVDQG'\QDPLFVRI%XLOGLQJV
2FWREHU%UDWLVODYD
SUDZLH GZXNURWQLH :\QLNL WH Vą QDMEOLĪV]H W\P X]\VNDQ\P JG]LH ĞFLDQ\ Vą Z SHáQL X]XSHáQLHQLHP V]NLHOHWX
NRQVWUXNFML
ÄĝFLDQ\SDQHOH´XPLHMVFRZLRQHUyZQROHJOHGRRVL;PDMąZLĊNV]H]QDF]HQLHRG]DPRGHORZDQ\FKSURVWRSDGOH
: SU]\SDGNX ]DPRGHORZDQLD LFK MHG\QLH Z GROQHM F]ĊĞFL RELHNWX X]\VNXMHP\ V]W\ZQRĞü R ZLĊNV]ą
ZSRUyZQDQLX ] PRGHOHP NRQVWUXNFML V]NLHOHWRZHM QDWRPLDVW SRSU]H] GRGDQLH ĞFLDQ Z JyUQHM F]ĊĞFL 0RGHO 9, JG]LH ĞFLDQ\ Z GROQHM F]ĊĞFL RELHNWX ]DPRGHORZDQH Vą SR REZRG]LH SRVLDGD ]EOLĪRQH Z\QLNL GR
PRGHOX,92]QDF]DWRĪH]DPRGHORZDQLHĞFLDQGRGDWNRZR ZSRSU]HNNRQVWUXNFMLQLH]PLHQLDPDNV\PDOQHM
ZDUWRĞFL SU]HPLHV]F]HĔ Z]GáXĪ GDQHM RVL :LĊNV]ą V]W\ZQRĞü SRZLQQ\ PLHü PRGHOH ]H ĞFLDQDPL
]DPRGHORZDQ\PLZ]GáXĪNRQVWUXNFML$MHGQDNZPRGHOX,,,JG]LHĞFLDQ\VąZSU]HFLZQ\PNLHUXQNXZDUWRĞFL
SU]HPLHV]F]HĔVąEDUG]RPDáH:Sá\ZQDWDNLVSDGHNZDUWRĞFLPLDáRSRáRĪHQLHĞFLDQ(NVWUHPDSU]HPLHV]F]HĔ
]ORNDOL]RZDQH Vą ZH ZV]\VWNLFK PRGHODFK ZQDMZ\ĪV]\FK SXQNWDFK RELHNWX ĝFLDQ\ XVWDZLRQH SRSU]HF]QLH
ZNRQVWUXNFML]QDMGXMąVLĊQDMEOLĪHMW\FKSXQNWyZGODWHJRWHĪSU]HPLHV]F]HQLDRGUyĪQLąMąVLĊRGUHV]W\PRGHOL
.ROHMQ\ Z\NUHV SU]HGVWDZLD PDNV\PDOQH SU]HPLHV]F]HQLD Z]JOĊGHP RVL < -HVW WR RĞ XNLHUXQNRZDQD
SRSU]HF]QLHGRNRQVWUXNFML
:\N 3U]HPLHV]F]HQLDZĊ]áyZSRRVL<GODFDáHMNRQVWUXNFML
1DMZLĊNV]H ZDUWRĞFL Z\VWĊSXMą Z SLHUZV]\P PRGHOX FP QDWRPLDVW QDMPQLHMV]H Z RVWDWQLP FP
:DUWRĞFL WH ĞZLDGF]ą R W\P LĪ ]DVWRVRZDQLH X]XSHáQLHQLD NRQVWUXNFML V]NLHOHWRZHM Z IRUPLH ĞFLDQ
RZáDĞFLZRĞFLDFK FHJá\ SHáQHM GDMH ZLĊNV]ą V]W\ZQRĞü R =DVWRVRZDQLH ÄĞFLDQSDQHOL´ Z NLHUXQNX
SRSU]HF]Q\PMHG\QLHZGROQHMF]ĊĞFL]PQLHMV]DSU]HPLHV]F]HQLDR1DMZLĊNV]DUyĪQLFDSRPLĊG]\QLPL,,
D9, Z\QRVL =DPRGHORZDQLH ĞFLDQ SU]\ SRPRF\ SDQHOL QD FDáHM Z\VRNRĞFL Z]GáXĪ NUyWV]HJR ERNX
RELHNWX ]ZLĊNV]D V]W\ZQRĞü NRQVWUXNFML R 5yZQLHĪ UyĪQLFH SRPLĊG]\ PRGHODPL ]H ĞFLDQDPL
XPLHMVFRZLRQ\PL QD FDáHM Z\VRNRĞFL Vą QLHZLHONLH 1DMZLĊNV]D SRPLĊG]\ PRGHOHP ,,, D 9,, Z\QRVL :SU]\SDGNXSU]HPLHV]F]HĔ8<QDMZLĊNV]H]QDF]HQLHPDOLF]ED]DVWRVRZDQ\FKSDQHOLRUD]WRF]\]QDMGXMąVLĊ
RQH W\ONR Z GROQHM F]\ WHĪ JyUQHM F]ĊĞFL RELHNWX :H ZV]\VWNLFK PRGHODFK PDNV\PDOQH SU]HPLHV]F]HQLH 8<
]ORNDOL]RZDQHMHVWGODZĊ]áDSRáąF]HQLDSáDWZLPQLHMZLĊFHMZĞURGNXUR]SLĊWRĞFLGĨZLJDUDJáyZQHJRGDFKX
$1$/,=$,,
: QDVWĊSQ\P HWDSLH DQDOL]D REHMPXMH SRUyZQDQLH PRGHOL]UyĪQ\PL PDWHULDáDPL Z\NRU]\VWDQ\PL Z EXGRZLH
ĞFLDQ'RWHMDQDOL]\Z\EUDQRSR]DNRQVWUXNFMąV]NLHOHWRZąWU]\PRGHOH3LHUZV]\]QLFKWRPRGHONRQVWUXNFML
V]NLHOHWRZHM PRGHO , GUXJL ]H ĞFLDQDPL XPLHMVFRZLRQ\PL Z SRSU]HN NRQVWUXNFML PRGHO ,,, QDVWĊSQ\ ]H
ĞFLDQDPL Z]GáXĪ RELHNWX PRGHO 9 2VWDWQL PRGHO WR NRQVWUXNFMD ] ]DPRGHORZDQ\PL ZV]\VWNLPL ĞFLDQDPL
QRĞQ\PL MDNR SDQHOH R ZáDĞFLZRĞFLDFK GDQHJR PDWHULDáX PRGHO 9,, -DNR SLHUZV]\ PDWHULDá Z\NRU]\VWDQR
FHJáĊ SHáQą ZJ SURMHNWX EXGRZODQRDUFKLWHNWRQLF]QHJR LVWQLHMąFHJR RELHNWX .ROHMQ\P PDWHULDáHP
Z\NRU]\VWDQ\P Z PRGHOX GR DQDOL]\ MHVW SXVWDN 0$; -HJR ZáDĞFLZRĞFL ZPRGHOX REOLF]HQLRZ\P WR
I N 03D ( 03D ‫ * ݝ‬03D J N1 7U]HFL PDWHULDá SRGGDQ\ DQDOL]LH WR
SXVWDN3RURWKHUPRZáDĞFLZRĞFLDFK I N
03D (
03D‫ * ݝ‬03DJ N1
:\N 3U]HPLHV]F]HQLDZĊ]áyZZ]GáXĪRVL;GODFDáHMNRQVWUXNFML
~ 11 ~
WK
,QWHUQDWLRQDO&RQIHUHQFHRQ1HZ7UHQGVLQ6WDWLFVDQG'\QDPLFVRI%XLOGLQJV
2FWREHU%UDWLVODYD
:\N 3U]HPLHV]F]HQLDZĊ]áyZZ]GáXĪRVL<GODFDáHMNRQVWUXNFML
:1,26.,,32'6802:$1,(
3RUyZQDQLX SRGOHJDáR PRGHOL NRQVWUXNFML .RĞFLRáD SZ ĝZLĊWHJR -DFND R]PLHQLRQHM NRQVWUXNFML : SUDF\
]PLHQLRQR NRQVWUXNFMĊ ĞFLDQRZą LVWQLHMąFHJR RELHNWX QD V]NLHOHWRZą 'DOHM SU]HNV]WDáFDQR ĞFLDQ\
]DPRGHORZDQH MDNR RNáDG]LQ\ QD SDQHOH 0RGHO Z\MĞFLRZ\ PRGHO , MHVW W\SRZą NRQVWUXNFMą V]NLHOHWRZą
ZNWyU\P ĞFLDQ\ ]DPRGHORZDQH MDNR RNáDG]LQ\ SU]HND]\ZDá\ MHG\QLH REFLąĪHQLD QD LQQH HOHPHQW\
NRQVWUXNF\MQH-HG\QLHVWURS\ZSRVWDFLSDQHOLVąXV]W\ZQLHQLHPSR]LRP\PRELHNWX
$QDOL]XMąF Z\NUHV\ SU]HPLHV]F]HĔ 8; 8< ]DXZDĪRQR ĪH QDMZLĊNV]H ZDUWRĞFL X]\VNDQR Z PRGHOX
NRQVWUXNFML V]NLHOHWRZHM PRGHO , QDWRPLDVW QDMPQLHMV]H Z RVWDWQLP 9,, JG]LH ÄĞFLDQ\SDQHOH´ Vą
X]XSHáQLHQLHP SHáQHJR V]NLHOHWX ĪHOEHWRZHJR 2]QDF]D WR ĪH NRQVWUXNFMD R HOHPHQWDFK QRĞQ\FK WDNLFK MDN
ĪHOEHWRZHEHONLVáXS\MHVWQDMEDUG]LHMSRGDWQDQDGHIRUPDFMĊSRGZSá\ZHPREFLąĪHĔZáDVQ\FKL]HZQĊWU]Q\FK
3R DQDOL]LH Z\NUHVX SU]HPLHV]F]HĔ 8; VWZLHUG]RQR ĪH SRQDG GZXNURWQLH ZLĊNV]ą V]W\ZQRĞü X]\VNDQR SU]\
]DPRGHORZDQLX ĞFLDQ SRSU]HF]Q\FK VLĊJDMąF\FK QDMEOLĪHM QDMZ\ĪV]\FK SXQNWyZ RELHNWX $ WR GOD QLFK
RGQDMG\ZDQR HNVWUHPXP SU]HPLHV]F]HĔ 'OD LQQ\FK PRGHOL Z\QLNL E\á\ MHG\QLH R PQLHMV]H RG W\FK
X]\VNDQ\FKZNRQVWUXNFMLV]NLHOHWRZHM3RGVXPRZXMąFNRQVWUXNFMDV]NLHOHWRZDZ\ND]XMHQDMZLĊNV]HZDUWRĞFL
SU]HPLHV]F]HĔ Z]JOĊGHP ZV]\VWNLFK RVL ,FK VSDGHN ]QDF]ąFR ]DOHĪQ\ MHVW RG OLF]E\ ĞFLDQ R ZáDĞFLZRĞFLDFK
FHJá\LXPLHV]F]HQLDLFKQDMEOLĪHMHOHPHQWyZ]QDMZLĊNV]\PLSU]HPLHV]F]HQLDPL6DPNLHUXQHNSDQHOL]JRGQLH
] NLHUXQNLHP SU]HPLHV]F]HĔ QLH RGHJUDá ZLĊNV]HM UROL 3RSU]H] ]DPRGHORZDQLH ĞFLDQ MDNR SDQHOL Z FDáHM
NRQVWUXNFMLX]\VNDQRGZXNURWQLHZLĊNV]ąV]W\ZQRĞüNRQVWUXNFML
:SU]\SDGNXZ\NUHVyZ8;QDMPQLHMV]ąV]W\ZQRĞüX]\VNDQRSU]\]DVWRVRZDQLXSXVWDND0$;'ODPRGHOL,,,
RUD]9,,UyĪQLFHVąGRĞü]QDF]ąFHZSRUyZQDQLXGRNROHMQ\FKPDWHULDáyZ3U]\FHJOHVąRQHZPRGHOX]H
ĞFLDQDPL XPLHMVFRZLRQ\PL Z]GáXĪ NUyWV]HJR ERNX RELHNWX SU]\ SXVWDNX 3RURWKHUP ± Z]GáXĪ GáXĪV]HJR
1DWRPLDVW RVWDWQLD NRQVWUXNFMD 9,, Z\UyZQDáD ZDUWRĞFL GOD W\FK GZyFK PDWHULDáyZ 8PLHMVFRZLHQLH
HNVWUHPyZ GOD ZV]\VWNLFK SU]\SDGNyZ MHVW EDUG]R SRGREQH :DUWRĞFL SU]HPLHV]F]HĔ GOD SXVWDND 0$; Vą
QDMZLĊNV]H 1DMZLĊNV]H HNVWUHPD GDOHM RGQDMGXMą VLĊ Z PRGHOX , QDMPQLHMV]H ± Z PRGHOX 9,, 5yĪQLFH
SRPLĊG]\ PRGHODPL GOD ZV]\VWNLFK ĞFLDQ Vą QLHZLHONLH RN D VSDGHN XZDUXQNRZDQ\ MHVW OLF]Eą
]DPRGHORZDQ\FKĞFLDQMDNRSDQHOL,PWDOLF]EDZLĊNV]DW\PSU]HPLHV]F]HQLDPQLHMV]H
3RGVXPRZXMąF SU]\ ]DVWRVRZDQLX ZVSyáSUDFXMąFHJR Z\SHáQLHQLD Z NRQVWUXNFML V]NLHOHWRZHM ZH ZV]\VWNLFK
NLHUXQNDFK RUD] QD FDáHM Z\VRNRĞFL RELHNWX X]\VNXMHP\ QDMZLĊNV]ą V]W\ZQRĞü -HVW RQD GZXNURWQLH ZLĊNV]D
QLĪJG\E\ĞFLDQQLHEUDQRSRGXZDJĊ
/,7(5$785$
>@ $XJXVW\Q-±.DUSH]R=2]DVWRVRZDQLXNRQVWUXNFMLVWDORZ\FKZEXGRZQLFWZLHVDNUDOQ\P,QĪ\QLHULD
L%XGRZQLFWZRQU
>@ /LVLN$$UFKLWHNWXUDVDNUDOQD3URMHNW\LUHDOL]DFMH:\G3ROĝO*OLZLFH
>@ 3DZáRZVNL$3ROVNLIHQRPHQEXGRZQLFWZDVDNUDOQHJRZODWDFK,QĪ\QLHULDL%XGRZQLFWZRQU
>@ 6HNFMD.RQVWUXNFML%HWRQRZ\FK.,/L:3$13RGVWDZ\SURMHNWRZDQLDNRQVWUXNFMLĪHOEHWRZ\FK
LVSUĊĪRQ\FKZHGáXJ(XURNRGX'ROQRĞOąVNLH:\G(GXNDF\MQH:URFáDZ
>@ 6WDURVROVNL : .RQVWUXNFMH ĪHOEHWRZH ZHGáXJ 31% L (XURNRGX :\G 1DXNRZH 3:1
:DUV]DZD
>@ :LáXQ==DU\VJHRWHFKQLNL:\G.RPXQLNDFMLLàąF]QRĞFL:DUV]DZD
>@ ĩPXGD-3RGVWDZ\SURMHNWRZDQLDNRQVWUXNFMLPHWDORZ\FK:\G$UNDG\:DUV]DZD
~ 12 ~
Proceedings of the 11th International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
DYNAMIC RESPONSE OF BUILDINGS AND STRUCTURES DUE
TO INDUSTRIAL MACHINERY EFFECTS
J. Benþat1 and M. Stehliková2
Abstract
In this paper a dynamic characterization and vibration analysis has been used for the detection and
identification of the machine processing condition and the effect of the production machinery vibration on
building complex structures and production process. For sensitive process machines and structures dynamic
response due to production machinery calculation procedures was applied using experimental input data via
spectral analysis.
Key Words
Industrial machine vibration, ground vibrations, experimental tests, vibration monitoring, spectral analysis.
1
INTRODUCTION
In production hall all machines vibrate and, as the state of the machines worsens their vibration level increase
and this cause increasing of the structure vibration level, too. An ideal indicator on this state, especially dynamic
behavior is obtained via measuring and by supervising the vibration level produced by a machine. While the
increase in machine vibration allows us to detect a defect, the analysis of the machine vibration characteristics
makes it possible to identify its cause. The analysis in frequency domain is generally carried out when the
machine vibratory level is considered to be higher than the acceptable threshold [2]. This kind of vibrations if
excessive can damage to nearby buildings and structures and also can negative affect the process in industrial
production halls.
2
INDUSTRIAL MACHINERY VIBRATIONS
The industrial production machinery process may cause undesirable vibrations transmitted from machine
foundations via ground to production hall structures as well as nearby buildings and environment. The ground
vibration due to these man activities recorded at a distance from machine foundations is analyzed assuming it to
be a random and statistically stationary function of time. This kind of vibrations if excessive can damage to
nearby buildings and structures. Vibration which usually also has a negative impact on security and stability of
the structures, facilities performance and people should be controlled by experimental analysis and the results
compared (spectral picks limit, vibration levels, etc.) with relevant standards prescription values and criteria
[3,4]. In the paper case study there is describes the analysis of vibrations caused by unfavorable production
machinery effects on hall structures and production process in Justur a.s. St. Turá industrial plant [1].
______________________________
1
Prof. Ing. Ján Benþat PhD, Department of Structural Mechanics, Faculty of Civil Engineering, University of
Žilina, Univerzitná 1, 010 26 Žilina, E–mail: [email protected], Tel.: + 421 903 543 673
2
Ing. Mária Stehlíková PhD, Department of Structural Mechanics, Faculty of Civil Engineering, University of
Žilina, Univerzitná 1, 010 26 Žilina, E–mail: [email protected], Tel.: + 421 911101652
~ 13 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
The results of the theoretical and experimental investigation of vibrations caused by production machinery on the
buildings structures were analyzed mainly from aspects of the safety of the building structures and the influence
of vibrations on production process conditions.
2.1
Assessment of building vibration due to industrial activities
Assessment of building vibration due to industrial activities caused by production machines is a problem that can be
solved through the application of research. This research consists mainly of defining the relationship between
intensity fluctuations in the soil, the vibration energy quantity and the distance from the vibration source.
Through intensity fluctuations can appear in different physical quantities, such as the oscillation velocity,
acceleration, frequency, ground motion intensity, displacement and energy. There are accessible several
standards in the field of measurement of vibration regarding the building vibration limits in the European Union,
USA, Australia, ISO codes and others. In Slovakia in the field of measuring and assessing of building vibrations
due to ground motion the most commonly used standard is Slovak Standard STN EN 1998 – 1/NA/Z1[3] based on
EC8 and Slovak Standard STN 73 0032 [4], (In Slovak).
2.2
Machine effects on building structure and production process experimental analysis
This paper section shortly described study of the unfavorable production machinery effects on industrial building
complex structures and also on vibration–sensitive production process in industrial plant of the Justur a.s. St. Tura
(company). The complex of industrial processing buildings in the processing building is fully described in [1]. The
most sensitive part of the industrial processing buildings is the processing building M1 used for special medical
articles production, which is tailored to accurate technological processes. This building is joined with the next
processing building M2 by partition wall. The vibrations caused by unfavorable production traditional tool
machinery effects in this building disrupted vibration sensitive operations (CNC lathe MORI SEIKI SL–204) in
adjacent processing building M1 even they have unfavorable effects on M1 structure with vibration velocities
amplitude only vmax > 6,0 mm/s. To determine harmful machine vibration sources and to regulate their
working regime, it was need to perform experimental measurements and monitoring of the machines – related
vibrations and compare to the low–vibration fabrication machines criteria or relevant Standards.
Experimental procedure and device. The industrial processing buildings dynamic response (M1) due to
traditional tool machinery in building M2 were measured in relevant structure points by accelerometers BK –
8306. The output signals from the accelerometers were preamplified and recorded on portable PC equipped with
A/D converters of the software packages NI and DISYS, (Fig.1). The experimental analysis has been carried out
in the Laboratory of the Department of Structural Mechanics, CEF, University of Žilina [1]. The machines and
structure vibrations frequencies were obtained using spectral analysis of the recorded response dynamic
components, which are considered as ergodic and stationary. Spectral analysis (power spectra, PSD) was
performed via National Instrument software package NI LabVIEW.
Fig. 1. Set of accelerometers with amplifiers and measuring laptop in acquisition configuration to measure floor
and mounts vibrations of the CNC lathe MORI SEIKI SL–204 ( BK4)
Building structure dynamic response (BSDR) machines dynamic response (MDS). The main purpose of the
dynamic tests in the building M1 was to determine the structure vibrations level and machines vibrations level
(in common processing regime and in out of operation regime) due to machinery effects working in building M2
and to compare to the limiting value recommended by machines producer (CNC lathe MORI SEIKI SL–204)
~ 14 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
prescription vibration level or standard level [3,4]. In this case machine producer prescription was not available.
To reach dynamic analysis target (BSDR, MDS) it was reason to carry out 2 series of experimental
measurements and 14 days continual monitoring of the dynamic response of the M1 buiding structure at selected
representative points, [1].
During the first series of tests and 14 days monitoring in the both halls (M1,M2) it was performed normal
production progress of work and in the process there were measured in selected points vibration level values vmax
(mm/s) and max vrms (mm/s) that are summarized in Fig. 2. As the measured vibration level values for the
structure fundament (BK3) and the most sensitive production equipment CNC lathe Mori Seiki, SL – 204 (BK5)
had higher values than the standard upper limits of the vibration level [3,4] (machine producer prescription
vibration level was not available) it was necessary to perform the machines working regime adjusting in the hall
M2 to obtain the required allowable vibration velocity. After the machines working regime adjusting in hall M2
there were performed the second series of tests in the same points and procedure as during the first series of tests.
The summarized measured vibration velocity values with their upper standard limits are plotted in Fig. 2. As an
example of the machines induced vibrations analysis results in frequency domain (PSD) and time domain
(velocities amplitude time history – v(t)) of the structure fundament (BK3) and on the most sensitive production
equipment CNC lathe Mori Seiky, SL – 204 (BK5) are plotted on Fig. 3.
6
25
b)
a)
5
20
4
15
3
10
2
5
1
0
0
BK1
BK2
BK3
BK4
Xdirection
BK5
BK5a
BK6
BK7
Ydirection
BK8
BK1
BK5z(M)
BK2
BK3
BK4
Xdirection
Zdirection
Upper limit for structure (STN 730032)
Upper limit for machines (STN 730032)
BK5
BK5a
BK6
Ydirection
BK7
BK8
Zdirection
Upper limit for structure (microtremor)
STN EN 1998–1/NA/Z1
Fig. 2. Amplitude of extreme velocities values vmax (mm/s) of the tests: a) 1th series and monitoring. b) 2nd series
The comparison of the measured vibration velocities extreme levels (after adjusted machine regime) and
standard limits suggests fulfilling standards required criteria vmax < 25 (mm/s) [3] and vmax < 6,0 (mm/s) [4] for
hall M1 structure where measured value vmax = 5,8 (mm/s) [1] and also for sensitive production equipment
was fulfilled required standard criterium vmax < 1,0 (mm/s) [4] when measure value on the machine lathe Mori
Seiki frame vmax = 0,76 (mm/s) [1]. According to the results of the structure spectral analysis the structure basic
natural frequencies have values f(n) < 10 Hz [1], it means there is no resonance effect because the exciting
machines frequencies are over the 15 Hz, see Fig. 3.
[m /s ]
0 .0 3
a)
[m /s ]
b)
0 .0 2
0 .0 0 0 5
0 .0 0 0 2 5
0 .0 1
0
0
-0 .0 0 0 2 5
-0 .0 1
-0 .0 0 0 5
0
5
10
15
20
t[s ]
25
[m /s ]
0
5
10
15
20
t[s ]
25
[m /s ]
0 .0 3
0 .0 0 0 5
0 .0 2
0 .0 0 0 2 5
0 .0 1
0
0
-0 .0 0 0 2 5
-0 .0 1
-0 .0 0 0 5
8 .5
9
9 .5
10
1 0 .5
11
1 1 .5
t[s ]
[(m /s )^ 2 /H z ]
1 8 ,3 3 H z
2 .5 E -0 5
1 .5 E -0 5
16
17
18
19
20
t[s ]
1 8 ,3 3 H z
2 1 ,9 4 H z
2 E -0 5
1 .5 E -0 5
1 E -0 5
2 2 ,1 7 H z
5 .E -0 6
15
[(m /s )^ 2 /H z ]
2 E -0 5
1 E -0 5
1 4 ,7 1 H z
10
5 .E -0 6
20
30
40
50
[H z ]
0
1 4 ,7 1 H z
10
2 5 ,7 1 H z
20
30
40
50
[H z ]
Fig. 3. Time histories v(t) and PSD Gvv(f) during a) monitoring (BK3), b) 2nd series of tests (BK5)
~ 15 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
CONCLUSIONS
This paper presents an overview of the analysis of vibrations caused by unfavorable production machinery
effects on building structures and production process, too. The results of the theoretical and experimental
investigation of vibrations caused by production machinery dynamic effects in hall M2 on the M1 hall structures
were analyzed mainly from aspects of the safety of the building structure and the influence of vibrations on
production process conditions in production buildings M1 of the industrial plants Justur a.s. St. Turá. Based on
the results presented in the paper the following conclusions can be drawn:
i) Since the most sensitive production equipment CNC lathe Mori Seiki, during production process had
high vibration level it was necessary to perform in the hall M2 the machines working regime adjusting
to obtain the required allowable vibration velocity for failure free production process. The machines
regime adjusting caused to reduce vibration level of the sensitive production equipment about 52%.
The comparison of the measured vibration velocities level and standard limits suggests fulfilling
required criteria for sensitive production equipment.
ii) The relevant calculated data values following from experimental spectral and amplitude analysis of the
production hall M1 structure dynamic response (spectral picks limit, vibration levels, etc.) were
compared with relevant standards prescription values and criteria. From these comparisons it follows
that all standards prescription values and criteria regarding building structure were fulfilled.
ACKNOWLEDGEMENT
We kindly acknowledge the research project VEGA, Nr.G1/0169/12 granted by Scientific Grant Agency of the
Slovak Republic Ministry of Education. We should also like to thank the Civil Engineering Faculty – University
of Žilina for additional feed in this field research activity.
REFERENCES
[1]
Bencat, J. et al.: Assessment of the structure and precision production machine dynamic response in Justur
a.s. St. Tura, Report PC 22/SvF/10, University of Žilina, (2011).
[2]
Newmark, M. S. et al.: Monitoring Construction Vibrations at Sensitive Facilities, Acentech Incorporated,
Cambridge, Massachusetts, (2011).
[3]
Slovak National Annex to Eurocode 8, Design of structures for earthquake resistance. Part 1: General rules,
seismic actions and rules for buildings, (In Slovak). STN EN 1998–1/NA/Z1. SUTN, Bratislava, (2010).
[4]
Slovak Standard, Calculation of buildings structures loaded by dynamic effect of machines (In Slovak).
STN 73 0032, SUTN, Bratislava, (2005).
~ 16 ~
Proceedings of the 11th International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
BENDING RESISTANCE OF CURVED BEAMS ACCORDING TO
EUROCODE STN EN 1993
Miriam Brzáþová 1, Yvonna Koleková 2
Abstract
Detailed verification of stability of given large span steel arch in its plane by two different methods given in
Eurocodes [1, 2, 3]: a) by equivalent column method(uniform cross-section), b) by global analysis taking into
account the second order effects and relevant imperfections according to Tab.D.8 [2](non-uniform crosssection). Calculation of internal forces by computer program IQ 100 [5] using 1st and 2nd order analysis with
and without imperfections (Fig.2,3,4,5). Comparison of results (Table 1).
Key words
Steel, stability, arch, second order effects, imperfections, Eurocode
1
INTRODUCTION
Characteristics of given structure:
steel parabolic arch with span L
relative half length of the arch
y( x )
L
4
f x§ x·
s
¨1 ¸ and
L
L L© L¹
330 m , rise/span ratio
I/A
0.130 . The shape of arch
2
2
ª
ª
ºº
1« § f ·
L
f
§ f ·
¨ 4 ¸ 1 ln «4 ¨ 4 ¸ 1 » »
»»
4« © L¹
4f « L
© L¹
¬
¼¼
¬
210 GPa , steel grade S355 , f y
Properties of uniform cross-section: area A
i2
43 m
330 m
y§f x·
¨ , ¸ and
L©L L¹
s§f ·
¨ ¸ , which are defined by expressions
L©L¹
Material properties: Young modulus E
the cross-section h
f
L
0.522 , respectively.
335 MPa ( t ! 40 mm) , J M 1 1.1 .
0.415 m 2 , in plane second moment of area I 1.72 m 4 , height of
5m, in plane elastic section modulus W
0.686 m 3 , in plane radius of inertia
4.145m 2 . Class 3 cross-section has buckling curve „c“.
1
Bc.Miriam Brzáþová, Faculty of Civil Engineering, Slovak University of Technology in Bratislava,, Radlinského 11, 813 68 Bratislava
Assoc. Prof. Ing. Yvonna Koleková, PhD., Department of Structural Mechanics, Faculty of Civil Engineering, Slovak University of
Technology in Bratislava, Radlinského 11, 813 68 Bratislava, [email protected], 00421(0)259274332
2
~ 17 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
Properties of non-uniform cross-section: the area changes according to A k
moment of area I k
W
1,72m 4
m 4 , height of the cross-section h
cos(ij k )
> @
0.686 m 3 , in plane radius of inertia i 2
I/A
October 2013, Bratislava
0,415m 2
m 2 , in plane second
cos(ij k )
> @
5m
, in plane elastic section modulus
cos(ij k )
4.145m 2 . Class 3 cross-section has buckling curve „c“.
Boundary conditions:
a) In plane: translation fixed and rotation fixed on both ends (hingeless arch),
b) Out of plane: translation fixed and rotation fixed on both ends (hingeless arch); the arch is laterally supported
and no lost of stability out of plane may occur.
Design values of actions:
a) Permanent action uniform along the length of arch span g d 0.12127 MN / m ,
b) Variable action constant along the left half length of arch span q d
0.03546 MN / m ,
c) In plane imperfection according to table D.8 in [2]: the shape of two asymmetric waves with design value of
amplitude e o r L / 400 r320 m / 400 r0.825 m (hingeless arch, buckling curve „c“ in table D.8). Uniform
mean value of action along the length of arch span q m ,d g d 0.5q d
0.12127 0.5 * 0.03546
0.139 MN / m .
q m.d L2 0.139 * 330 2
44.0032 MN .
8f
8 * 43
Replacement of initial imperfections according to table D.8 by equivalent action
8He o
q equ.eo r
r0.010667 MN / m .
0.5L 2
Horizontal component of thrust H
d) Combination of design values of actions:
for 1st and 2nd order analysis without imperfections (results see in Fig.4 and Fig.6 respectively):
in left half of arch span length q l.d g d q d 0.12127 0.03546 0.15673 MN / m ,
in right half of arch span length q r.d
st
gd
0.12127 MN / m ,
nd
for 1 and 2 order analysis with imperfections (results see in Fig.5 and Fig.7 respectively)
in left half of arch span length q l.d g d q d q equ.eo 0.12127 0.03546 0.010667 | 0.1674 MN / m ,
in right half of arch span length q r.d
g d q equ.eo
0.12127 0.010667 | 0.1106 MN / m .
1. Internal forces
Parabolic arch was replaced by structure having form of polygon (Fig.1). Arch span was divided into 100 equal
parts. Uniform loading q was replaced by point loads Q. Distributions and values of internal forces N, M, V
may be found in Fig.2, Fig.3, Fig.4, Fig.5.
Values in Fig.2 and Fig.3 were calculated by 1st order analysis without and with imperfections respectively, and
values in Fig.4 and Fig.5 by 2nd order analysis without and with imperfections respectively. Computer program
IQ 100 [5] was used to obtain results. In all calculations influence of normal force deformations were taken into
account.
2. Verification of arch stability
Characteristic and design values of cross-section resistances of uniform cross-section:
NRk
Afy
0.415m2 335MPa 139.025MN , M Rk
Wf y
0.688 m 3 335 MPa
244.24 MNm
NRd Afy / ȖM1 0.415m2335MPa/1.1 126.386MN , MRd Wfy / ȖM1 0.688 m3335 MPa/1.1 222.036MNm
2
~ 18 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Characteristic and design values of cross-section resistances of non-uniform cross-section:
NRk
0.467 m2 335 MPa 156,445 MN , M Rk
Afy
0.688 m 3 335 MPa
Wf y
244.24 MNm
NRd Afy / ȖM1 0.467m2335MPa/1.1 142,223MN , MRd Wfy / ȖM1 0.688 m3335 MPa/1.1 222, 036MNm.
2.1 Stability verification by using equivalent column method
Internal forces (Fig.1):
N Ed , I,q (a ) 49. 3653 MN, M Ed , I,q (a )
91.2525 MNm .
In plane buckling length factor according to table D.4 in [2] ȕ 0.669 .
In plane critical buckling force N cr
Compare it with the value N cr
Į cr
ʌ 2 EI
ʌ 2 210 000 *1.935
301.980 MN ,
ȕs 2 0.669 * 0.522 * 3302
Į cr N Ed , I,q (a )
5.8467 * 49.365
288.622 MN , where
5.8467 is minimum force amplifier for the axial force configuration NEd in members to
reach the elastic critical buckling, which was calculated by IQ 100 [5].
N Rk
N cr
Relative slenderness Ȝ
Measure of imperfection D
Factor ĭ
156.445
288.622
0.736 .
0.49 (class „c“ cross-section).
2
0.5ª1 Į(Ȝ 0.2) Ȝ º
«¬
»¼
>
0.5 1 0.490.736 0.2 0.736 2
1
Reduction factor Ȥ
ĭ ĭ2 Ȝ
1
2
In plane buckling resistance N b , Rd
0.902 0.902 2 0.736 2
ȤA
fy
Ȗ M1
0.703 * 0.467
335
1.1
@
0.902 .
0.703 .
99.983 MN .
Equivalent uniform moment factor for sway buckling mode may be obtained by using method
2 from Annex B in [1]. Cm, y 0.9 and interaction factor is as follows
§
N Ed , I,q (a ) ·
¸
C m , y ¨1 0.6Ȝ bar
¨
N b , Rd ¸¹
©
Utilization factor
k yy
UI
N Ed , I,q (a )
N b, Rd
49.3653 ·
§
0.9¨1 0.6 * 0.736
¸ 1.096 .
99.983 ¹
©
k y C m , y M Ed , I,q (a )
49.365
M Rd
99,983
1.096 * 0.9 * 91.2525
222,036
0.494 0.405
0.899 1.0 .
2.2 Verification of strength by using 2nd order analysis with imperfections according to
table D.8 [2]
Internal forces (Fig.4):
N Ed , II,q ,eo (a )
50. 2131 MN, M Ed , II,q ,eo (a ) 138 .147 MNm ,
Utilization factor
U II
N Ed , II, q , eo (a )
N Rd
M Ed , II, q , eo (a )
50. 213
M Rd
142.223
138.147
222.036
All the Figures can be find in the full Article.
3
~ 19 ~
0.353 0.622
0.975 1.0 .
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
3. SUMMARY
1storderanalysis
accordingto
5.2.2(3)c)[1]
without
imperfections
(hiddenin F )
2ndorderanalysis( Į cr
5.8467 )
withimͲ
perfections
according
without
imperͲ
fections
accordingto5.2.2(3)a)[1]
withimperfectionsaccording
to
toTab.D.8
[2]
Tab.D.8
[2]
44.0032 MN H[MN]
44.506 MN
N(a)
[MN]
Ͳ49.3653
Ͳ49.8743
Ͳ49.7135
M(a)
[MNm]
Ͳ91.2525
Ͳ127.660
Ͳ96.8436
Utility
factor
inlefthalfofarch
0.899
Ͳ50.2131
Ͳ138.147
inpointmඟa
0.975
Table 1: Results of analysis of large span parabolic steel arch according to Eurocodes
References
[1] EN 1993-1-1 Eurocode 3: Design of steel structures. Part 1-1: General rules and rules for
Buildings. CEN Brussels. May 2005. (STN EN 1993-1-1: November 2006).
[2] EN 1993-2 Eurocode 3: Design of steel structures. Part 2: Steel bridges. CEN Brussels.
October 2006. (STN EN 1993-2: December 2007).
[3] EN 1999-1-1 Eurocode 9: Design of aluminium structures. Part 1-1: General structural
rules. CEN Brussels. February 2007. (STN EN 1999-1-1: March 2011).
[4] Dinnik, A. N.: ProdoĐnyj izgib (teorija i priloženija). GONTI. 1939.
[5] Rubin, H. – Aminbaghai, M. – Weier, H.: IQ 100. TU Wien. Vollversion Okt. 2004.
Wolters Kluwer Deutschland GmbH, Werner Verlag.
Acknowledgment
The authors acknowledge support by the Slovak Scientific Grant Agency under the contracts No.
1/1101/12.
4
~ 20 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
NUMERICAL MODEL OF DOUBLY CORRUGATED THINWALLED ELEMENTS BASED ON 3D OPTICAL SCANNING
R. A. Cybulski1
Abstract
This paper describes briefly the construction of numerical model with aid of 3D optical scanning of doubly
corrugated thin-walled steel panels which are used as a solution for arch buildings and roofing structures. As an
example of such system the ABM MIC 120 prefabrication technology is chosen, where factory on wheels makes
cold-formed arch steel buildings or roofs in a very short time period as self-supporting panels. The main
problem of such structures lies in the lack of proper theoretical model of the element due to its complex
geometry. In order to build numerical model for local stability purposes, samples of panels were scanned and
achieved geometries were exported to the finite element method software. The examples of numerical analyses
are also included.
Key Words
Cold-formed, 3D scanning, arch structures.
1
INTRODUCTION
Due to today’s difficult economy, cheap and short time consuming solutions for buildings industry are very
desirable. One of the solution which fulfills above requirements is the ABM (Automatic Building Machine)
technology. It is a mobile factory used to fabricate and construct arch steel buildings based on self-supporting
panels made of MIC 120 profile. This technology comes from the USA and belongs to M.I.C. Industries Inc.
Such technology was commonly used by US army to built temporary buildings and nowadays those structures
become popular solution in civilian life.
There are a few problems connected to this technology. All calculations are made according to American design
codes. This gives a series limitation of use of this system in Europe due to different loads consideration. Also,
there is no proper theoretical model of the panel and surfaces corrugations created during panels bend into arch
are not well understood.
Due to very complex geometry of curved panel, it is almost impossible to build manually a numerical model
which will consists of all geometrical imperfections. In order to reflect the real geometry of corrugated elements,
three dimensional (3D) optical scanning method is proposed and based on that, the numerical models for finite
element method (FEM) analyses are built.
2
3D OPTICAL SCANNING OF CURVED PANELS
In order to scan doubly corrugated thin-walled element, 0.6 m long sample was cut from the arch of radius 10 m.
1
MSc R. A. Cybulski, The Silesian University of Technology, Civil Engineering Department, Akademicka 5,
44-100 Gliwice, Poland, 0048-32-2372994, [email protected]
~ 21 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
The optical scanning device called COMET L3D 2M made by Steinbichler Optotechnik GmbH was chosen.
Such device consists of 2 Mpx photo-camera with 1600 x 1200 resolution and projector which uses so-called
structural light instead of leaser and is connected to the computer.
This system converts the surface geometry into a cloud of high-density numerous points with 3D coordinates. It
has been developed specifically for accurately measuring the surface geometries of items different in size or
parts different in size on the same subject. The resolution and measuring range can be changed according to
necessity.
The brief description of scanning methodology is presented herein.
Firstly, the scanning device must be calibrated. Calibration is needed due to change of camera’s lens and in order
to accommodate the scanning device to surrounding temperature. Three types of camera leans with different
field of vision (FOV) equal to 100, 200 and 400 can be used for discussed scanning device. For the double
corrugated panels, camera lens with FOV equal to 400 has been utilized.
Secondly, after calibration, the object can be put on the rotating platform (Fig. 1). Scanner lightens the tested
object with light of specified structure. Most often the light is white or blue. The device is projecting a set of
lines (fringes) with a given density on the tested object. Then information is collected about the distortion of the
projected lines on the measured surface, which is due to variation of the shape of a given element. From the
recorded sequence, the coordinate of a point can be calculated. The entire process is executed for each pixel and
this is a reason that achieved result is a cloud of points that reflects the shape of the object. Next step is data
transformation called triangulation, where obtained points are changed to the triangular gird. Triangular gird
reflects much better complex shapes of elements than quadratic gird. Due to this, user is achieving a surface of
3D object. Such surface can be saved with file extension called STL, SAT or IGS.
Fig. 1. Scanning of the curved panel
Now, the so-called path of girds can be created. This gird is made from triangular surfaces by connecting them in
larger surfaces. The surfaces boundary is created by paths located on the scanned surface where diametrical
change of geometry is obtained. Such step can be done using Geomagic software for transforming 3D scan data
into highly accurate surfaces which can be exported to CAD and FEM software for reverse engineering, product
design, rapid prototyping and numerical analysis.
Developed model of doubly corrugated thin-walled panel is ready to export to CAD or FEM systems. Fig. 2a
presents exported model of scanned panel to AutoCad system and Fig. 2b to Abaqus software.
a)
b)
Fig. 2. a) AutoCad model, b) Abaqus model
~ 22 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
3
October 2013, Bratislava
USAGE OF SCANNED MODELS
In previous chapter 3D optical scanning was briefly described. Achieved models of straight and curved panels
were exported to commercial FEM software called Abaqus in order to run stability analyses. According to
Authors knowledge based on discussions with companies giving services in optical scanning, such methodology
has not been used yet for buildings structural elements in Poland. The application of optical scanning is very
common in automotive and aerospace industries [1, 2] not only in Poland but especially in Germany, France,
Japan and USA. This chapter will discuss shortly the application of obtained model from the scanning in stability
analyses of plate and shells elements.
3.1 Numerical stability analysis
In order to show differences in behavior of thin-walled elements with and without transverse corrugations, two
numerical models were prepared reflecting straight and curved panels.
Firstly, linear stability analyses were carried out for both kinds of panels in Abaqus with procedure of the type
“linear perturbation, buckling” based on the solution of an eigenvalue problem. Analyzed panels are fabricated
from steel grade S280GD. Young Modulus (E) and Poisson ratio () are equal 210 GPa and 0.3 respectively.
Concentrated axial compression load in present case was chosen as 1N and was applied in the cross-sections
gravity centers. Boundary conditions in both cases are following: on both ends of the sample “rigid body”
elements were used in order to apply external force and supports, on one end (where load was applied) movable
in axial direction pinned support was used, on the second end, non-movable pinned support was applied. Quaddominated mesh was used.
First buckling modes achieved from analyses for straight and curved panels are presented in Fig.3. The buckling
critical forces are equal to 19.5 kN and 112.9 kN for straight and curved panels respectively.
a)
b)
Fig. 3. First buckling modes: a) straight panel, b) curved panel
Secondly, non-linear analyses were carried out in Abaqus with procedure of the type “Static, Riks” based on socalled arc length method [3] which uses load proportionality factor (LPF). For such analyses, the same steel
grade was used as before with basic steel plasticity model where: yield strength fy=280 MPa, ultimate tensile
strength fu=424.5 MPa and plastic strain pl=0.163. Concentrated axial compression loads are equal to 19.5 kN
and 112.9 kN for straight and curved panels respectively and are taken from linear stability investigation.
Boundary conditions are like in previous analyses. The deformations of destroyed elements are presented in
Fig.4. The ultimate forces are equal to 48.4 kN and 35.3 kN for straight and curved panels, respectively.
a)
b)
Fig. 4. Deformation shapes: a) straight panel, b) curved panel
~ 23 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Fig.5a and Fig.5b illustrate obtained load displacement paths for both types of panels where relation between
axial deformation (shortening of an element) and axial compression force is presented.
a)
b)
Fig. 5. Load displacement paths: a) straight panel, b) curved model
4
CONCLUSIONS
From stability analyses of a straight panel it is observed that bifurcation point B lies on equilibrium path before
the point M which is obtained by the analyzed element due to maximum load achievement. Such phenomenon
presents a typical behavior of a thin-walled element without geometrical imperfections and EC design
procedures can be applied.
From stability analyses of a curved panel it can be observed that bifurcation point B does not lie on equilibrium
path before the point M. So surfaces geometrical imperfections play an important role in thin-walled element
behavior and only non-linear stability analysis is able to end up with reasonably results.
Structures built from thin-walled elements with smooth surfaces have visible post-buckling capacity and due to
that, time of collapse is rather longer than the time of collapse of structures made of corrugated panels – the
collapse of doubly corrugated is rapid.
Obtained results from numerical investigation have good agreement with the results achieved on the
experimental way. Laboratory tests on straight and doubly corrugated panels are described in [4].
ACKNOWLEDGEMENT
This paper has been financed by National Science Centre based on grant no. DEC-2011/01/N/ST8/03552.
Author of this paper is a scholar under the project “DoktoRIS- scholarship program for innovative Silesia” cofinanced by European Union under the European Social Fund.
Calculations were possible due to Computational Grant CyfronetMNiSW/IBM_BC_HS21/Plska/028/ 2011.
REFERENCES
[1]
Kus, A.: Implementation of 3D Optical Scanning Technology for Automotive Applications. Sensors, 9:
1967-1979, 2009
[2]
Li, L. - Schemenauer, N. - Peng, X. - Zeng, Y. - Gu, P.: A reverse engineering system for rapid
manufacturing of complex objects. Robotics and Computer-Integrated Manufacturing, 18: 53–67, 2002.
[3]
Memon, B. - Xiao-zu. S.: Arc-length technique for nonlinear finite analysis. Journal of Zhejiang University
Science, 5: 618–628, 2004.
[4]
Walentyski, R. - Cybulski, R.- Kozieł, K.:. Achilles’ heel of the ABM 120 double corrugated profiles. In:
N. Jendzelovsky, eds., New Trends in Statics and Dynamics of Buildings, 25–28. Slovakia University of
Technology in Bratislava, Bratislava, 2011.
~ 24 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
MODEL OF INTERACTIVE SYSTEM:
CONCRETE FOUNDATION – MINING SUBSOIL
S. Dawczyski1
Abstract
The paper proposes and presents model of interactive system: building foundation – mining subsoil. The model
can be used mainly to calculate and check foundations of the existing buildings (e.g. in situations when mining is
planned under the building not protected against mining impacts). Innovation of such solution is simultaneous
use of various elastic-plastic material models for concrete and soil. Concrete foundation was modelled with the
use of five-parameters Willam-Warnke model and mining subsoil was modelled with the use of elastic perfectly
plastic Drucker-Prager model. Additional contact elements of zero thickness were employed in the planes of
contact of these two mediums. Program ANSYS was used for numeric analyses. Main advantage of presented
model is ease of modification of boundary conditions depending on material properties as well as intensity of
mining impacts.
Key Words
Concrete foundations; Mining subsoil; Mining subsidence; Material models; Numerical analysis.
1
INTRODUCTION
As a result of underground mining exploitation disturbance to rockmass balance state takes place. Resulting from
it additional stresses and deformations causes deformations of soil surface layer. In situation if building is
erected on mining subsoil, despite standard combination of loads, mining impacts should be additionally taken
into account in calculations.
2
MATERIAL MODELS
2.1 Subsoil
The representation of the properties of the ground subjected to the impact of adverse effects resulting from
underground mining, elastic – perfectly plastic material model proposed by Drucker and Prager was used.
Boundary surface of this criterion - the formula (1) - after application of the relevant coefficients (, k) can be
written as a function of the first invariant of stress and the second invariant of stress deviator.
(
σ
F I1 , J 2
σ
)= α ⋅ I
σ
1
σ
+ J2 − k = 0
(1)
Using simple algebraic transformations, the Drucker-Prager outer boundary surface equation, in the form in
which it was adopted in numerical analysis in this paper, can be given with the following equation:
2 ⋅ 2 ⋅ sin φ
2 ⋅ 2 ⋅ c ⋅ cos φ
⋅ σ okt + τ okt −
=0
3 − sin φ
3 − sin φ
1
(2)
Dr. S. Dawczyski, Silesian University of Technology, Akademicka 5, 44-100 Gliwice, Poland,
+48322372262, [email protected]
~ 25 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Failure criterion for the Drucker-Prager model assumes that the decisive factor is energy of the non-dilatational
strain. In a complex stress state, this assumption is not always true. On the other hand, to the undeniable
advantages of DP criteria include:
• smoothness of the boundary surface in the octahedral stress (clarity in the interpretation and numerical
applications),
• full circular symmetry of deviatoric section so that continuity of the derivative is obtained,
• convexity of deviatoric section (so called Drucker condition is fulfilled),
• relatively easy to implement criteria for numerical application (hence the prevalence and popularity of this
model in professional computer programs).
2.2 Concrete
For the purpose of numerical analysis of the concrete foundation, a modified model of Willam and Warnke was
adopted, which is approximating the results of laboratory strength tests in a better way. In contrast to the threeparameters model (WW-3) with the straight meridians, in the five-parameters criterion (WW-5) the meridians
forming the boundary surface are curved (are constructed of a second order parabola).
Boundary surface of five-parameters Willam and Warnke model can be written by the equation:
F (σ m ,τ m ,θ ) =
1
⋅
τm
r (σ m ,θ ) f c
−1 = 0
(3)
In the general case, where the boundary surface (F) of WW-5 model is given by (3), the failure criterion for
concrete in triaxial state of stress can be defined as:
Γ
−F ≥0
fc
(4)
where is a function of stress state.
The presented five-parameters material model proposed by Willam and Warnke:
• has good compatibility with the experimental results,
• stands out among the other models of smooth and convex surface boundary (which avoids the ambiguity of
interpretation associated with other criteria in the singular points of the section collapse),
• has uniquely determined gradient and continuous derivative at any point of the considered surface,
• includes the special cases of the other theoretical criteria,
• has a surface boundary which opens in the direction of the axis of high hydrostatic stresses (triaxial
compression), but the bulge curvature causes that in range of very large compressive stresses, the surface
intersects the hydrostatic axis in a certain place (each meridian elsewhere).
2.3 Contact layer
For all the contact surfaces between the physically differing materials (concrete and soil), additional, completely
vulnerable, surface contact elements were modelled. These eight-nodes elements with zero thickness took
geometrical characteristics compatible with solid elements on which they were defined. Applied surface contact
layer allows, inter alia, an occurrence of a slip as a result of loosening ground deformation.
3
SUMMARY
In previous studies regarding structure interaction with the mining subsoil, models based on the theory of
elasticity have been dominated. Presented in the paper a different approach depended on the use of the elasticplastic models for both parts of the system is innovative and will certainly contribute to a more accurate analysis
on the impact of mining deformation on structures. Numerical model presented in the paper can be used as a tool
to analyse existing structures (in the interacting systems of known boundary conditions) as well as to evaluate
effort status of the foundation constructions e.g. in case of function alteration or reconstruction of the given
structure (when only loading capacity changes and other parameters are not altered). Undoubtedly a valuable
advantage of the presented model is the ease of changing the various boundary conditions, as well as the
possibility to obtain complete results for each finite element at each stage of the calculation.
ACKNOWLEDGEMENT
This paper has been prepared as part of INSYSM project 251373 FP7-PEOPLE-2009-IAPP funded by European
Union.
~ 26 ~
WK
3URFHHGLQJVRIWKH ,QWHUQDWLRQDO&RQIHUHQFHRQ
1HZ7UHQGVLQ6WDWLFVDQG'\QDPLFVRI%XLOGLQJV
2FWREHU%UDWLVODYD6ORYDNLD
)DFXOW\RI&LYLO(QJLQHHULQJ678%UDWLVODYD
6ORYDN6RFLHW\RI0HFKDQLFV6$6
5(86(2)35(&$676758&785$/(/(0(176
6'DZF]\ĔVNL-%URODQG.$GDPF]\N
$EVWUDFW
)URPERWKHFRQRPLFDQGHQYLURQPHQWDOUHDVRQVWKHLGHDRIUHXVHRIZKROHVWUXFWXUDOHOHPHQWVEHFRPHPRUHDQG
PRUHSRSXODUDOORYHUWKHZRUOG,WVHHPVWREHSDUWLFXODUO\VLJQLILFDQWWKHFRPPRQUHXVHRISUHFDVWHOHPHQWV
UHLQIRUFHGFRQFUHWH DQG SUHVWUHVVHG SUHWHQVLRQHG FRQFUHWH SUHIDEULFDWHV DOLNH 6XFK HOHPHQWV DUH UHODWLYHO\
HDV\WRGLVPDQWOHDQGWRWDNHDZD\IRUQH[WXVH
,Q3RODQGWKHSUHFDVWVWUXFWXUDOV\VWHPVKDVEHHQLQFRPPRQXVHVLQFHHDUO\VWKHUHIRUHWKHJUHDWQXPEHU
RI VWUXFWXUHV WR \HDUV ROG KDYH WR EH GLVDVVHPEOHG QRZDGD\V PDLQO\ GXH WR FKDQJHV LQ IXQFWLRQDO
GHPDQGV8QIRUWXQDWHO\WKHUHDUHQRSUDFWLFDOJXLGHOLQHVZKDWSURFHGXUHRIWHVWLQJDQGDVVHVVPHQWVKRXOGEH
XVHGWRTXDOLI\DQGFDWHJRUL]HWKHPHPEHUVIRUUHXVH7KLVZDVWKHPDLQUHDVRQWRLQLWLDWHWKHUHVHDUFKSURJUDP
FRQFHUQLQJDOOLVVXHVRIUHXVHRIZKROHVWUXFWXUDOHOHPHQWV
.H\:RUGV
5HXVHRI5&HOHPHQWV/DERUDWRU\WHVWV3UHFDVWHOHPHQWV5HXVHJXLGHOLQHV
,1752'8&7,21
5HXVH RI ZKROH VWUXFWXUDO HOHPHQWV LV D GLIILFXOW EXW SRVVLEOH LVVXH 6XFK D SURFHGXUH ZLOO OLPLW WKH ODQGILOO
GLVSRVDORIPDWHULDOVWKDWFDQEHUHXVHGWKHUHE\UHGXFLQJFRQWDPLQDWLRQRIWKHHQYLURQPHQWZKLFKLVHVVHQWLDO
IRUWKHVXVWDLQDEOHGHYHORSPHQWRIWKHFRQVWUXFWLRQLQGXVWU\LQFOXGLQJWKHHQYLURQPHQWDODVSHFWV
6XVWDLQDEOH GHYHORSPHQW LQ WKH FRQVWUXFWLRQ LQGXVWU\ VKRXOG FRYHU WKH HQWLUH OLIH F\FOH RI WKH EXLOGLQJ IURP
GHVLJQ WKURXJK ZKROH SHULRG RI XWLOL]DWLRQ XQWLO LWV GHPROLWLRQ >@ ,Q HDFK RI WKHVH SHULRGV WKH LPSDFW RI
EXLOGLQJVRQWKHHQYLURQPHQWVKRXOGEHPLQLPL]HGE\PLQLPL]LQJWKHHQHUJ\GHPDQGDQGWKHXVHRIEXLOGLQJ
PDWHULDOVVKRXOGEHRSWLPL]HGLQFOXGLQJWKHSRVVLELOLW\RIWKHLUIXWXUHUHXVH
,Q GHOLEHUDWLRQV RI WKH QHHGV DQG PHULWV RI UHF\FOHG EXLOGLQJ PDWHULDOV LV LPSRUWDQW WR WKH IDFW WKDW WKH
FRQVWUXFWLRQLQGXVWU\LVVWLOORQHRIWKHPDMRUSURGXFHUVRIZDVWHLQWKHZRUOG>@7KXVWKHPRUHZHZLOOEHDEOH
WRREWDLQPDWHULDOVIRUUHXVHWKHPRUHZHVDYHHQHUJ\DQGQDWXUDOUHVRXUFHVEHFDXVHWKHUHLVQRQHHGWRSURGXFH
QHZPDWHULDOVDQGWKHVPDOOHUZLOOEHFRVWVDVVRFLDWHGZLWKWKHGLVSRVDORUVWRUDJHRIZDVWH>@
,QWKHFXUUHQWHFRQRPLFVLWXDWLRQHYHU\DFWLRQRIWKHPRVWHQYLURQPHQWDOO\IULHQGO\PXVWEHVDQFWLRQHGOHJDOO\
DQG HFRQRPLFDOO\ ,Q RUGHUWR EXLOGLQJ PDWHULDOVUHF\FOLQJZDV SURILWDEOH VRPH DFWLRQV PXVW EH WDNHQ LQ ERWK
DGPLQLVWUDWLYHHJDSSURSULDWHOHJLVODWLRQSURKLELWLQJWKHGLVSRVDORIZDVWHZKLFKFDQEHUHXVHGLQODQGILOOVLWHV
RULQFUHDVLQJWKHFRVWRIVXFKVWRUDJHDQGWHFKQLFDODQDSSURSULDWHFKRLFHRIWRROVDQGGHPROLWLRQWHFKQLTXHV
GHSHQGLQJRQWKHW\SHRIPDWHULDOWRDFTXLUH>@
'U 6 'DZF]\ĔVNL 6LOHVLDQ 8QLYHUVLW\ RI 7HFKQRORJ\ $NDGHPLFND *OLZLFH 3RODQG
V]\PRQGDZF]\QVNL#SROVOSO
'U - %URO 6LOHVLDQ 8QLYHUVLW\ RI 7HFKQRORJ\ $NDGHPLFND *OLZLFH 3RODQG
MDQXV]EURO#SROVOSO
06F . $GDPF]\N 6LOHVLDQ 8QLYHUVLW\ RI 7HFKQRORJ\ $NDGHPLFND *OLZLFH 3RODQG
NDWDU]\QDDGDPF]\N#SROVOSO
~ 27 ~
WK
,QWHUQDWLRQDO&RQIHUHQFHRQ1HZ7UHQGVLQ6WDWLFVDQG'\QDPLFVRI%XLOGLQJV
2FWREHU%UDWLVODYD
352326$/)255(86(2)5&35(&$670(0%(56
,Q FDVH RI UHLQIRUFHG FRQFUHWH RU SODLQ FRQFUHWH VWUXFWXUHVUHXVH RI µROG¶ VWUXFWXUHV LQ 3RODQG LV FRQILQHG WR D
FUXVKLQJ RI FRQVWUXFWLRQV DQG REWDLQLQJ LQ WKLV ZD\ DJJUHJDWHV DQG VWHHO LQ WKH IRUP RI VFUDS $JJUHJDWHV
REWDLQHG LQ WKLV ZD\ DUH UHXVHG LQ FLYLO HQJLQHHULQJ 2QH SDUW RI WKLV DJJUHJDWH LV XVHG DV D PDWHULDO IRU QHZ
VWUXFWXUDOHOHPHQWVDQGWKHRWKHUHVSHFLDOO\LQ8SSHU6LOHVLDUHJLRQLQVRXWKHUQ3RODQGLVXVHGDVDVXEJUDGHRI
WKH QHZ URDGV DQG KLJKZD\V 1RZDGD\V WKLV SKHQRPHQRQ PDNHV KDUG WKH DFTXLVLWLRQ RI UHLQIRUFHG FRQFUHWH
HOHPHQWVIURPGLVPDQWOHGEXLOGLQJVIRUODERUDWRU\WHVWLQJ
'HVSLWHDYHU\KLJKGHPDQGGXHWRWKHFRQVWUXFWLRQRIKLJKZD\VRQFUXVKHGDJJUHJDWHZKLFKFXUUHQWO\VROYHV
WKHSUREOHPRIµFRQFUHWHZDVWH¶LQ8SSHU6LOHVLDWKLVSKHQRPHQRQGRHVQRWKDYHDSHUPDQHQWFKDUDFWHUDQGLQ
WKH QHDU IXWXUH WKH SUREOHP ZLOO FRQWLQXH WR JURZ 7KHUHIRUH WKHUH LV D QHHG IRU UHVHDUFK GHYHORSPHQW RQ
DOWHUQDWLYHPDWHULDOVDQGHOHPHQWVIURPGHPROLVKHGEXLOGLQJV
3UHFDVWPHPEHUVIURPGLVPDQWOHGUHLQIRUFHGFRQFUHWHVWUXFWXUHVRIIHUVFRQVLGHUDEOHSRWHQWLDOIRUWKHUHFRYHU\RI
WKHHOHPHQWVLQRUGHUWRUHXVH
,Q3RODQGDVLJQLILFDQWGHYHORSPHQWRISUHFDVWVWUXFWXUHVWRRNSODFHLQWKH
VDQG
VRIODVWFHQWXU\,QSXEOLF
EXLOGLQJVPDGHRIUHLQIRUFHGFRQFUHWHWKHPRVWFRPPRQO\XVHGZHUHSUHFDVWURRIVODEVDQGSUHFDVWIORRUVODEV
,QLQGXVWULDOEXLOGLQJVDOVRZHUHXVHGSUHFDVWVSDQGUHOEHDPVFUDQHEHDPVDQGFROXPQV0DQ\REMHFWVIURPWKLV
SHULRGDQGWKH\HDUVIROORZLQJIRUYDULRXVUHDVRQVDUHGHPROLVKHGQRZ7KHUHDVRQIRUWKHGHPROLWLRQLVXVXDOO\
ODFNRIFRVWHIIHFWLYHSRVVLELOLWLHVRIDGDSWLQJRIWKHVHEXLOGLQJVLQDZD\WKDWPHHWVWKHFXUUHQWUHTXLUHPHQWVDQG
IXQFWLRQDOVSHFLILFDWLRQV0RVWRIWKHUHLQIRUFHGFRQFUHWHHOHPHQWVIURPWKHGHPROLWLRQLVGLVSRVHGWRODQGILOORU
DWEHVWWRFRQFUHWHFUXVKLQJSODQW
7KHLPSRUWDQWLVVXHLVWKDWWKHUHDUHQRUXOHVDFFRUGLQJWRZKLFKLWZRXOGEHSRVVLEOHWRDVVHVVDQGFODVVLI\IRU
UHXVHQRWRQO\UHLQIRUFHGFRQFUHWHHOHPHQWVEXWDQ\VWUXFWXUDOPHPEHUV
)XUWKHU GHYHORSPHQW RI FRQFUHWH FRQVWUXFWLRQ VKRXOG WDNH LQWR DFFRXQW WKHLU DELOLW\ WR UHFRYHU WKH VWUXFWXUDO
PHPEHUVHVSHFLDOO\SUHFDVWRQHV5HXVDELOLW\FRQFHUQVPDLQO\UHLQIRUFHGFRQFUHWHSUHFDVWURRIHOHPHQWVIORRU
VODEV EHDPV VSDQGUHO EHDPV FUDQH EHDPV DQG FROXPQV $OWKRXJK WKHVH ODVW WKUHH HOHPHQWV FROXPQV FUDQH
EHDPVDQGVSDQGUHOEHDPVREWDLQHGIURPWKHGHPROLWLRQRILQGXVWULDOEXLOGLQJVDUHGLIILFXOWWRUHXVHGXHWRWKHLU
VSHFLILFQDWXUHFRQFHUQLQJWKHVL]HDQGORDGFDSDFLW\
3ULQFLSOHVRIFODVVLILFDWLRQRIHOHPHQWVIURPGHPROLWLRQVIRUUHXVHPXVWEHFRQFHUQLQJSODLQFRQFUHWHUHLQIRUFHG
FRQFUHWHDQGSUHVWUHVVHGFRQFUHWHWDNLQJLQWRDFFRXQWWKHGHVLJQVWDQGDUGVDSSOLFDEOHWRWKHSHULRGIURPZKLFK
WKHHOHPHQWVDUH
$QGWKHUHIRUHWKHSURMHFWVRIGHPROLWLRQVKRXOGLQFOXGHLQWHUDOLD
DJHQHUDOGHVFULSWLRQRIWKHEXLOGLQJ
DVWUXFWXUDOGHVFULSWLRQRIWKHEXLOGLQJ
DSUHOLPLQDU\DVVHVVPHQWRIWKHWHFKQLFDOFRQGLWLRQRIWKHVWUXFWXUDOHOHPHQWV
LQGLFDWLRQRIWKHSRVVLEOHHOHPHQWVIRUUHXVHWRJHWKHUZLWKWKHLULQYHQWRU\
LGHQWLILFDWLRQRIZD\VRIEXLOGLQJGHPROLWLRQ
$IWHUWKHGHPROLWLRQZRUNVFRQWUDFWRUVKRXOGVXEPLWWKHILQDOHYDOXDWLRQRIWKHUHFRYHUHGHOHPHQWV7KLVVKRXOG
HQFRPSDVVWKHIXOOUDQJHRIGLDJQRVWLFDQGUDQJHRIUHXVDELOLW\RIVWUXFWXUDOPHPEHUV7KLVDVVHVVPHQWVKRXOGEH
PDGHE\WKHFHUWLILHGH[SHUWDQGWKHQFDQEHWKHEDVLVIRULVVXLQJWKHFHUWLILFDWHZKLFKHQDEOHVWKHUHXVHRIWKH
HOHPHQWV
,QDQ\FDVHLWLVDOVRQHFHVVDU\WRPDNHDSUHOLPLQDU\DVVHVVPHQWRIHOHPHQWVLQDFRQGHPQHGEXLOGLQJ
/$%25$725< 7(676 $1' ,1 6,78 ,19(67,*$7,216 2) 35(&$67
6758&785$/(/(0(176
,Q WKH HYDOXDWLRQ SURFHVV RI GHPROLWLRQ PDWHULDOV IRU UHXVH PRVW LPSRUWDQW LVVXH LV WR GHWHUPLQH WKH FXUUHQW
SDUDPHWHUV RI VWUHQJWK DQG GXUDELOLW\ RI WKHVH HOHPHQWV 7KH EDVLV RI WKH LQLWLDO DVVHVVPHQW FDQ EH QRQ
GHVWUXFWLYH WHVWLQJ FDUULHG RXW LQ VLWX RQ WKH H[LVWLQJ VWUXFWXUH EHIRUH VWDUWLQJ WKH GHPROLWLRQ SURFHVV ,I WKH
UHVXOWV RI WKHVH WHVWLQJ DUH LQFRQFOXVLYH RU D WKRURXJK HYDOXDWLRQ LV QHHGHG WKH VWUHQJWK ODERUDWRU\ WHVWV RQ
VDPSOHV WDNHQ IURP WKH EXLOWLQ HOHPHQWV VKRXOG EH SHUIRUPHG 6XFK D SURFHGXUH SURORQJV WKH SURFHVV RI
GHPROLWLRQEXWLWGRHVSURYLGHDEDVLVIRUDPRUHDFFXUDWHDVVHVVPHQWDQGSRVVLEOHTXDOLILFDWLRQVHOHPHQWVIRU
UHXVH ,Q VWUHQJWK DVVHVVLQJ RI PDWHULDOV EXLOW LQ HYHQ LI WKH RULJLQDO GHVLJQ GRFXPHQWDWLRQ LV DYDLODEOH
GLIILFXOWLHVPD\DULVHWKDWKDYHDQLPSRUWDQWLPSDFWRQWKHORDGFDSDFLW\DQGGXHWRWKHQHHGWRWDNHDFFRXQWRI
‡WKHLPSDFWRIWLPHRQWKHVWUHQJWKSDUDPHWHUV
‡WKHHQYLURQPHQWDOFRQGLWLRQVXQGHUZKLFKDFRQVWUXFWLRQZRUNVDSSOLHVWRHDFKW\SH RI VWUXFWXUDOPDWHULDOV
VWHHOPDVRQU\WLPEHUDQGFRQFUHWH
‡SURSHUPDLQWHQDQFHRUODFNWKHUHRI
~ 28 ~
WK
,QWHUQDWLRQDO&RQIHUHQFHRQ1HZ7UHQGVLQ6WDWLFVDQG'\QDPLFVRI%XLOGLQJV
2FWREHU%UDWLVODYD
‡KLVWRU\RIUHSDLUVPRGLILFDWLRQVDSSOLHGVWUHQJWKHQLQJHWF
‡GHVLJQVWDQGDUGVZKLFKZHUHLQIRUFHZKHQWKHVWUXFWXUHZDVHUHFWHG
‡DSRVVLEOHELRORJLFDORUFKHPLFDOFRUURVLRQLQUHLQIRUFHGFRQFUHWHVWUXFWXUHVFDUERQDWLRQWHVWLQJ
‡LQFDVHRIFRPSRVLWHPDWHULDOVVXFKDVUHLQIRUFHGFRQFUHWHWKHFXUUHQWVWDWHRIWKHFRQFUHWHVXUIDFHDQGWKH
DGYDQFHPHQWRIFRUURVLRQRIUHLQIRUFLQJVWHHO
'HVSLWH WKHVH IDFWRUV KDYLQJ D VSHFLDOL]HG UHVHDUFK DQG GLDJQRVWLF HTXLSPHQW DQG DSSURSULDWH SURIHVVLRQDO
H[SHULHQFHDVVHVVPHQWRIPHFKDQLFDOSURSHUWLHVFDQEHPDGH UHODWLYHO\TXLFNO\DQGDFFXUDWHO\,WLVFOHDUWKDW
WKHLPSOHPHQWDWLRQRIDZLGHUDQJHRIUHVHDUFKHVZLOOQRWEHSURILWDEOHIRUWKHLQGLYLGXDOVWUXFWXUDOHOHPHQWVEXW
IRUWKHHYDOXDWLRQRIDODUJHUJURXSRILGHQWLFDORUVLPLODUHOHPHQWVFRVWZLOOEHPXFKORZHUWKDQWKHSURGXFWLRQ
RIQHZRQHV
7KHW\SHDQGVFRSHRIUHVHDUFKFDUULHGRXWLQVLWXDQGLQWKHODERUDWRU\FDQEHYHU\GLIIHUHQW7KHFRQVWUXFWLRQ
H[SHUWVKRXOGGHFLGHZKLFKLVWKHPRVWVXLWDEOH
(9$/8$7,21 $1' 48$/,),&$7,21 2) 6758&785$/ 0(0%(56 )25
5(86(
%HIRUH WKH GHPROLWLRQ RI D EXLOGLQJ LV GRQH LW LV UHFRPPHQGHG WR DVVHVV WKH WHFKQLFDO FRQGLWLRQ RI LQGLYLGXDO
VWUXFWXUDOHOHPHQWVIRUSRVVLEOHUHXVHDVDZKROHRUDVFRPSRQHQWV7KHDVVHVVPHQWVKRXOGEHWKHEDVLVIRUWKH
LPSOHPHQWDWLRQ RI WKH GHPROLWLRQ SURMHFW ZKLFK VKRXOG SURYLGH D VFKHGXOH RI ZRUNV WKDW WKH HOHPHQWV WR EH
UHFRYHUHGKDYHQRWEHHQGDPDJHGRUGHVWUR\HG
7KHSURFHVVRIWHFKQLFDOHYDOXDWLRQRIGHPROLWLRQPDWHULDOVIRUUHXVHVKRXOGFRQVLVWRIWKHIROORZLQJVWHSVE\
DQDORJ\ZLWK>@
6WHS$FTXLVLWLRQDQGDQDO\VLVRIWKHDYDLODEOHWHFKQLFDOGRFXPHQWDWLRQEHVWZKHQWKHUHLVDQRULJLQDOGHVLJQ
GRFXPHQWDWLRQDVEXLOWH[HFXWLYHRUIDLOLQJWKDWDQ\RWKHUGRFXPHQWDWLRQRIWKHEXLOGLQJHJLQGXVWU\SURMHFWV
WKH ERRN RI REMHFW GHVLJQV RU GHVFULSWLRQV RI UHSDLU PDLQWHQDQFH HWF 6XFKUHFRUGV FDQ EH JDLQHG IURP WKH
SURSHUW\RZQHURUPDQDJHUDQGLQH[WUHPHFDVHVZKHUHWKH\GRQRWKDYHWKHGRFXPHQWDWLRQLWFDQEHIRXQGLQ
WKH DUFKLYHV RI GHVLJQ RIILFHV FRQVWUXFWLRQ FRPSDQLHV DQG ORFDO DGPLQLVWUDWLYH FHQWHUV IRU LVVXLQJ EXLOGLQJ
SHUPLWV
6WHS6LWHYLHZPHDVXUHPHQWVDQGILHOGWHVWV$WWKLVVWDJHLWLVLPSRUWDQWWRGHWHUPLQHWKHFRPSDWLELOLW\ RI
DYDLODEOHGRFXPHQWDWLRQZLWKWKHIDFWV7KHDWWHQWLRQVKRXOGEHSDLGQRWRQO\RQWKHJHRPHWULFGLPHQVLRQVDQG
PDWHULDOV RI FRQVWUXFWLRQ XVHG LQ WKH EXLOGLQJ EXW DOVR RQ WKH FXUUHQW WHFKQLFDO FRQGLWLRQ RI WKH EXLOGLQJ WKH
KLVWRU\ RI FKDQJHV LQ WKH FRQGLWLRQV RI XVH WKH LPSDFW RI ZHDWKHU FRQGLWLRQV DFWLQJ ORDGV HWF 3DUWLFXODU
DWWHQWLRQ VKRXOG EH SDLG WR VHQVLWLYH SODFHV LQ WKH VWUXFWXUH VXFK DV WKH VXSSRUW ]RQH RI VWUXFWXUDO HOHPHQWV
FRQQHFWLRQVQRGHVORFDOORDGVDUHDSODFHWKHVWDWLFVFKHPHFKDQJHVHWF,QDGGLWLRQWRWKHYLVXDODVVHVVPHQW
DQGSRVVLEOHGLVSODFHPHQWPHDVXUHPHQWVGHIOHFWLRQLQFOLQDWLRQVKRXOGDOVREHPDGHLISRVVLEOHZLWKWKHXVH
RIQRQGHVWUXFWLYHPHWKRGVDQHYDOXDWLRQRIVWUHQJWKSURSHUWLHV7KHUHVXOWRIWKHVLWHLQVSHFWLRQDQGILHOGWHVWLQJ
VKRXOGEHDUHSRUWZLWKDGHVFULSWLYHGUDZLQJDQGSKRWRJUDSKLFSDUWFRQWDLQLQJJXLGHOLQHVIRUGHPROLWLRQRU
LQGLFDWLQJWKHQHHGIRUIXUWKHUGHWDLOHGODERUDWRU\DQDO\VLV
6WHS6DPSOLQJWKHPDWHULDODQGVWUHQJWKSURSHUWLHVWHVWV,QDFFRUGDQFHZLWKWKHGHWDLOHGVWDQGDUGSURFHGXUHV
GHSHQGLQJ RQ WKHW\SH DQG PDWHULDO RI FRQVWUXFWLRQ WLPEHUUHLQIRUFHG FRQFUHWH VWHHO VWRQH EULFN VKRXOG EH
VDPSOHG WKH DSSURSULDWH QXPEHU RI WHVWLQJ HOHPHQWV DQG SHUIRUP ODERUDWRU\ WHVWV RI PDWHULDOV DQG VWUHQJWK
SURSHUWLHV (YHQ LI WKHUH LV RULJLQDO GHVLJQ GRFXPHQWDWLRQ LW LV DGYLVDEOH DW WKLV VWDJH WR YHULI\ WKH SK\VLFDO
SURSHUWLHVRIWKHPDWHULDOVXVHGLQVWUXFWXUH
6WHS)LQDOUHSRUW7KHILQDOUHSRUWVKRXOGLQFOXGHDGHVFULSWLRQRIDOOWKHUHVHDUFKDQGDQDO\VLVRQHDFKRIWKH
SUHYLRXVVWHSVLQFOXGLQJWKHDSSRLQWPHQWRIDQH[LVWLQJIDFLOLW\GRFXPHQWDWLRQPHWKRGRORJ\SXUSRVHDQGVFRSH
RIWKHUHVHDUFKHVFDUULHGRXWLQVLWXDQGLQODERUDWRU\,WVKRXOGWDNHLQWRDFFRXQWDFWXDOWHFKQLFDOFDSDELOLWLHVRI
GLVPDQWOLQJRIZKROHVWUXFWXUDOHOHPHQWVLQDVSHFLILFORFDWLRQFRQGLWLRQV7KHFRQFOXVLRQRIWKHUHSRUWVKRXOG
EHVSHFLILFSURSRVDOVUHJDUGLQJWKHUHXVHRIPDWHULDOVRUVWUXFWXUDOHOHPHQWVDQGKRZWRFDUU\RXWWKHGHPROLWLRQ
LQDPDQQHUWKDWGRHVQRWYLRODWHWKHUHFRYHUHGLWHPVPD\RSWLRQDOO\LQFOXGHDGHPROLWLRQFRVWFDOFXODWLRQVRU
MXVWDQHVWLPDWHRIFRVWVDVZHOODVVSHFLILFWHFKQLFDOGDWDPDWHULDODQGVWUHQJWKFOHDUO\FODVVLI\LQJOLPLWVRI
WKH VFRSH RI UHXVH RI PDWHULDOV REWDLQHG $Q LPSRUWDQW LVVXH LV WR LGHQWLI\ DQG DVVHVV WKH H[WHQW QHFHVVDU\
UHPHGLDOWUHDWPHQWVFOHDQLQJFRDWLQJUHSURILOLQJHWFZKLFKVLJQLILFDQWO\DIIHFWWKHHFRQRPLFDVVHVVPHQWRI
WKHPHULWVRIUHXVH7KHVHWUHDWPHQWVPD\EHJLYHQDVYDULRXVVFHQDULRVVXFKDVIRUSHUPDQHQWRUWHPSRUDU\XVH
RIWKHHOHPHQWVLQWKHQHZGHVLJQ
~ 29 ~
WK
,QWHUQDWLRQDO&RQIHUHQFHRQ1HZ7UHQGVLQ6WDWLFVDQG'\QDPLFVRI%XLOGLQJV
2FWREHU%UDWLVODYD
6800$5<$1'&21&/86,216
:LWKLQ WKH IUDPHZRUN RI UHVHDUFKHV FDUULHG RXW DW WKH 'HSDUWPHQW RI 6WUXFWXUDO (QJLQHHULQJ RI 6LOHVLDQ
8QLYHUVLW\ RI 7HFKQRORJ\ YDULRXV VWUXFWXUDO HOHPHQWV PDGH RI SUHFDVW FRQFUHWH ZHUH WHVWHG 7KHVH LQFOXGHG
GLIIHUHQW W\SHV RI URRI VODEV >@ >@ KROORZ FRUH VODEV FUDQH EHDPV FROXPQV URRI JLUGHUV >@ DQG EULGJH
JLUGHUV 7KH DQDO\VLV RI WKH WHVWLQJ UHVXOWV RI VWUHQJWK DQG PDWHULDO SURSHUWLHV RI SUHFDVW UHLQIRUFHG FRQFUHWH
HOHPHQWV VKRZV WKDW HYHQ DIWHU PDQ\ \HDUV RI XWLOL]DWLRQWKH\ FDQ EH VXFFHVVIXOO\ UHXVHG LQQHZ FRQVWUXFWLRQ
+RZHYHU LQ RUGHU WR WKLV FRXOG KDSSHQ RQ D ZLGHU VFDOH WKH JUHDWHU DZDUHQHVV RI VXFK D SRVVLELOLW\ IURP
FRQVWUXFWLRQGHVLJQHUVLGHLVQHHGHG8QGRXEWHGO\DQLQFHQWLYHIRULQYHVWRUVWRUHXVHSUHFDVWFRQFUHWHHOHPHQWV
ZRXOGEHWKHLUDWWUDFWLYHSULFH&XUUHQWO\WKHFRVWRIUHLQIRUFHGFRQFUHWHHOHPHQWVUHFRYHUHGIURPWKHGHPROLWLRQ
LVLQIOXHQFHGE\WKHIROORZLQJIDFWRUV
DVVHVVPHQWRIWKHWHFKQLFDOSURSHUWLHVRIHOHPHQWV
WKHFRVWRIGHPROLWLRQODERUHTXLSPHQWDGGLWLRQDOPDWHULDOVRYHUKHDGV
WKHFRVWRISUHSDULQJRIHOHPHQWIRUUHXVH
WKHFRVWRIWUDQVSRUWWRWKHVWRUDJHDUHDIRUHOHPHQWVZDLWLQJIRUUHXVH
WKHFRVWRIDGYHUWLVLQJDQGSUHSDUDWLRQRIFDWDORJZLWKWKHWHFKQLFDOGDWD
7KH ILQDO SULFH RI WKH HOHPHQW REWDLQHG IURPWKH GHPROLWLRQ RI UHLQIRUFHG FRQFUHWH VWUXFWXUHV FRQVLVWV RI FRVWV
DVVRFLDWHGZLWKWKHVHDFWLYLWLHV0RVWRIWKHVHFRVWVDUHQRWSUHVHQWZKHQSURGXFLQJQHZHOHPHQWV
3DUWRIWKHVH H[SHQVHVLVGHSHQGHQWRQPDQ\ IDFWRUVDQGIRUWKHVDPHHOHPHQWVFDQEHVLJQLILFDQWO\GLIIHUHQW
7KHUHIRUH WKH VDPH HOHPHQWV PD\ KDYH GLIIHUHQW SULFHV &RPSDUHG WR WKH SULFHV RI QHZ DQG VLPLODU RQHV DV
FRPLQJIURPWKHGHPROLWLRQWKH\VKRXOGEHVLJQLILFDQWO\ORZHUWRPDNHLWHDVLHUWRILQGEX\HUV
$&.12:/('*(0(17
6FLHQWLILFUHVHDUFKHVKDYHEHHQGRQHZLWKLQWKH3URMHFW³,QQRYDWLYHPHDQVDQGHIIHFWLYHPHWKRGVRILPSURYLQJ
WKH VDIHW\ DQG GXUDELOLW\ RI EXLOGLQJV DQG WUDQVSRUW LQIUDVWUXFWXUH LQ WKH VXVWDLQDEOH GHYHORSPHQW VWUDWHJ\´
FRILQDQFHG E\ WKH (XURSHDQ 8QLRQ IURP WKH (XURSHDQ 5HJLRQDO 'HYHORSPHQW )XQG XQGHU WKH 2SHUDWLRQDO
3URJUDPPH,QQRYDWLYH(FRQRP\
5()(5(1&(6
>@ $&, 5 *XLGH IRU HYDOXDWLRQ RI FRQFUHWH VWUXFWXUHV EHIRUH UHKDELOLWDWLRQ $PHULFDQ &RQFUHWH
,QVWLWXWH
>@ $MGXNLHZLF] $ %URO - 'DZF]\ĔVNL 6 $GDPF]\N . 5HXVH RI 5& DQG 3& SUHFDVW PHPEHUV DV
FRQWULEXWLRQWRVXVWDLQDEOHFRQVWUXFWLRQILE6\PSRVLXP7HO$YLY,VUDHO$SULOSS
>@ $MGXNLHZLF] $ %URO - 'DZF]\ĔVNL 6 5HXVH RI UHLQIRUFHG FRQFUHWH SUHFDVW URRI VODEV &HQWUDO
(XURSHDQ &RQJUHVV RQ &RQFUHWH (QJLQHHULQJ &RQFUHWH 6WUXFWXUHV LQ 8UEDQ $UHDV :URFáDZ 3RODQG
6HSWHPEHUSS
>@ &KLQL$5%UXHQLQJ6)'HFRQVWUXFWLRQDQGPDWHULDOVUHXVHLQWKH8QLWHG6WDWHV6SHFLDO,VVXHDUWLFOH
LQ7KH)XWXUHRI6XVWDLQDEOH&RQVWUXFWLRQ±3XEOLVKHGWK0D\
>@ *UDYLQDGD5RFKD&$OR\VLR6DWWOHU0$GLVFXVVLRQRQWKHUHXVHRIEXLOGLQJFRPSRQHQWVLQ%UD]LO$Q
DQDO\VLV RIPDMRUVRFLDOHFRQRPLFDODQGOHJDOIDFWRUV5HVRXUFHV&RQVHUYDWLRQDQG5HF\FOLQJ
SS
>@ 7KRUPDUN & 5HF\FOLQJ 3RWHQWLDO DQG 'HVLJQ IRU 'LVDVVHPEO\ LQ %XLOGLQJV 5HSRUW 7$%.
.)6$%/XQG6ZHGHQ
~ 30 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
EXPERIMENTÁLNE OVEROVANIE HOMOGENITY
ŽELEZOBETÓNOVÝCH STPOV
I. Demjan1 a M. Tomko2
Abstract
The contribution is focused on the application for analyzing experimental diagnostic homogeneity of reinforced
concrete columns.
Kúové slová
experimental diagnostic, reinforced concrete columns
1
ÚVOD
Príspevok je zameraný na aplikáciu relevantných metód pre diagnostiku a experimentálne overenie homogenity
železobetónových stpov novej turbostolice, obr. 1, obr. 2.
V príspevku sú uvedené len niektoré vybrané výsledky z kompletnej diagnostiky železobetónovej stolice
turbostroja. Experimentálna diagnostika bola realizovaná pracovníkmi Stavebnej fakulty TU v Košiciach v
spolupráci s firmou Inset s.r.o..
Obr. 1. Pôdorys železobetónového základu turbogenerátora
1
Ing. I. Demjan, PhD., TU v Košiciach, Stavebná fakulta, Ústav inžinierskeho stavitestva, Vysokoškolská 4,
042 00 Košice, tel.: 055 / 602 42 49, [email protected]
2
Doc. Ing. M. Tomko, PhD., TU v Košiciach, Stavebná fakulta, Ústav inžinierskeho stavitestva,
Vysokoškolská 4, 042 00 Košice, tel.: 055 / 602 42 49, [email protected]
~ 31 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Obr. 2. Pohad na železobetónový základ turbogenerátora
2
ZISOVANIE HOMOGENITY BETÓNOVÝCH STPOV
Prieskum bol realizovaný nedeštruktívnym spôsobom, kde sa posúdili železobetónové stpy z hadiska ich
integrity a homogenity:
- geofyzikálne meranie georadarom
- ultrazvukové meranie
- metóda Impact Echo
- skúška tvrdosti Schmidtovým tvrdomerom
Rozsah prieskumných prác a metódy merania boli navrhnuté tak, aby v maximálnej miere bolo možné
identifikova slabé miesta analyzovaných prvkov (poruchy, anomálie betónu).
Zmena vlastností prostredia
Indikácia lokálnej nehomogenity
Obr. 3. Záznam z georadarového merania
ultrazvuk_rýchlos S1
4200
4000
rýchlos [m.s-1]
1
3800
2
3
4
3600
5
6
3400
7
3200
6,2
5,8
5
5,4
4,6
4,2
3,8
3
3,4
2,6
2,2
1,8
1
1,4
0,6
0,2
-0,9
-1,5
-2,1
-2,7
3000
stanienie
Obr. 4. Rýchlos šírenia ultrazvukových vn v jednotlivých stpov
~ 32 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Obr. 5. Vyhodnotenie meraní metódou Impact Echo
Obr. 6. Hodnoty odrazu pre jednotlivé steny stpov
3
VYHODNOTENIE VÝSLEDKOV DIAGNOSTIKY
Na základe uskutonených meraní možno stpy S3 – S5 hodnoti ako homogénne bez prejavov lokálnych
porúch. Zistené zmeny charakteru prostredí (väšinou vo vnútri stpov) odpovedajú pravdepodobne zmene
vlhkosti nevyzretého betónu.
U stpu S1 bola identifikovaná lokálna nehomogenita v blízkosti rohu medzi stenami A a B na výškovej úrovni
2,6 – 3,1 m. Charakter anomálie nemožno jednoznane uri. Mohlo by sa jedna o prejav konštrukného prvku
~ 33 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
alebo o prejav lokálnej poruchy (kaverna, štrkové hniezdo a pod.). U stpu S2 sa prejavila konštrukná škára na
úrovni 6,55 m bez prejavu zmeny vlastností betónu v jej okolí.
4
ZÁVER
Aj napriek nie celkom vhodne zvolenému postupu betonáže stpov turbostolice, teda nedodržaniu správneho
spôsobu vibrovania betónovej zmesi, je možné konštatova, že experimentálna diagnostika potvrdila oakávanú
homogenitu železobetónových stpov, teda neboli zistené výraznejšie lokálne poruchy.
POAKOVANIE
Tento lánok bol vypracovaný v rámci riešenia projektu VEGA . 1/0321/12 podporovaného Vedeckou
grantovou agentúrou MŠ SR a SAV.
Tento lánok bol vytvorený realizáciou projektu s názvom „Podpora Centra excelentného integrovaného
výskumu progresívnych stavebných konštrukcií, materiálov a technológií“, na základe podpory operaného
programu Výskum a vývoj financovaného z Európskeho fondu regionálneho rozvoja.
LITERATÚRA
[1]
Kompletná projektová dokumentácia statiky, 2011
[2]
Správa: Kontrola homogenity železobetónových stpov stolice TBG 5, Inset s.r.o., 2011
[3]
Správa: Kontrola homogenity a analýza chemického zloženia železobetónových stpov stolice TBG 5,
Stavebná fakulta, Technická univerzita v Košiciach, 2011
[4]
Štainbruch, J.: GPR Scanner as a Next Step in Detailed 3D Diagnostics. In: NDE for Safety, Proceedings.
Brno, VUT v Brn. 2009. p. 211 - 218. ISBN 978-80-214-3973-3
[5]
Garbacz, A. - Štainbruch, J. - Hlavá, Y. - Hobst, L. - Anton, O.: Defect Detection in Concrete
Structures with NDT Methods: Impact/Echo Versus Radar. In: NDE for Safety, Proceedings. Brno,
VUT v Brn. 2009. p. 21 - 28. ISBN 978-80-214-3973-3
[6]
Štainbruch, J. - Anton, O. - Kordina, T.: Rozvoj použití Georadaru pi diagnostice železobetonových
konstrukcí. In: Beton 3/2011. Beton TKS, S.R.O., p. 66 - 70. ISSN 1213-3116
[7]
Papán, D.: The computing model improving based on measured dynamic response of ceiling structure
(Zdokonalenie výpotového modelu na základe nameranej dynamickej odozvy štruktúry stropu).
In: TRANSCOM 2003: 5-th European conference of young research and science workers in transport and
telecommunications: Žilina, 23-25 June 2003. Section 7: Theory and structure of engineering
constructions. Technology of constructions. Mechanics of rigid and elastic bodies. Forensic engineering
Žilina: University of Žilina, 2003. p. 143-144. ISBN 80-8070-086-9
[8]
Papán, D.: Spektrálne charakteristiky zaaženia a odozvy mostných konštrukcií vo vzahu k technickej
seizmicite. In: Dizertaná práca. Žilinská univerzita v Žiline, Stavebná fakulta, Katedra stavebnej
mechaniky, Žilina, 2008, 120 s.
~ 34 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
THE ROLE OF ENERGY-EFFICIENT CONSTRUCTION
IN CONTEMPORARY ENGINEERING DESIGN
L. Fedorowicz1 and I. Pokorska-Silva2
Abstract
In passive objects, conversion of solar energy into heat occurs by free convection, conduction and radiation.
Passive systems require analysis of the energy requirements and conditions for obtaining solar energy.
The article presents the general problems of modeling connected with energy simulations on:
- relation passive solar heat gain to the location of the object,
- object shape and construction of partitions.
Thermal response was assessed in a global analysis of the object (ESP-r) and in a local analysis, concerning
contact of object with the subsoil.
Key Words
Simulations; modeling; energy-efficient construction.
1
INTRODUCTION
Designing buildings generally, beyond the design considerations, actually becomes a complex multi-element
task – fig.1. Such presenting of design process results from current trend – striving for ecological and low-energy
construction.
6.Materials
selection
1.Orientation
& shape
7.Envelope
design
5.Heating
& cooling
4.Ventilation
2.Site
design
3.Lighting,
daylighting
& electricity
lighting
Fig. 1. Integrated design process [2]
1
Associate Prof. L. Fedorowicz, The Silesian University of Technology, Faculty of Civil Engineering,
Akademicka 5, 44-100 Gliwice, Poland, lidia,[email protected]
2
Msc I. Pokorska-Silva, The Silesian University of Technology, Faculty of Civil Engineering,
Akademicka 5, 44-100 Gliwice, Poland, [email protected]
~ 35 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Each element (fig. 1) may be subject of an independent research - both in-situ, laboratory and modeling.
At the same time ensured should be proper correlation of all components making up the design process. Overall,
this gives the required energy efficiency of the building.
In the conducted deliberations shown efficiency of numerical study in the design of energy-efficient.
In the analyzes was used program ESP-r, considered to be one of the most powerful dynamic thermal simulation
tools that allows modeling the energy and fluid flows, giving the results very accurately reflecting the real
building environment [1].
Presented approach is global, i.e. that in the most general case allows to create a model that includes
all the elements shown in fig.1 and assessment of their influence on energy efficiency of the designed building.
However, for research purposes it is more important that the calculation model, may form (after suitable
calibration) virtual equivalent studies in situ and laboratory tests.
2
CONSTRUCTION AND INITIAL CALIBRATION OF COMPUTATIONAL
MODEL
For analysis was taken a one-zone model of the object, characterized by the energy interaction of the subsoil.
The approach is a continuation of the research presented in [3].
Main parameter determining the size of the energy gains and the quality of the internal environment
of the building, is solar radiation.
In consideration on the thermal issues is a problem creating acceptably simplified model of description of energy
interaction between the building and the environment, ensuring proper description of the external parameters –
weather.
Problems of the radiation measurements and computational modeling have been the subject of many research.
These models use statistical analyses and methods of averaging weather data – for example, to determine
the typical meteorological year or meteorological reference year for energy calculation; in certain cases
allowing for climate specificity (for example [4]).
The following procedure shows the calibration process – as proposed in the work – preparing the computational
model of a building to simulate the state in situ.
In the analyzes were used climate databases contained in ESP-r library.
2.1 Estimating the accuracy of temperature response in a model of specified geometry
In the case of thermal analysis is important the total amount of radiation energy incident on the outer surface
inclined differently. For the solid elements, some of the energy of solar radiation is absorbed and converted into
heat energy, some energy is reflected, in transparent surfaces some of the energy penetrates into the inside and is
converted into heat.
In both cases, the consideration concerned finite volume constituting whole analyzed room.
Below, in fig. 3 is shown the results of the simulation in ESP-r conducted for two objects: a cylindrical
and cubic [3].
Were received satisfactory compliance of thermal response in both objects, as interpreted in tab. 1.
Cubic object (St)
Cylindrical object (W)
Volume, m3
180.0
180.0
Floor surface, m2
31.9
31.9
Tab. 1. Models of objects: cubical and cylindrical
~ 36 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Fig. 3. Simulation results in ESP-r – comparison of internal temperature (tw) in buildings; winter season
2.2
Influence of temperature interaction object with subsoil – auxiliary tw sensitivity study
to the influence of subsoil temperature
To model the node vertical partition – floor – ground was used program KOBRA. For the selected time period
was introduced: 1) conditions consistent with the solution ESP-r for applied climate base (fig.4a), 2) reduced
temperature of the subsoil (fig.4b)
a)
b)
Fig. 4. Result analysis of the corners in program Kobra for the data from the simulation in ESP-r
2.3 Adiabatic contact of building with subsoil
The effect of eliminating thermal interaction of building with subsoil on generalized thermal response
of the building is show in fig.5.
Fig. 5. Simulation results in ESP-r – comparison of internal temperature (tw) in cubic object: in thermal
interaction with subsoil (1), cut off from the subsoil by adiabat (2); winter season
~ 37 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
3
October 2013, Bratislava
RESEARCH ON INFLUENCE OF ENVIRONMENTAL AND MODIFICATION
OF PARTITION ON THE RESULTS OF CALCULATION OF ENERGY
To ensure the proper temperature (proper thermal comfort) inside the analyzed object is carried out analysis
of phenomena related to the flow of heat along with the analysis of factors supporting and disturbing the process.
It is obvious that what is achievable in passive solar heat gain in one location may not be available in another
location.
The advantage of numerical simulations carried out is the possibility of direct observation of the effect:
1) change of object location, and 2) changes in the construction of partitions (due to the effect of absorptivity
and emissivity) on the thermal response evaluated in the test object.
Fragment of the tests show the following figures. Figure 6 concerns with the problem (1). Was compared
the sensitivity of the object location described climate databases for cities Prague (Prg) and Porto (Prt). Figure 7
concerns while the problem (2).
Fig. 6. Simulation results in ESP-r – comparison of internal temperature (tw) in buildings located in Porto (Prt)
and Prague (Prg); winter season
Fig. 7. Simulation results in ESP-r – comparison of internal temperature (tw), temperature on the outer and inner
surface of the south wall of the buildings: before (I) and after (II) changing the construction of wall; winter
season
4
SUMMARY
We can talk about adequate description of reality in case of certain analysis if there are proper theoretical
dependencies, experimental studies results and observations in situ.
In the conducted global deliberations, was shown efficiency of numerical study in the design of energy-efficient
objects.
(Expanded description of the analysis presented in chapters 2 and 3, as well the bibliography included in the full
version).
~ 38 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
INTERPRETATION OF THE BEHAVIOR OF A SYSTEM
BUILDING OBJECT - DIFFICULT SUBSOIL
IN MODERN NUMERICAL MODELING
Jan Fedorowicz1 and Leszek Słowik2
Abstract
As a result of mining we can observe deformations of the layer of subsoil which interacts with the building
structure. Precisely, there are observed deformations of the ground surface.
Observations in situ (i.e. surveying and recorded damage as a result of non-uniform deformation of the
structure), however, indicate that we are dealing with the change of state of the ground that is deforming; usually
interpreted directly as a change in stiffness resulting from loosening or soil compaction.
The actual behaviour of a building object at mining deformed subsoil, however, depends on many factors,
including:
- the overconsolidation ratio of the subsoil,
- mining forced state of deformation,
- weight, size and rigidity of a building,
- homogeneity or heterogeneity of the subsoil.
This paper will present the results of numerical simulations and measurements in situ of the building tilted on the
ground, which parameters are entered in the computational analysis.
Key Words
Mining areas, mining activities revenues, protection of buildings in the areas of mining, numerical analysis,
models of inelastic material degradation.
1
INTRODUCTION
The characteristic feature of analyses of objects built on areas influenced by mining is the total lack of proposals
for numerical methods for proceeding that would yield assessment of behaviour and safety of these objects,
featuring, according to the contemporary principles of the geotechnical design, the building-subsoil interactive
system.
Behaviour of mining subsoils (that is beddings subjected to deformations caused by mining of minerals),
registered in the in situ state and forecast with various methods, reveal the complexity of phenomena so great
that calling them the "difficult beddings" is fully justified, and changes of mining conditions may lead to change
of T and ε parameters' ranges taken into account for the particular mining category. The danger of
"underestimation" of the real effect of these parameters on the building construction arises currently because of
1
PhD, DSc. J. Fedorowicz Associate Professor, Department of the Theory of Building Structures, Faculty of
Civil Engineering, The Silesian University of Technology, ul. Akademicka 5, 44-101 Gliwice, Poland, phone
No.: +48322372268, e-mail: [email protected]
2
MSc Eng Leszek Słowik, Ph.D. student: Instytut Techniki Budowlanej, Oddział Śląski, Katowice,
Al. W. Korfantego 191, Tel./FAX: +48 32 730 29 64, [email protected]
~ 39 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
the above mentioned reasons.
In authors' opinion, to prevent such phenomenon, more advanced descriptions of the soil behaviour in the
interaction zone of the building object with the deforming mining subsoil should be used in the forecast building
analyses.
Inappropriateness was pointed out already in [3,5] of the numerical assessment of the building - mining subsoil
system safety when the subsoil is described with the elastic plastic model, and the boundary conditions result
from separation of the surface deformations into the constituent states (represented by the deformation
parameters). Approach to analyses of the building - mining subsoil systems in the excessively conventional way
features another, very important problem. For example, the statement does not have to be always true that the
significant slope values resulting from mining pose a considerable threat to stability of tall objects with high
slenderness ratio, and insignificant one for objects with big dimensions and low slenderness ratio, covering,
among others, road embankments.
Problems mentioned above are the subject of a more extensive analysis presented in the next chapters of the
work. It was demonstrated that:
- defining the appropriate boundary conditions in the subsoil model, and
- employment of the relevant constitutive description of soil work
makes it possible to explain certain phenomena observed in the in situ state.
2
ANALYSIS OF REAL SYSTEM USING (MMC) MODEL FOR MINING
SUBSOIL
Description of the subsoil behaviour, representing the mining subsoil in the C-M model is explained in detail in
the full version of the work.
Problems of deviations of the building objects from the vertical occur mostly in the areas with mining influence.
These are the extremely difficult cases for modelling the complete building - subsoil system, among others
because of the lack of the unambiguous interpretation of the soil work representing the mining subsoil in the
main engineering (C-M) model; see chapter 2 of the full version of the work.
The following thesis was put forward:
If in certain soil conditions additional settlement may occur of the building objects due to deformations
taking place in the mining subsoil, then there is a significant probability that with the relevant soil
stratification or in specially complex mining conditions, the same phenomenon may be revealed in the
form of the non-uniform settlement causing building tilt (bigger than the forecasted terrain slope).
Effect of the additional settlements that is settlement process of the buildings' structures reinitiated by mining
was noticed repeatedly in the in situ observations; however, it was usually attributed to the evident differences
between the forecasted and measured values of the vertical terrain displacements.
General explanation of this effect in respect to the mining subsoil, based on the critical state mechanics, is given
in work [3].
In works [8, 12] cases were discussed of the permanent deviations of buildings from the vertical, it was also
shown, based on the assessment of the interaction change under the slanted building that deviation from the
vertical may be different from the terrain slope.
However, to be able to forecast the object slanting threat, it is proposed to carry out analysis of the soil behaviour
in the critical state model (MCC) making interpretation possible of the rigidity reduction of the deforming
mining subsoil as the result of the soil state change.
Credibility of such analysis is connected; however, with meeting three conditions:
1) Proper identification of the subsoil (along with its history) in the area of its interaction with the
construction,
2) determining model parameters properly, and
3) determining boundary conditions of the model properly.
In practice, meeting condition (3) in the engineering analyses may turn out to be most difficult.
Character, assumed by the conditions mentioned above determined for the real building object being the subject
of detailed monitoring since 1993 until now [12, 13], description of the subsoil, and determining of the
parameters are presented in the full version of the work. Successive stages of the procedure are as follows: soil
sampling - laboratory test results - determining model parameters, are shown in Fig. 1 (example for the OW1
test bore-hole).
~ 40 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
PROFIL OW-1
grunt
nasyp.
poziom pos.
piasek śr.
OCR=2.5, pc=200 kPa, M=1.157,
=0.056, =0.017, ecs=0.462,
=0.30, K(NC)o=0.4652, q*z=122 kPa
OCR=2.5, pc=200 kPa,
Cc=0.130, Cs=0.040,
ecs=0.462, =29o
ił
węgiel k.
OCR=2.5, pc=225 kPa, M=0.8985,
=0.047, =0.017, ecs=0.405,
=0.29, K(NC)o=0.6093, q*z=60 kPa
6 sin φ
3 − sin φ
λ=
Cc
2.303
K o( NC ) = 0 .95 − sin φ
p co
M =
K o) OC ) = OCR ⋅ K o( NC ) +
ν
1 −ν
OCR=2.5, pc=225 kPa,
Cc=0.108, Cs=0.038,
ecs=0.405, =23o
ił
1.0 K o( OC )
0.5
0
poziom pos.
-2
-4 ił 0.548
0.636
-6
0.612
Cs
2.303
q2 + M 2 p2
=
M 2p
κ =
(OCR − 1)
-9
z [m]
Fig. 1. Determining (MCC) model parameters
1) Determining boundary conditions of the model
The actual slanting of the investigated object (according to the in situ measurements) exceeds by about 10o/oo the
terrain slope values T (forecasted and determined along the measurement traverse).
Location of the investigated object and the dominating slanting component (parallel to the mining direction and
to the measurement traverse) (shown in Fig. 4 in the full version of the work) allow for the numerical simulation
of soil behaviour in (2D) analysis. The task of the preliminary analysis (presented below) is answering the
question if the observed building behaviour results from appearing of the phenomenon of the additional
settlements of the building due to activation of the particular phenomena in the pre consolidated soil by mining.
This phenomenon is understood here as the soil rigidity reduction and transition from the pre consolidation state
to the normal consolidation state in the subsoil loosening stage. Discovering this phenomenon would make it
possible to refer to the thesis stated in the work (put forth at the beginning of the chapter).
The boundary conditions determined in this way were used for carrying out the preliminary analysis meeting the
conditions specified above. Result of analysis showing the mining subsoil behaviour in the (MCC) model in the
area of subsoil interaction with the analysed object. In the preliminary analysis:
homogeneous subsoil was introduced, with the clay layer parameters of OCR = 2.5, dominating in the soil
profile,
load from the construction was assumed as qz, equivalent, evenly distributed, applied to the foundation in the
marked area of the subsoil model,
load with the determined, displacement boundary conditions was realised in the incremental form in four
blocks, where the first block was the realisation of the load transferred from the construction to the subsoil.
The analysis result provides the qualitative view of the investigated object behaviour - Fig. 2.
This is the realisation of the last block of the displacement boundary conditions, when:
sum of the initial settlement values from load qz and vertical displacements of the object begins to exceed
displacement values of the undeveloped terrain, and
further vertical displacements of the building object, exceeding values measured along the measurement
traverse may be interpreted as the additional unforecasted building displacements (shaded area in Fig. 8);
with the tilt visible in the numerical simulation, consistent with the real state.
~ 41 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Fig. 2. Result of the preliminary analysis assessing behaviour of the examined building object..
3
SUMMARY AND CONCLUSIONS
Effect of the additional vertical construction displacements, different from displacements of the undeveloped
terrain (not loaded with the construction) was noticed repeatedly in the in situ observations. It was treated;
however, usually as the evident fact of occurrences of differences between the forecasted, and measured values
of the vertical terrain displacements. However, if this phenomenon may be explained with changes of soil
rigidity occurring in the mining subsoil, then (according to the thesis put forward in chapter 2) one may also
forecast the particular, disadvantageous for the building structure, consequences of this phenomenon.
There is, e.g., a big probability that with the relevant subsoil stratification or in the complex mining conditions
this phenomenon may demonstrate itself in the form of the uneven settlement causing building tilt (bigger than
the forecasted terrain slope).
Results of the preliminary analysis are presented in the work, providing picture of the mining subsoil behaviour
in the critical state model (MCC) in the area of interaction of the subsoil with the slanted building.
The analysis result provides the qualitative; however consistent with the reality, view of the investigated object
behaviour - Fig. 2.
Credibility of the numerical analysis (especially the one employing the advanced model of the constitutive soil
description) is closely connected with:
1) identifying of the subsoil,
2) determining parameters of the constitutive model, and
3) determining boundary conditions of the model.
In research analyses, meeting condition (3) correctly, and the proper realisation of the displacement boundary
conditions in the model are the base for the correct assessment and forecasting of the buildings' structures mining subsoil system behaviour.
ACKNOWLEDGEMENT
Numerical analyses
were performer at
ACK
CYFRONET
Kraków,
MNiSW/SGI3700/PŚląska/054/2010 and MNiSW/SGI3700/PŚląska/056/2010.
REFERENCES
Complete list of references is included in the full work version.
~ 42 ~
based
on
grant
Proceedings of the 11th International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
NETRADIýNÍ DIAGNOSTIKA PEVNOSTI V TLAKU
BETONOVÝCH MATERIÁLģ
T. Ficker 1
Abstract
This paper is focused on the recently found relationship between compressive strength and height irregularities
of fracture surfaces of cement-based materials. Experimental data indicate that this relationship may serve as a
prototype of calibration curves assessing macroscopic compressive strength on the basis of microscopic
characteristics of porous materials, especially cement-based materials.
Klíþová slova
Pevnost v tlaku; profilová analýza lomových povrchĤ; materiály na bázi cementu; konfokální mikroskopie.
1
ÚVOD
U kompozitních materiálĤ, jakou jsou betony, mají na celkovou pevnost v tlaku vliv zejména nejménČ pevné
komponenty. U prostých betonĤ to jsou pĜedevším dva nejslabší þlánky, a tím je jednak cementový kámen (v
podstatČ jde o hydratovanou cementovou pastu) a pĜechody mezi cementovým kamenem a agregáty, které jsou
tvoĜeny kamenivem a pískovými zrny. Agregáty samotné mají vČtšinou o dost vČtší pevnost ve srovnání s
cementovým kamenem, a pokud je beton dobĜe pĜipraven, tzn. je zvolen správný vodní souþinitel a navíc
cementový kámen dobĜe obaluje kamenivo, pak tím nejslabším þlánkem v celém ĜetČzci bývá cementový kámen,
který tím pádem rozhoduje o celkové pevnosti tohoto kompozita. Z tohoto hlediska má smysl zabývat se
samostatnČ pevností cementového kamene, jakožto jedné z kritických složek kompozitních materiálĤ na bázi
cementu.
2
LOMOVÉ POVRCHY JAKO UKAZATEL PEVNOSTI MATERIÁLU
VysvČtlení, proþ lomové povrchy pórovitých materiálĤ na bázi cementu nesou informaci o pevnosti v tlaku,
vyžaduje dokumentovat kombinovaný vliv pórovitosti jak na pevnost samotnou, tak na drsnost lomových
povrchĤ.
ěídící vliv pórovitosti na pevnost v tlaku nejen u materiálĤ na bázi cementu, ale i u ostatních anorganických
pórovitých materiálĤ, je znám již Ĝadu desetiletí. U materiálĤ na bázi cementu má na pevnost v tlaku nejvČtší vliv
kapilární pórovitost. V technologii betonových materiálĤ a cementového kamene je velmi dobĜe znám základní
vztah mezi pórovitostí P a pevností v tlaku V c [1]
V c V o exp(kP)
1
(1)
Prof. RNDr. Tomáš Ficker, DrSc., Ústav fyziky, Fakulta stavební, Vysoké uþení technické v BrnČ, VeveĜí 95,
602 00 Brno, tel. ++420 541 147 661, e-mail [email protected]
~ 43 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
kde
Vo
October 2013, Bratislava
a k jsou materiálové konstanty. Tento vztah byl ji ž v minulosti mnohokrát experimentálnČ ovČĜován a
prakticky využíván. Doposud ale chybČl explicitní vztah mezi pórovitostí a drsností lomových ploch
cementového kamene. Teprve nedávný experimentální výzkum [1 - 3] vnesl do této problematiky jasno.
Experimenty ukázaly, že mezi pórovitostí P a parametrem drsnosti lomové plochy H a
Ha
1
L˜M
³³| f ( x, y) | dx dy
(2)
( LM )
existuje tČsná korelace H a ( P ) , tudíž vzhledem k závislosti (1) bylo možno též oþekávat, že bude existovat
silná korelace mezi pevností a parametry drsnosti lomových ploch
V c (H a ) .
Provedené experimenty tento
pĜedpoklad potvrdily. Jeden z pĜíkladĤ takové experimentální závislosti je uveden na obr. 1.
Obr. 1. ExperimentálnČ zjištČné závislosti H a ( P ) a
Existuje tedy možnost optimalizovat závislost
V c (H a )
V c (H a )
na cementovém kameni
na konkrétní druh cementového kamene u konkrétního
typu betonu a používat tuto závislost jako cejchovní kĜivku. Teoreticky se tak otevírá možnost provádČt
komponentní analýzu pevnosti urþitého typu betonu. K praktickému použití této metody je však tĜeba ještČ
dalšího výzkumu.
PODċKOVÁNÍ
Tento výzkum je podporován Grantovou agenturou ýeské republiky na základČ kontraktu þ. 13-03403S.
LITERATURA
[1]
[2]
[3]
Ficker T. - Martišek, D. – Jennings, H. M. (2010) Roughness of fracture surfaces and compressive
strength of hydrated cement pastes. Cement and Concrete Research 40(6): 947 - 955.
Ficker T and Martišek D (2011) Roughness and fractality of fracture surfaces as indicators of
mechanical quantities of porous solids. Central European Journal of Physics 9(6): 1440 – 1445.
Ficker T (2012) Fracture surfaces and compressive strength of hydrated cement pastes. Construction and
Building Materials 27(1): 197-205.
~ 44 ~
Proceedings of the 11th International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
STABILITA ZÁKLADOVÝCH PěECHODģ MEZI BETONEM
A HORNINOVÝM PODLOŽÍM
T. Ficker 1
Abstract
In foundations of large civil-engineering structures the joints between concrete materials and rocks are exposed
to an enormous mechanical stress. The strength of the joints considerably influences the mechanical stability of
the structures. An important factor that governs the mechanical strength of these joints is asperity (roughness) of
their surfaces. The joint roughness coefficient enters the formula for joint strength and essentially affects its
value. One of the most widely used methods for assessing the joint roughness coefficient of a particular joint is
based on visual inspection of sectional profiles. This paper presents an alternative method for determining
roughness coefficients. The method is based on the Fourier wave analysis.
Klíþová slova
Materiálové spoje; drsnost stykových ploch; koeficient drsnosti; pevnost materiálových spojĤ; Fourierova
vlnová analýza povrchĤ.
1
ÚVOD
Problém mechanické stability velkých civilnČ-inženýrských staveb (mostĤ, pĜehrad, tunelĤ apod.) je do znaþné
míry problémem stability jejich základĤ. Základová stabilita souvisí s kvalitou horninového podloží a s pevností
pĜechodových spojĤ mezi betonovým materiálem a podložím. Zejména pĜechodové spoje a to nejen mezi
betonem a horninovým podložím, ale také spoje v samotných horninách („rock joints“) jsou místy styku dvou
drsných povrchĤ, na kterých záleží, zda nedojde ke smykovým (kluzovým) posuvĤm. Mechanická pevnost
tČchto spojĤ je proto kritická pĜi oceĖování stability základĤ tČchto velkých staveb.
DĤležitou roli pĜi výpoþtu pevnosti pĜechodových spojĤ hraje drsnost jejich stykových ploch. K ocenČní
drsnosti stykových ploch se užívá tzv. koeficient drsnosti. Urþení jeho numerické hodnoty pro konkrétní
materiálový spoj však není triviální záležitostí a v minulosti bylo vČnováno tomuto problému znaþné výzkumné
úsilí, z nČhož vzešla Ĝada návrhĤ a alternativních postupĤ. Doposud nejužívanČjší je metoda vizuálního
porovnávání drsnosti stykových ploch s drsnostními standardy. Jde však o metodu sice jednoduchou, ale za cenu
urþité subjektivity výsledku. Tento pĜíspČvek popisuje zpĤsob vyhodnocování drsností, u kterého je vizuální
zpĤsob nahrazen poþítaþovým (numerickým) vyhodnocováním, a to na základČ charakteristik získaných z vlnové
Fourierovy analýzy povrchĤ.
1
Prof. RNDr. Tomáš Ficker, DrSc., Ústav fyziky, Fakulta stavební, Vysoké uþení technické v BrnČ, VeveĜí 95,
602 00 Brno, tel. ++420 541 147 661, e-mail [email protected]
~ 45 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
2
October 2013, Bratislava
SMYKOVÁ PEVNOST MATERIÁLOVÝCH SPOJģ
Experimentální výsledky [1], [2] ukázaly, že smyková pevnost materiálových spojĤ
parametrech, avšak drsnost („asperity“) stykových ploch hraje klíþovou úlohu
W
ª
Vn
závisí na nČkolika
º
§Vo ·
¸¸ ) b »
©V n ¹
¼
V n tg « R JRC log¨¨
¬
kde R JRC je koeficient drsnosti,
W
normálové efektivní napČtí,
Vo
(1)
efektivní pevnost v tlaku stykových stČn a
) b je tĜecí úhel (materiálová konstanta). Obtížnost výpoþtu hodnoty W spoþívá v obtížnosti urþení hodnoty
koeficientu drsnosti R JRC pro daný materiálový spoj.
3
NUMERICKÉ POROVNÁVÁNÍ STANDARDģ DRSNOSTI
Jak již bylo Ĝeþeno, pro urþování hodnoty R JRC se nejþastČji používá vizuální porovnávací metoda. Vizuální
porovnávání lze nahradit objektivnČjším numerickým porovnáváním v kooperaci se standardními povrchy, u
nichž je hodnota R JRC známa. Pro úþel numerického porovnání dvou povrchĤ lze použít maticový indikátor
povrchového tvaru
Z N (k , n) , který je složen z rozvojových koeficientĤ Ok , n , ak ,n , bk ,n , ck ,n , d k ,n
dvourozmČrné Fourierovy Ĝady obsahující harmonické funkce sinus a kosinus
Z N ( k , n)
(Ok , n ˜ ak , n ) 2 (Okn ˜ bk , n ) 2 (Ok , n ˜ ck , n ) 2 (Ok , n ˜ d k , n ) 2
Dvojice hodnot ( k , n) urþuje dvourozmČrný harmonický vlnový mód povrchu a hodnota
(2)
Z N ( k , n) jeho
numerickou váhu v souboru ostatních vypoþítaných módĤ k , n N 1 . Relativním srovnáním maticových
indikátorĤ lze vybrat ze souboru standardních ploch tu nejpodobnČjší a její hodnotu R JRC pak pĜiĜadit zkoumané
ploše.
Popsaný princip numerického porovnávání materiálových ploch pĜedstavuje ekvivalent vizuálního
porovnávání, avšak prvek subjektivity je tu nahrazen objektivním, striktnČ matematickým postupem. K tomuto
úþelu byl vypracován poþítaþový program, který provádí celou proceduru automaticky. Jako vstupní soubor se
zadává zkoumaná plocha v digitální podobČ. Digitální plocha se rozvine do Fourierovy dvourozmČrné Ĝady a
z rozvojových koeficientĤ se vypoþítá matice Z N ( k , n) . Standardní soubor ploch je uložen v úložišti (databázi)
programu, a to již v podobČ
Z N ( k , n) matic, takže numerické porovnávání probíhá pouze mezi tČmito
maticemi.
Vyvinutý poþítaþový program je schopen provést srovnání ploch podstatnČ rychleji, nežli v pĜípadČ
vizuálního porovnávání. Databáze programu je snadno rozšiĜitelná o další standardní plochy, takže je možné
podstatnČ zjemnit a tím i zpĜesnit urþování hodnot koeficientĤ drsnosti.
PODċKOVÁNÍ
Tento výzkum je podporován Grantovou agenturou ýeské republiky na základČ kontraktu þ. 13-03403S.
PodČkování náleží také Doc. PeaDr. Daliboru Martiškovi, Ph.D., Ústav matematiky, Fakulta strojní, Vysoké
uþení technické v BrnČ za softwarovou podporu.
LITERATURA
[1] Barton N. (1973) Review of a new shear strength criterion for rock joints. Eng. Geol. 7: 287–332.
[2] Barton N. - Choubey V. (1977) The shear strength of rock joints in theory and practice. Rock Mech. 10: 1 –
65.
~ 46 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
STEROWANIE WŁASNOCIAMI STRUKTUR PŁYTOWYCH
TYPU TENSEGRITY ZA POMOC SAMONAPRE
W. Gilewski1, A. Al Sabouni-Zawadzka2
Abstract
The present paper is an attempt to the future application of plates based on tensegrity modules to smart structure
technologies. An information on smart structures is shortly introduced. A simple tensegrity module is applied to
build a tensegrity plate. The influence of several self-stress states on displacements is analyzed.
Key Words
Smart structures; Active control; Tensegrity; Tensegrity plate
1
WSTP
Konstrukcje inynierskie (budynki, mosty) poddane s działaniu rónych obcie, wród których najbardziej
niebezpieczne s obcienia wyjtkowe, takie jak silne wiatry, trzsienia ziemi. Wyzwaniem dla projektanta
moe by zaprojektowanie takiej konstrukcji, która mogłaby reagowa na wyjtkowy stan obcienia, np.
zmieniajc swoje własnoci (sztywno, podatno). Jest to moliwe przy wykorzystaniu tzw. inteligentnych
technologii (por. [1,2]). Technologie te mog dotyczy materiałów inteligentnych lub konstrukcji inteligentnych.
Praca stanowi wstp do analizy wpływu samorównowanych układów sił w strukturach płytowych,
zbudowanych z modułów tensegrity, na stan przemieszcze i sił wewntrznych konstrukcji. Zmiana wartoci siły
sprajcej w całej strukturze lub jej fragmencie moe by czynnikiem sterujcym w konstrukcji, która w sposób
inteligentny reaguje na czynniki zewntrzne [4]. Rozwaane tensegrity s strukturami kratowymi, o szczególnej
konfiguracji prtów i wzłów [5,6]. Struktury takie, z racji swojej infinitezymalnej geometrycznej zmiennoci w
stanie bez sprenia wstpnego, mog by znacznie bardziej podatne ni tradycyjne kratownice na niewielkie
zmiany parametrów sterowania, a przez to bardziej przydatne do wykorzystania w konstrukcjach inteligentnych.
W pracy przedstawiono przykład struktury płytowej tensegrity, która składa si z kilkunastu modułów. Badano
wpływ sił sprajcych i połoenia modułów spranych na stan przemieszczenia konstrukcji. Obliczenia
przeprowadzono za pomoc systemu Sofistik w zakresie nieliniowym geometrycznie.
2
STEROWANIE WŁASNOCIAMI KONSTRUKCJI
Konstrukcje i materiały inteligentne stanowi przedmiot prac wielu autorów w ostatnich kilkunastu latach (por.
[1,2,4]). Schemat działania konstrukcji inteligentnej przedstawiono na Rys. 1. W schemat ten wpisany jest
monitoring stanu obiektu, który stosowany jest obecnie w wielu duych budowlach inynierskich. Zbieranie i
analiza informacji o „stanie zdrowia” konstrukcji (ang. Structural Health Monitoring) moe stanowi
przyczynek do moliwej reakcji obiektu i ewentualnej korekty stanu dla bezpieczestwa konstrukcji.
1
Prof. dr hab. in. Wojciech Gilewski, Warsaw University of Technology, Faculty of Civil Engineering, Institute
of Building Engineering, Al. Armii Ludowej 16, 00-637 Warsaw, Poland, e-mail: [email protected]
2
Mgr in. Anna Al Sabouni-Zawadzka, Warsaw University of Technology, Faculty of Civil Engineering,
Institute of Roads and Bridges, Al. Armii Ludowej 16, 00-637 Warsaw, Poland, e-mail: [email protected]
~ 47 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Rys. 1. Schemat sterowania w konstrukcji inteligentnej
Przedmiotem dalszej analizy s sterowniki, a w szczególnoci ocena moliwoci sterowania własnociami
konstrukcji za pomoc samorównowanych układów sił podłunych w strukturach płytowych tensegrity.
3
STEROWANIE WŁASNOCIAMI STRUKTUR PŁYTOWYCH TENSEGRITY
Przedmiotem dalszych rozwaa jest struktura płytowa zbudowana z modułów tensegrity przedstawionych na
Rys. 2 (dokładny opis geometrii modułu i konfiguracji wzłów znale mona w pracy [3]). Wykorzystane bd
moduły „lewy” i „prawy” w zalenoci od kierunku obrotu trójkta górnego wzgldem dolnego. Na Rys. 3
przedstawiono wpływ siły sprajcej w pojedynczym module na przemieszczenie poziome górnego trójkta,
spowodowane poziom sił skupion.
Rys. 2. Pojedynczy moduł tensegrity
ɷ ΀ŵŵ΁
^ ΀ŬE΁
Rys. 3. Wpływ samosprenia na przemieszczenia pojedynczego modułu tensegrity
~ 48 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Przy pewnej wartoci siły sprajcej nastpuje wzrost przemieszczenia, co oznacza, e spranie przestaje
usztywnia tensegrity, a zaczyna dominowa nad obcieniem zewntrznym. Takiego sprenia naley unika.
Przy wartoci sprenia bliskiej zeru przemieszczenie dy do nieskoczonoci, gdy moduł tensegrity jest
infinitezymalnie geometrycznie zmienny.
Na Rys. 4 przedstawiono struktur płytow, która składa si z 14 odwróconych modułów z Rys. 2, ułoonych na
przemian, tak, aby stykały si niektóre z wzłów płaszczyzny dolnej płyty. Moduły tensegrity połczono
dodatkowymi prtami w płaszczynie dolnej, w których, pod obcieniem pionowym skierowanym w dół,
wystpuj siły rozcigajce. Mog one zatem by cignami.
a)
b)
c)
d)
Rys. 4. Struktura płytowa zbudowana z modułów tensegrity – rysunek aksonometryczny a) i trzy rzuty b-d)
Płyta podparta jest w czterech punktach na płaszczynie górnej i obciona pionow sił skupion skierowan w
dół (por. Rys. 5a). Przedmiotem analizy jest wpływ sprenia poszczególnych modułów tensegrity na
przemieszczenie pionowe pod sił skupion. Połoenie spranych modułów oznaczono na Rys. 5a cyframi 1-7.
Wyniki oblicze przedstawiono na Rys. 5b. Jako „FULL” oznaczono równoczesne sprenie wszystkich
modułów. Podobnie, jak w przypadku pojedynczego modułu, przy braku sił sprajcych, struktura płytowa jest
infinitezymalnie geometrycznie zmienna i przemieszczenia d do nieskoczonoci. Wraz ze wzrostem sił
sprajcych przemieszczenia gwałtownie malej. Przy wartoci siły sprajcej S=3000 kN badane
przemieszczenie osiga warto 25.15 mm, niezalenie od połoenia spranego modułu. Rozkład
przemieszczenia przy dalszym wzrocie sił sprajcych zaley od połoenia modułu spranego, cho pod
wzgldem jakociowym jest zawsze taki, jak dla pojedynczego modułu (Rys. 3). Najwikszy jest wpływ
sprenia wszystkich modułów, a w drugiej kolejnoci modułów, które znajduj si z pobliu obcienia i
analizowanego przemieszczenia (1,2,3). Sprenie modułów 4-7, po gwałtownym spadku przemieszczenia do
wartoci 25 mm, nie powoduje dalszych znaczcych zmian.
~ 49 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
a)
ɷ ΀ŵŵ΁
b)
^΀ŬE΁
Rys. 5. a) Struktura z zaznaczonymi modułami samonapronymi,
b) Wpływ samonapre modułów na przemieszczenie pionowe pod sił skupion
4
WNIOSKI
Wyniki przedstawione w referacie stanowi przyczynek do oceny moliwoci sterowania własnociami struktur
płytowych typu tensegrity za pomoc samorównowanych układów sił podłunych w wybranych modułach
konstrukcji. Analiza struktur daje obiecujce wyniki i wskazuje na zasadno podjcia tego zagadnienia.
Dalszych bada wymaga dobór spranych modułów w zalenoci od celu, który chcemy osign w
rzeczywistej konstrukcji inynierskiej, wybór modułów tensegrity i sposobów ich połczenia, zagadnienia
odpowiedzi dynamicznej struktur na działanie obcie wyjtkowych. Struktury płytowe z moliwoci
sterowania ich własnociami mog stanowi interesujcy obszar zastosowa inynierskich.
LITERATURA
[1]
[2]
[3]
[4]
[5]
[6]
Culshaw, B.: Smart structures and materials. Artech House, Boston, 1999.
Gandi M.V., Thompson B.S.: Smart materials and structures. Chapman & Hall, London, 1992.
Gilewski, W. - Kasprzak, A.: Wstp do Mechaniki Modułów Tensegrity, edited by: Jemioło S., Lutomirski
Sz., Teoretyczne podstawy budownictwa. Vol. I. Mechanika materiałów i konstrukcji. OWPW, Warszawa
2012, pp. 83-94.
Juang G.J.N., Sae-Ung S., Yang J.N.: Active control of large building structures. Structural Control.
H.M.E. Lipholz, ed., North-Holland, Amsterdam, 1986.
Motro, R.: Tensegrity: Structural Systems for the Future, Kogan Page Science, London 2003.
Skelton, R. E. – de Oliveira, M. C.: Tensegrity Systems. London 2009.
~ 50 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
ACTIVE MONITORING WITH USE OF SMART STRUCTURES
BASED ON HIGH-STRENGTH FIBRE COMPOSITES AS A
METHOD OF STRUCTURAL ELEMENTS OPTIMISATION
M. *yUVNL1, A. Knoppik-:UyEHO2 and M. .R]áRZVNL3
Abstract
Currently used methods for design, maintenance and strengthening of buildings not always ensure both costeffective design and safe use of the structure. In the countries where buildings are subject to complex effects
such as earthquakes, floods, communication effects, individual protection systems are commonly used in which
technical textiles are applied. Although strengthening systems based on high-strength fibres are known for over
20 years, they are still undervalued by structural engineers. At the same time their application in other branches
of industry (aerospace, automotive, clothing, healthcare and sports) develops dynamically. The fibre-based
composites are used to form the smart structures, which apart from continuous collection of data about
behaviour of the building enable active compensation of undesired effects. The paper presents an overview of the
methods for structural health monitoring focused on active methods for continuous real-time monitoring of
buildings with use of smart textiles.
Key Words
civil engineering infrastructure; high-strength fibre composites; smart materials; smart structures; structural
health monitoring.
1
INTRODUCTION
The task of structural engineer is to provide a satisfactory level of safety for a designed building, which means to
ensure the load-bearing capacity and durability of individual structural elements as well as stability and
robustness of the structure as a whole. The loss of any of those features has a major impact on the quality of the
building, at least by reduction of comfort or functionality, at most ± by leading to a catastrophe. The structure
may be damaged in a number of ways. One of the causes may be an excess of load-bearing capacity of the
element. The failure may also occur as a result of global stability loss, most often caused by excess deformation
of individual elements due to their insufficient stiffness. In both cases this may be caused by unforeseen overload
but also by deterioration of material properties (stiffness degradation). Finally, the structure may undergo failure
due to dynamic loading. This type of loading is extremely difficult to predict and model, yet it is so dangerous.
To ensure the required level of safety, durability and robustness of the structure it is common in the engineering
practice to overestimate the safety margins. In consequence, structural elements are overdesigned and
uneconomical. A method for improvement is application of active monitoring by use of smart materials, which is
1
3K'6(QJ0*yUVNLXO$NDGHPLFND-100 Gliwice, tel.: +48(32)237-22-88, [email protected]
MSc. SEng. A. Knoppik-:UyEHOXl. Akademicka 5, 44-100 Gliwice, tel.: +48(32)237-22-88,
[email protected]
3
06F6(QJ0.R]áRZVNLXO$NDGHPLFND-100 Gliwice, tel.: +48(32)237-22-88,
[email protected]
2
~ 51 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
the topic of the INSYSM project realised in co-operation with European partners in the domain of structural and
material engineering. The idea focuses on application of materials based on high-strength fibres in the systems of
active monitoring by introduction of the intelligent system of sensors and actuators into their structure. The use
of such composite materials will allow for real-time monitoring of the structure and active compensation of its
undesired behaviour such as unexpected overload, excess vibration or deterioration.
2
COMPOSITE MATERIALS BASED ON HIGH-STRENGTH FIBRES
Fibre-reinforced polymer (FRP) is a composite material consisting of a polymer matrix and reinforcing fibres.
Commonly used reinforcement in FRP involves high-strength glass, aramid, carbon, basalt, metal and ceramic
fibres while typical polymer matrix is made of an epoxy, polyester thermosetting plastic or vinylester.
Mechanical properties of the composite are mainly provided by reinforcement, but also the matrix. The FRP is
commonly used in aerospace, automotive, marine, and construction industries.
Depending on the application FRP should exhibit balanced proportions of properties of the matrix and fibres.
FRP for high-demanding applications should present suitable high strength/stiffness-to-weight ratio as compared
to other structural materials. The composite should be resistant to corrosion and fatigue, which often pose
problems to most metals and alloys. Moreover, the composites should be competitive regarding cost efficiency.
A variety of materials suitable for reinforcement in FRP meet those requirements. Tab. 1 shows an overview of
basic mechanical properties of commonly used high-strength fibres. Although main function of the
reinforcement is strictly structural, other physical properties become increasingly more important when
considering the use of composites in smart structures, for example light transmission through glass fibres or
electrical conductivity of carbon fibres. Thanks to its fibrous structure, it is possible to use a combination of
different fibres or even place other elements necessary for functioning of smart structures in between.
Type of fibres
Glass
Aramid
Carbon
Basalt
Tensile stress [MPa]
1750-4500
3500-4100
1000-6000
3000-4840
Modulus of elasticity [GPa]
65-87
70-200
215-640
79-93
Elongation at break [%]
2.4-5.5
1.8-5.0
0.2-2.3
3.1
Tab. 1. Comparison of characteristics of chosen high-strength fibres [3, 6].
Glass fibres are broadly used as insulation materials, filtering media and optical fibres [4]. Combined with a
polymer matrix, glass fibres form glass-fibre reinforced plastic (GFRP). Depending on the application, GFRP is
available in many forms from mats with randomly oriented fibres to yarns with fibres strictly orientated to the
principal stress axes. GFRP shows significant strength-to-weight ratio and is much cheaper than other FRPs.
Aramid fibres present high tensile strength, especially under impact load. Aramid-fibre reinforced plastic
(AFRP) is mainly used in military, automotive and aerospace industry. In construction industry, AFRP is used
for applications requiring high modulus of elasticity. They are available in a form of dry fabrics, unidirectional
sheets as well as pre-formed strips and profiles.
Carbon fibres are characterised with excellent tensile strength. Carbon-fibre reinforced plastic (CFRP) has many
application requiring high strength and rigidity. CFRP is commonly used in aerospace, automotive industry and
increasingly as consumer and sporting goods. Strengthening of concrete and masonry structures is a big market
for CFRP. A very important feature of carbon fibres is its ability to conduct electricity. Although extremely
expensive in production, carbon fibres are the most promising material being still under development.
Basalt fibres, besides good mechanical properties, exhibit good thermal, electrical and sound insulation
properties [4]. Basalt fibres are widely used in industry as fire protection in a form of fabrics and tapes and
insulation of high-voltage wires. Thanks to its high resistance to aggressive media, basalt fibres are used for
production of pipes transporting corrosive liquids and gases. As compared to other materials basalt fibres are
comparably cheaper and have prospects in mass production.
Steel reinforced plastic (SRP) is a composite material where unidirectional high-strength twisted steel wires are
impregnated in thermosetting resin [1]. SRP is used for strengthening concrete and steel structures.
3
MONITORING OF STUCTURES
Plenty of methods and systems for damage detection have been developed for aerospace, mechanical and also
civil engineering infrastructure, starting from simple, local measurements to advanced continuous monitoring.
~ 52 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
However, majority of those systems provide passive monitoring of structures which, although precise and
automatic, allows only for data acquisition and requires human reaction to compensate the observed damage.
Fig. 1. The concept of smart materials, smart structures and intelligent structures
The alternative for those classic measurements is application of smart structures using smart materials, which
change their properties in a controlled way as a reaction to the external stimulus. Smart materials are usually
composite materials which apart from the main structural part contain distributed sensors and actuators. A smart
structure apart from having a sensor feature and an actuator feature involves additionally an external feedback
due to a control system [8, 9]. Smart structures are related to living systems like a human body: sensors act as
nerves and actuators act as muscles; the control centre is brain. The ultimate form of smartness are intelligent
structures which have the added capability of learning [7]. The concept is described in Fig. 1.
The beginnings of smart structures are connected with aerospace industry [8]. However, smart structures soon
found application in other branches of industry, such as automotive, health protection or clothing. They are
applied mainly for damping or control of vibrations, especially in rotary elements of machines and vehicles [8].
The areas of application of smart structures in civil engineering comply with the initial applications of those
systems. Smart structures are used mainly to dampen vibrations, so in building structures susceptible to dynamic
loads, especially in buildings in the areas vulnerable to earthquakes, in structural elements of bridges and in
high-rise buildings subject to wind loads. The systems are also applied to sense cracks or corrosion.
The main feature of smart structure is realised by the system of distributed sensors/actuators. This is realised
with use of a single material which can act as both sensor and actuator or by a combination of materials. Sensors
in smart structures are made mainly with use of optical fibres [9]. Optical fibres have one undeniable feature ±
they can be easily braided into composite materials. Fibre optics can be used for measurement of temperature,
pressure, rotation, acceleration, acoustics, chemical composition, radiation, fluid flow and liquid level [7].
Actuators in smart structures are made with use of a variety of materials, the most popular of which are
piezoelectric materials and shape-memory alloys, but also electro- and magneto-strictive fluids and electrorheological fluids as well as ferroic materials. Piezoelectric materials are either ceramic or polymeric
electromechanical transducers which, thanks to reversibility of piezoelectric effect, can act as both sensors and
actuators [7]. The most popular piezoelectric material is a PZT piezoceramic (lead zirconate titanate) [8, 9].
Second most popular group of materials are shape-memory alloys which have a memory because of a transition
that occurs within them between two separate phases [7]. Most often used property of those alloys is transition
between martensitic and austenitic phase in the conditions of variable temperature [8]. Most of the shapememory alloys are titanium-based [7] with the most popular Nitinol (alloy based on nickel and titanium).
4
SMART STRUCTURES BASED ON HIGH-STRENGTH FIBRES COMPOSITES
A composite structure made of high-strength fibres allows of easy braiding of other, fibrous materials. Therefore,
the first idea was to implement fibre optics into the structure of fibre-reinforced polymers [5]. Such a composite
materials are used as both reinforcement and real-time structural health monitoring device. They have been
widely adopted in most high technology engineering applications such as a smart wing in aerospace and aircraft
industry, where they are used not only as sensors but also as a primary structure. In civil engineering their
application is conceptual. FRP sensors are used mostly when reinforcement of concrete structures is applied; as
structural materials they are mostly used in bridge cables.
~ 53 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Because of its ability to conduct electric current, carbon is mostly used as a basic material in smart composite
materials. It is characterised with an intrinsic smartness due to its ability of self-monitoring so there is no need to
embed additional sensors into the structure of carbon-fibre-based composite. Carbon-based materials may
incorporate solely carbon fibres, glued by non-conductive polymer matrix, or carbon±carbon composites where
also the matrix has conductive properties [2]. They have the ability to sense reversible strain and damage in their
own structure, which are the relevant quantities in structural health monitoring.
Currently the work with smart materials in structural engineering applications remains largely theoretical with
few existing examples available for discussion. The existing examples of the application of material based on
high-strength fibres in architecture are that of the theoretical project of Peter Testa who designed a Carbon
Tower prototype DQG-HQQ\6DELQ¶VH%UDLG7RZHUSURWRW\SH7KH&DUERQ7RZHULVGHVLJQHGWREHDFDUERQILEUH
structure which primary structure is a pre-compressed double helix. Regarding the properties of carbon fibre
there is a great potential of construction of a lightweight, high-resistant and ± most importantly ± intrinsically
smart building. The structure of the eBraid Tower is designed to be composed of many interlaced strands,
featuring two interconnected braids: an external braided carbon fibre grid superstructure and an internal
conducting braid. It is aimed to be an energetically passive building.
5
SUMMARY AND CONCLUSIONS
Increasing demand for properties of materials that allow for construction of more slender structures led to
development of materials that are both strong and lightweight. Recently, smartness was added to those features.
Among the materials which satisfy those requirements, fibre-reinforced composites are most promising. Due to
their composite structure, numerous fibrous materials which exhibit smart features can be braided to create smart
structures. The main feature of smart structure is realised by the system of distributed sensors/actuators. Most
preferably this is done with use of a single material, alternatively by a combination of materials to form a
composite structure. Sensors in smart structures are made mainly with use of optical fibres; actuators are made
mostly with use of piezoelectric materials and shape-memory alloys. Because of its ability to conduct electric
current, carbon is mostly used as a basic material in smart composite materials. It is characterised with an
intrinsic smartness due to its ability of self-monitoring. Currently the work with smart materials in structural
engineering applications remains largely theoretical. The existing examples of the application of material based
on high-strength fibres in architecture are Carbon Tower ProtRW\SH E\ 3HWHU 7HVWD DQG -HQQ\ 6DELQ¶V H%UDLG
Tower Prototype. Those examples show a great potential for construction of lightweight, high-resistant and ±
most importantly ± intrinsically smart buildings.
ACKNOWLEDGEMENT
This paper has been supported by INSYSM Project founded by the European Commission in the 7 th Framework
Programme Marie Curie Industry±Academia Partnership and Pathways (Project No. 251373).
REFERENCES
[1]
Casadei, P. ± Nanni, P.: Steel reinforced polymer: an innovative and promising material for strengthening
the infrastructures. Concrete Engineering International, 9(1), 2005.
[2]
Chung, D.D.L.: Self-monitoring structural materials. Materials Science and Engineering, 22: 57±78, 1998.
[3]
*yUVNL 0 5HVHDUFK DQG WKHRUHWLFDO EDVHV IRU VWUHQJWKHQLQJ RI RC structures with FRP subjected to
flexure, shear and torsion. PhD thesis. Silesian University of Technology, 2005.
[4]
Hearle, J.: High-performance fibres. Woodhead Publishing, Cambridge, 2001.
[5]
Lau, K.-T.: Fibre-optic sensors and smart composites for concrete applications. Magazine of Concrete
Research, 55(1): 19±34, 2003.
[6]
Singha, K.: A Short Review on Basalt Fiber. International Journal of Textile Science, 1(4): 19±28, 2012.
[7]
Strong, A.B. ± Jensen, D.W.: Smart structures ± impractical or inevitable?.
http://strong.groups.et.byu.net/pages/articles/articles/smartstructuresa.pdf
Tylikowski, A.: Konstrukcje inteligentne (Smart structures). Journal of Theoretical and Applied
Mechanics, 4(35): 991±1002, 1997.
[8]
[9]
Wadhawan, V.K.: Smart Structures and Materials. Resonance, 10(11): 27±41, 2005.
~ 54 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
SHEAR AND BENDING CAPACITY OF COMPOSITE
STEEL-CONCRETE BEAMS
G. Gremza1
Abstract
The paper presents the results of investigation of composite steel-concrete beams, in which shear strength loadbearing capacity of the steel cross-section was availed of to a large extent (exceeding 80%) The aim was to find
a possibility of constraining the shear strength complying with the standards, simultaneously with the shearing
of the cross sections of beams of the class 1 or 2, and to find a way of increasing the critical load of beams with
a web of the class 4. Preliminary conclusions concerning the considered problem have been suggested.
Key Words
Steel-concrete composite structures; shear resistance; bending and shear resistance;
1
INTRODUCTION
Przy projektowaniu belek zespolonych stalowo-betonowych nono na cinanie standardowo przyjmuje si jako
równ nonoci na cinanie tylko belki stalowej. Po przekroczeniu 50% nonoci na cinanie zgodnie np. z [4]
dokonywana jest redukcja wytrzymałoci stali na rozciganie w cinanej czci belki stalowej. Innego rodzaju
ograniczenie nonoci moe wystpi w belkach ze rodnikiem klasy 4, w których niestateczno przy cinaniu
moe wyeliminowa ewentualne korzyci wynikajce z wykonania zespolenia. Poszukiwanie (ze wzgldów
poznawczych) moliwoci ograniczenia redukcji nonoci na zginanie z uwagi na cinanie stanowiło jedn
z przyczyn podjcia przedstawionych w artykule eksperymentów i ich analizy.
2
COMPOSITE BEAMS WITH HOT-ROLLED I-SECTIONS
Badaniu poddano dwie belki zespolone o przekrojach i schemacie statycznym przedstawionym na rys. 1. Belki te
wykorzystano wczeniej w badaniach efektów powodowanych skurczem betonu [2]. rednia wytrzymało
betonu na ciskanie fcm wynosiła po czterech tygodniach od betonowania 42,0 MPa, a wytrzymało na
rozciganie fctm = 3,06 MPa. Moduł dorany betonu Ec wynosił 31,5 GPa. Granic plastycznoci stali fy
okrelono na 285 MPa, moduł Younga stali Ea przyjto równy 210 GPa.
2.1 Test results
Belka BZ7K uległa zniszczeniu przez zmiadenie betonu pomidzy siłami skupionymi obok przekroju 2-2.
W belce BZ9K nono została wyczerpana na skutek głbokiego uplastycznienia dolnej półki przekroju
stalowego. W adnej z belek nie wystpiło uszkodzenie połczenia pomidzy belk a płyt. Nie stwierdzono
równie w adnym miejscu widocznych deformacji rodnika wywołanych cinaniem lub pionowym naciskiem
od obcienia skupionego. Pomierzone odkształcenia belki stalowej w przekroju 3-3 wskazuj, e osignito
stan graniczny nonoci ze wzgldu na zginanie z niemal pełnym uplastycznieniem belki stalowej (patrz Fig. 1).
1
Dr. G. Gremza, Silesian Technical University, 482372224, [email protected]
~ 55 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Fig. 1. Examined beams: a) static scheme and strain gauges arrangement, b) cross-sections of beams
and measured strains in cross-sections 3-3 (without strains from shrinkage and self-weight)
Najwiksze wartoci siły poprzecznej V i momentu zginajcego M uzyskane w badaniach oraz obliczone
zgodnie z załoeniami podanymi w [4] według schematu przedstawionego na rys. 2 zestawiono w tablicy 1.
Uzyskane wartoci obcienia wskazuj, e ze wzgldu na współprac płyty redukcja nonoci na zginanie moe
by potencjalnie mniejsza ni obliczono według [4].
Max. moment M
Max. shear force V
value reached during the value reached during the
test in cross-section:
test in cross-section:
Beam
2-2
3-3
2-2
3-3
kN
kN
kNm
kNm
BZ7K
115,2
0
57,7
58,0
BZ9K
134,5
0
67,4
67,9
Plastic shear
capacity Vpl
of steel beam
according to [4]
kN
125,3
125,3
Calculated bending
capacity Mpl
according to [4]
for V = 0 for V = Vpl
kNm
kNm
58,2
33,0
67,5
38,0
Tab. 1. Values of forces and calculated capacities according to [4] (cross-section - see Fig. 1)
Fig. 2. Scheme of stress distribution for determine bending capacity according to [4]
2.2 Cross-sections of beams in elastic range
Praktycznie liniowe zalenoci obcienie-odkształcenie odnotowywano do wartoci momentu zginajcego
30,3 kNm i 35,0 kNm w przekroju 3-3. W przekroju 1-1 wartoci tych nie przekroczono. Na podstawie wyników
pomiarów tensometrycznych i ogólnie znanych liniowo-sprystych zwizków konstytutywnych okrelono
zatem wartoci napre i odkształce w punktach pomiarowych w przekrojach oznaczonych jako 1-1 (patrz
Fig. 1). Wartoci te porównano z wynikami oblicze teoretycznych w zakresie sprystym, w których przyjto
przekrój zastpczy przedstawiony na rys. 3. Potwierdzono, e przekrój pracuje jako jednolity zarówno przy
zginaniu, jak i przy cinaniu (Fig. 4). Udział belki i płyty w przenoszeniu obcie w fazie sprystej (przy Ec =
31,5 GPa) oszacowano na 73,7 % i 26,3 % w belce BZ7K oraz 71,1 % i 28,9 % w belce BZ9K. Analiz
sztywnoci przekroju przy zginaniu i cinaniu oraz rozdział siły poprzecznej w fazie sprystej przedstawiono
szerzej w pełnej wersji referatu na CD.
Fig. 3. Substitute cross-section in elastic range of the beam (for bending)
~ 56 ~
140
shear force (kN)
shear force [kN]]
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
140
120
120
100
80
60
40
20
0
-20
BZ9K, tension
BZ9K, compr.
BZ7K, tension
BZ7K, compr.
(7cm, th. tens.)
(7cm, th. comp.)
(9cm, th. tens.)
9cm, th. comp.)
steel beam I140PE
-15
-10
100
80
60
BZ9K (mean)
BZ7K (mean)
BZ9K, calculated
BZ7K, calculated
steel beam I140PE
40
20
-5
0
5
10
15
principal strain [0,1 promil]
0
-50
0
50
100
150
200
250
shear stress (MPa)
Fig. 4. Comparison of theoretical strain and stress value with stress obtained from test (cross-section 1-1)
2.3 Ultimate limit state – bending and shear resistance
Nono plastyczn belki stalowej na cinanie obliczono według znanego wzoru (opis na Fig. 2):
V pl = AV f y / 3
(1)
Nono na cinanie przekroju zespolonego obliczono jako równ nonoci na cinanie belki stalowej i nonoci
na cinanie płyty. Nono płyty w stanie zarysowanym ze wzgldu na nono fikcyjnego ciskanego krzyulca
według modelu kratownicowego wzorowanego (Fig. 5) obliczono według wzoru zaczerpnitego z [3]:
V R , plate = b w zυ 1 f cm (cot θ + tan θ ) .
(2)
w którym przyjto: υ 1 = 0,6 , cot θ = 2 (typowo dla płyt).
Fig. 5. Truss model for shear reinforced plate in ultimate limit state
Jednoczenie z sił ciskajc w fikcyjnym krzyulcu, w sworzniu wystpowa bdzie siła rozcigajca, któr
naley uwzgldni przy obliczaniu nonoci połczenia na cinanie (opis na Fig. 5):
Fstud = V plate a tan θ / z .
(3)
Dla kompletnoci obliczono nono płyty z pominiciem zbrojenia na cinanie według [5]:
V R , plate = 0,35(1 − ( z + x / 2)) f ctm (1,2 + ρ L )bw t p , gdzie ρ L = b f t f / t p bw ≤ 0,01
Part in shear capacity
of cross-section
beam
plate
formula
kN
%
%
BZ7K
(2)
78,28
61,6
38,4
BZ9K
(2)
103,9
54,7
45,3
BZ7K
(4)
77,08
61,9
38,1
BZ9K
(4)
97,81
56,2
43,8
*Warto bw przyjto równ szerokoci półki belki
na docisk betonu do półki według [5]: bw = 1,73 bf .
Shear capacity of
plate:
Beam
(4)
Calculated
M from Effective width
Mpl,v
test
bw
(formula (5))
kN
kN
kN
70,89 0,0172
57,7
57,7
12,64 cm*
73,59 0.0304
66,7
67,4
12,64 cm*
71,31 0,0190
57,7
57,7
b = 42 cm
75,60 0,0426
66,3
67,4
b = 42 cm
stalowej bf = 7,3 cm powikszonej ze wzgldu na nono
Vbeam
ρ
Tab. 3. Shear and bending capacity of cross-section taking into account the cooperation of a plate
Udział belki stalowej w przenoszeniu obcienia cinajcego w stanie granicznym nonoci ustalono w sposób
uproszczony, przyjmujc jako wprost proporcjonalny do jej udziału w nonoci całkowitej:
~ 57 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Vbeam = V (V pl /(V pl + VR , plate )) .
(5)
Dla tak rozdzielonych sił poprzecznych obliczono nono na zginanie całego przekroju według wzoru (opis na
Fig. 2):
M pl = (( A − AV ) + AV (1 − ρ )) f y ( d c − 0,5 x) , gdzie: ρ = ((2Vbeam / V pl ) − 1) 2 .
(6)
Wyniki oblicze zestawiono w tablicy 3.
3
BEAMS WITH WEBS CLASS 4
Badania belek ze rodnikiem klasy 4 obcionych sił skupion przedstawili autorzy pracy [1]. W badanych
belkach, obecno płyty elbetowej spowodowała podwyszenie wartoci obcienia krytycznego rodnika belki
stalowej. Łagodniejszy ni w belkach stalowych był równie przebieg deformacji rodnika. Zniszczenie belek
nastpiło przez zniszczenie połczenia belki i płyty, wywołane przez siły pola cignie, przy obcieniu
wikszym o około 19 i 28 % ni obcienie krytyczne.
Udziały poszczególnych elementów przekroju w przenoszeniu siły poprzecznej w chwili wystpienia
niestatecznoci rodnika, okrelone zgodnie z teori sprystoci według wzorów podanych w [1], zestawiono
w tablicy 3. Rezultaty oblicze według tych wzorów pokrywały si z wnioskowaniem na podstawie odczytów
tensometrycznych. W ostatnim wierszu tablicy przedstawiono wyniki bada uzyskane na 6 belkach stalowych
o identycznym przekroju i rónych rozpitociach, lecz bez płyty elbetowej.
Shear force at the moment of initializing of web
buckling (critical shear force):
Plate
Span
dimension
L
in whole cross
in web
in plate
- section
(formula in [1]) (formula in [1])
cm
m
kN
kN
kN
12 x 30
2,8
191,5
170,9
17,9
12 x 80
2,8
208,0
179,8
25,5
1,9-6,0
103-107,5
103-107,5
beams without plate
Tab. 3. Critical forces in beams with slender web 4 class (abstract from [1])
4
SUMMARY
W przedstawionych badaniach potwierdzono tez, e dziki przenoszeniu czci siły poprzecznej przez płyt
elbetow mona ograniczy redukcj wytrzymałoci materiału belki stalowej na rozciganie w obszarze
przekroju czynnego przy cinaniu. W belkach stalowo-betonowych klasy 1 lub 2 z niezbyt wysokimi
przekrojami stalowymi umoliwia to istotne ograniczenie redukcji nonoci przekroju zespolonego na zginanie
z powodu cinania.
W belkach ze rodnikiem klasy 4 wykonanie płyty elbetowej połczonej z belk stalow pozwala na
podniesienie wartoci obcienia krytycznego na cinanie w porównaniu do belki bez zespolenia. Po
wystpieniu niestatecznoci powstaj jednak znaczne dodatkowe siły obciajce połczenia belki z płyt.
Z tego powodu korzystny efekt zespolenia mona wykorzysta jedynie czciowo.
REFERENCES
[1]
Gremza G., - Basiski, W.: Badania wpływu zespolenia z płyt betonow na nono na cinanie belek ze
rodnikiem falistym. Konstrukcje Stalowe, nr 5/2011, pp. 25-29.
[2]
Zamorowski, W., - Gremza, G.: Badania wpływu skurczu betonu na ugicia i odkształcenia belek
zespolonych stalowo – betonowych. Przegld Budowlany, 2/2006, pp. 18-22.
[3]
EN 1992-1-1: Eurocode 2: Design of concrete structures - Part 1-1: General rules and rules for buildings
[4]
EN 1994-1-1: Eurocode 4: Design of composite steel and concrete structures - Part 1.1: General rules and
rules for buildings
[5]
PN-B-03264:2002: Konstrukcje betonowe, elbetowe i sprone. Obliczenia statyczne i projektowanie.
~ 58 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
PARTIALLY ENCASED COMPOSITE STEEL-CONRETE BEAMS
EXPOSED TO TORSION
G. Gremza1
Abstract
This paper presents the test results concerning asymmetric composite steel-concrete beams with a plate and
a partially encased web subjected to torsion. These results were compared with results obtained in analytical
model, which is a combination of previously known classical models of steel and concrete structures and own
proposals. The variations of the rigidity of the element as a function of load and the effect of the degree
of cooperation between steel and concrete on the stiffness and capacity of a composite beam is described.
Key Words
Composite beam, torsion
1
WPROWADZENIE
W obliczeniach statycznych wystpuj sytuacje, np. w rusztach czy skrajnych belkach mostów, w których
sztywno zespolonego przekroju na skrcanie w istotny sposób wpływa na wartoci sił wewntrznych.
W monografiach z zakresu konstrukcji warstwowych i zespolonych zagadnienie to jest niekiedy ujmowane. Nie
uwzgldniono go natomiast w Eurokodzie 4. Przedstawiane w publikacjach rozwizania dla nieobetonowanej
belki, połczonej z płyt elbetow, oparte s głównie na zastosowaniu sprowadzonego przekroju
cienkociennego o charakterystykach materiałowych odpowiadajcych belce stalowej.
Znacznie mniej publikacji dotyczy natomiast elementów z czciowo obetonowanymi rodnikami.
W opracowaniach zazwyczaj pomija si take ewentualny wpływ sposobu ukształtowania styku na nono
i sztywno elementu poddanego skrcaniu oraz zmian jego zachowania si pod wpływem zmieniajcych si
wartoci obcienia. Tymczasem do powszechnie wykonuje si konstrukcje, w których połczenie wykonano
z łczników podatnych. Majc powysze na wzgldzie, podjto badania majce docelowo ułatwi opracowanie
technicznego modelu elementu zespolonego stalowo-betonowego poddanego skrcaniu, w tym take elementu
niesymetrycznego.
2
ANALIZOWANE ELEMENTY I METODYKA BADA
Belki stalowe zaprojektowano z kształtownika walcowanego I200PE. Połczenie midzy belk a płyt elbetow
zapewniono za pomoc sworzni przyspawanych do górnego pasa belki, w rozstawach co 8 cm w elemencie BS5
i 16 cm w elemencie BS6. Przez otwory w rodnikach belek stalowych przeprowadzono strzemiona
o rednicy 6 mm, majce zapewni ich połczenie z obetonowaniem. Zrezygnowano z prtów zbrojenia
podłunego w celu sprawdzenia skutecznoci obetonowania bez ich udziału. Powierzchni belek przeznaczonych
do zespolenia z betonem nie malowano. W wersji pełnej referatu na CD podano wartoci wytrzymałoci
i siecznego modułu betonu.
1
Dr. G. Gremza, Silesian Technical University, 482372224, [email protected],pl.
~ 59 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Badania przeprowadzano na stanowisku, które umoliwiało obcianie elementu próbnego momentem
skrcajcym, bez skrpowania przekrojów podporowych. Osiowy rozstaw podpór wynosił 1,9 m, przy czym
obcienie przykładano po jednej stronie (przekrój A-A), natomiast po drugiej stronie (przekrój B-B)
przekazywane były jedynie reakcje. Kolejny poziom obcienia osigano po kilku cyklach obciania
i odciania elementu. Układ pomiarowy opisano w wersji pełnej referatu na CD.
a)
b)
Fig. 1. The cross-sections of elements a) BS1, b) BS5 i BS6
Fig. 2. Test arrangement
3
NONO I SZTYWNO BELEK TEORETYCZNA I WEDŁUG POMIARÓW
W tablicy 1 zestawiono nonoci i wartoci momentów rysujcych uzyskane w badaniach oraz nonoci
obliczone teoretycznie jako sumy nonoci belki i płyty (wg p. 3.2 i p. 3.3).Wartoci obrotów i deplanacji
przekroju oraz analiz opart na tych wartociach a take obliczone wartoci momentu rysujcego Tcr
przedstawiono w wersji pełnej referatu na CD.
Beam
BS2
BS5
BS6
Torsional moment values from test
(kNm):
Calculated values
of torsional capacity (kNm):
maximum
cracking Tcr
plate
beam
altogether
Distance
between
studs (cm)
5,89
22,72
22,25
1,62
10,05
9,23
6,05
6,05
6,05
12,70
12,70
6,05
18,75
18,75
8
16
Tab. 1. Comparisons of calculated torsional capacities (kNm) and the test results
3.1 Nono teoretyczna przekroju płyty elbetowej
Do obliczenia nonoci prostoktnego przekroju elbetowego płyty na skrcanie wybrano po wstpnej analizie
propozycj zawart w pracy [7] (wzór (1)):
−1
§
u1
4u ·¸ .
Tu , p = 2 A 2 ¨
+
¨ ρ f cot θ
f c ¸¹
© t ty
(1)
We wzorze (1): A – pole przekroju elementu, u – obwód elementu, u1 – obwód w osi strzemienia, – kt
nachylenia rysy wzgldem osi elementu (utosamiony z ktem nachylenia krzyulców betonowych), fty – granica
plastycznoci zbrojenia poprzecznego, t – moc zbrojenia poprzecznego, obliczona wg wzoru:
ρt =
Aswu1 .
As
(2)
Dla rzeczywistego kta krzyulca ciskanego = 49° obliczona nono na skrcanie wynosi 12,7 kNm,
natomiast dla kta = 44°, obliczonego zgodnie z norm PN-B-03264:2002, uzyskano warto 14,2 kNm.
~ 60 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
3.2 Nono przekrojów belek ze rodnikiem obetonowanym
Nono teoretyczn belki czciowo obetonowanej na skrcanie (Fig. 3) obliczono przy załoeniu, e nono
ta zostanie osignita po wyczerpaniu nonoci wydzielonych krzyulców betonowych. Siły w krzyulcach s
równowaone przez układ napre w belce stalowej, a jednoczenie mechanizm przenoszenia sił pomidzy
rodnikiem belki a betonem nie ulega wyczerpaniu przed wyczerpaniem nonoci krzyulców. Przyjmujc
powysze załoenia, w konsekwencji zastosowano wzór (3):
Tu ,b = Ne sin α = 0,25b(b 2f − t w2 ) f c sin 2 α ,
(3)
w którym: N – nono krzyulca, b – szeroko krzyulca, e – odległo rodków cikoci dwóch powierzchni
betonowych w przekroju, po obu stronach rodnika, bf i tw – szeroko półki dwuteownika i grubo jego
rodnika.
Fig. 3. Schemat do wzoru 3
Szeroko krzyulców przy szacowaniu nonoci elementu przyjto równ około 0,9 wysokoci rodnika.
Warto ta odpowiada rozstawowi strzemion przeplecionych przez rodnik oraz obrazowi zarysowania belki
BS1. Nono elementu obliczona według wzoru (3) wynosi Tu,b = 6,05 kNm, podczas gdy w trakcie badania
uzyskano moment o wartoci 5,89 kNm (tabl. 1). Oszacowanie zatem mona wstpnie uzna za prawidłowe.
3.3 Porównanie nonoci sumarycznych z wynikami eksperymentu
Analizujc wyniki zestawione w tablicy 1 mona stwierdzi, e w belkach połczonych z płyt nono
rzeczywista była wiksza od sumy nonoci obliczonych wg wzorów (2) i (3) o ponad 18 %. Wynika to midzy
innymi z pominicia wzajemnego usztywnienia elementów przez ich połczenie.
3.4 Analiza sposobów zarysowania elementów
Analizujc sposób zarysowania (Fig 4a) stwierdzono, e wikszo rys ukonych przechodzi bez uskoku z belki
na płyt, „przenikajc” przez stopk dwuteownika. Pierwsze takie rysy zaobserwowano przy wartoci obcienia
momentem skrcajcym 10,87 kNm (belka BS5) i 10,85 kNm (belka BS6), przy czym w przypadku belki BS5
było to po kilkukrotnym odcianiu i obcieniu dochodzcemu do tej wartoci. Mona zatem wnioskowa, e
belka zespolona pracuje w podobny sposób jak monolityczna belka ktowa, a strumienie napre przebiegajce
po powierzchni elementów s przynajmniej czciowo przekazywane pomidzy elementami (Fig. 4b).
a)
b)
Fig. 4. Obraz zarysowania (belka BS6) i przybliony schemat przenoszenia napre
3.5 Sztywno przekrojów
Wartoci teoretyczne sztywnoci w fazie pracy przed zarysowaniem obliczono według wzoru:
GI T = Ga I Ts + βGc ((b f − t w ) 3 ) hwα 1 + Gc (1 − 0,63t / b )t 3b / 3 ,
(4)
natomiast wartoci teoretyczne sztywnoci w stanie granicznym nonoci okrelono za pomoc wzoru:
GI T = Ga I Ts + 2Gc (0,5(b f − t w ) 3 )hwα +
4 E s Ao2 Acp § 4nλA 1
1 ·
/ ¨¨
+
+ ¸¸ ,
2
po
ρt ρl ¹
© po t d
We wzorach powyszych:
~ 61 ~
(5)
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
α1 = (1 / 3)(1 − 0,63((b f − t w ) / hw ) , oraz α = (1 / 3)(1 − 0,63(0,5(b f − t w ) / hw ) ,
(6)
t d = (4Tu ) /( Af c ) , Ao = A − ( 2Tu , p u ) /( Af c ) , po = 2(b − t d ) + (t − t d ) .
(7)
oraz:
Warto td oznacza grubo strefy współpracujcej przy przenoszeniu skrcania, n – stosunek wartoci modułów
sprystoci betonu i stali, = 0,73; pozostałe oznaczenia jak we wzorze 1. Warto na podstawie
rónorodnych danych zebranych w pracy [7] przyjto równ 3. Pełniejszy opis poszczególnych składowych
wzorów (4) i (5) oraz uzasadnienie ich przyjcia zamieszczono w wersji pełnej referatu na CD.
Distance
Beam between
studs
BS2
BS5
BS6
8
16
Tcr
Tangential stiffness ~20-80% Tcr
Test
Theory
0,8Tcr − 0,2Tcr
Range
B≈
(4)
ϕ (0,8T ) − ϕ (0,2T )
cr
kNm
1,62
10,05
9,23
kNm2
2240
2146
Ratio
cr
%
kNm2
21 do 80% Tcr 2356
17 do 82% Tcr 2356
Stiffness in ULS
Test
Theory
T
Ratio
Bu = u
(5)
ϕ
u
%
95
91
kNm2
46
242
234
kNm2
57
188
190
%
81
129
123
Tab. 2. Porównanie sztywnoci obliczonych na podstawie pomiaru i według wzorów (4) i (5)
Wartoci sztywnoci belek uzyskane na podstawie dowiadczenia zestawiono w tablicy 2. Pomidzy belkami
o rónym rozwizaniu zespolenia pojawiła si około 5% rónica sztywnoci. W tablicy 2 zestawione równie
wartoci sztywnoci kocowej obliczone według sumy wzorów (4) i (5), po rozdzieleniu momentu skrcajcego
według pocztkowych sztywnoci elementów składowych. Zalenoci midzy sztywnoci na skrcanie i
obcieniem przedstawiono na wykresie w pełnej wersji referatu.
4
SUMMARY
W pracy przedstawiono rezultaty bada belek zespolonych o przekroju ktowym ze rodnikiem czciowo
obetonowanym, poddanych czystemu skrcaniu. Rezultaty te porównano z wynikami oblicze za pomoc
prostych formuł. W kolejnych publikacjach autor zamierza przedstawi analiz wyników bada belek poddanych
zginaniu i skrcaniu oraz warunki przystosowania belek przy powtarzajcym si obcieniu.
ACKNOWLEDGEMENT
This paper has been supported by Polish Committee for Scientific Research (grant No. Nr 4 T07E 072 29)
REFERENCES
[1]
Bijak R. „Model obliczeniowy prtów cienkociennych” XLV Konferencja Naukowa KiLiW PAN i KN
PZiTB. Wrocław – Krynica 1999, str. 15-22.
[2]
Ciak, T.: Wymiarowanie skrcanych płyt elbetowych oraz belek o przekroju teowym. Archiwum
Inynierii Ladowej, 4/1985, str. 499-511.
[3]
Dall' Asta A.: „Composite beams with weak sherar connection" International Journal of Solids and
Structures 38 (2001), str. 5605-5624.
[4]
Heins, C.P., Kuo, J., T., C.: Composite beams in torsion. Journal of the Structural Division, May 1972, pp.
1105-1117.
[5]
Lindner, J, Budassis N.: Biegedrillknicken von kammerbetonierten Verbundtraegern ohne Betongurt.
Stahlbau, Heft 2/2001, str. 126-133.
[6]
Manus, P., Culver, C, G.:: Nonuniform Torsion of Composite Beams. Journal of the Structural Division,
June 1969, str. 1233-1255.
[7]
Teng, T. - Teng, S.: Effective Torsional Ridigity of Reinforced Concrete. ACI Structural Journal, No. 101S26, March – April 2004, pp. 252-260.
~ 62 ~
WK
3URFHHGLQJVRIWKH ,QWHUQDWLRQDO&RQIHUHQFHRQ
1HZ7UHQGVLQ6WDWLFVDQG'\QDPLFVRI%XLOGLQJV
2FWREHU%UDWLVODYD6ORYDNLD
)DFXOW\RI&LYLO(QJLQHHULQJ678%UDWLVODYD
6ORYDN6RFLHW\RI0HFKDQLFV6$6
67$%,/,7<$1'$&&85$&<2)'<1$0,&&$/&8/$7,212)
6758&785(6
-*\|UJ\L
$EVWUDFW
'XULQJWKHFDOFXODWLRQRIHODVWLFERGLHVWKHVROXWLRQLVLQWULJRQRPHWULFVHULHV7KHPHPEHULQWKHH[DFWUHVXOWLV
LQILQLWH %XWLQ WKH SUDFWLFH ZH XVH RQO\ VRPH QDWXUDO PRGHV 7KH TXHVWLRQ LV KRZ PDQ\ PHPEHU RI YLEUDWLRQ
IRUPLVHQRXJKIRUWKHFRUUHFWUHVXOWV":HKDYHVHHQWKDWWKHQXPEHUVZLOOEHGLIIHUHQWLQFDVHWKHGLIIHUHQWNLQG
DQGSRVLWLRQRIWKHH[WHUQDOORGHVDQGZLOOEHHQRXJKLQFDVHLIGLIIHUHQWNLQGRILQWHUQDOIRUFHV,IZHXVHWKH
ILQLWHHOHPHQWPHWKRGIRUFDOFXODWLRQRIWKHVWUXFWXUHWKHQXPEHURIIUHHGRPLVYHU\ODUJH7KHTXHVWLRQLVWKH
HQRXJKQXPEHURIWKHYLEUDWLRQIRUP,QWKLVFDVHZHKDYHWRDQDO\VHWKHIRUPRIWKHORDGVDQGYHU\LPSRUWDQW
WKHFRUUHFWFDOFXODWLRQRILQHUWLDOIRUFHVIURPWKHPDVVHVRIWKHVWUXFWXUH,IWKHUHLVDUHH[WHUQDOGDPSLQJZH
KDYH WR DQDO\VH WKH VWUXFWXUH RI WKH GDPSLQJ PDWUL[ WRR ,Q FDVH RI WKH DSSOLFDWLRQ RI QXPHULFDO LQWHJUDWLRQ
PHWKRGVLVYHU\LPSRUWDQWWKHFDOFXODWLRQRIWKHFRUUHFWYDOXHVRILQWHJUDWLRQWLPHVWHSV)LUVWZHKDYHWRDQDO\VH
WKHXQGDPSHGV\VWHPIRUWKHJHWWKHWLPHVWHSVDQGUHGXFHWKHVL]HVWKHPDWUL[GLIIHUHQWLDOHTXDWLRQV
.H\:RUGV
6WDELOLW\RIG\QDPLFFDOFXODWLRQ$FFXUDF\RIG\QDPLFFDOFXODWLRQ$SSUR[LPDWHG\QDPLFYDOFXODWLRQ
(;$&762/87,212)%($0$7029,1*)25&(
7KHVROXWLRQRIEHDPWRDWUDYHOOLQJIRUFHLQFDVHRI]HURLQLWLDOFRQGLWLRQV
§
f
US[
O
¨ VLQ USY W OY P VLQ U S
) ¦ VLQ
Y [ W PO U US (,
O
O
· ¨©
§ U S (,
O
U S ¨
Y ¸
¸
¨ O P
¹
©
(, ·¸
W P ¸¹
+HUHWKHYLVWKHYHORFLW\RIWKHPRYLQJIRUFHDQGWKHOLVWKHOHQJWKRIWKHEHDP7KH(,LVWKHVWLIIQHVVDQGȝLV
WKHPDVVRIWKHRQHPHWHURIWKHEHDP
,QWKHSUDFWLFHZHFDQXVHRQO\VRPHYLEUDWLRQIRUPDQGWKHQHFHVVDU\QXPEHURIWKHPZLOOEHGLIIHUHQWLQFDVH
RI FDOFXODWLRQ RI GLVSODFHPHQW PRPHQWV DQG VKHDU IRUFH )RU WKH FRUUHFW FDOFXODWLRQ RI GLVSODFHPHQW WKH WZR
YLEUDWLRQ IRUP ZHUH HQRXJK 7KH )LJ DQG )LJ VKRZ WKH FKDQJLQJ RI WKH QXPEHU RI WKH DSSOLFDWLRQ DW
GLIIHUHQWYLEUDWLRQIRUPV)RUWKHPRPHQWWKHIRXUYLEUDWLRQIRUPZDVHQRXJKEXWIRUWKHFRUUHFWFDOFXODWLRQRI
VKHDUIRUFH ZHKDYHWRXVHDERXWYLEUDWLRQIRUP7KHQHFHVVDU\QXPEHURIWKHYLEUDWLRQIRUPLVGHSHQGHQW
IURPWKHYHORFLW\WRR>@
3ULYDWH3URI&6F'U+DELO-*\|UJ\L +%XGDSHVW$UDQ\-iQRVXE3KRQHID[
HPDLOJ\RUJ\L#HSPHFKPHEPHKX
~ 63 ~
WK
,QWHUQDWLRQDO&RQIHUHQFHRQ1HZ7UHQGVLQ6WDWLFVDQG'\QDPLFVRI%XLOGLQJV
2FWREHU%UDWLVODYD
)LJ'\QDPLFLQIOXHQFHOLQHRIPRPHQWDWPVYHORFLW\
)LJ'\QDPLFLQIOXHQFHOLQHRIVKHDUIRUFHDWPVYHORFLW\
'<1$0,&2)'523,03$&7
7KHPDWUL[GLIIHUHQWLDOHTXDWLRQ
0[ .[ T +HUH 0 LVWKHPDVVPDWUL[KDYLQJWKUHHSDUWVWKHPDVVHVRIWKHVWUXFWXUHVDQGWHFKQRORJLFDOORDGVWKHPDVVRI
WKHGURSSLQJERG\ . LVWKHVWLIIQHVVPDWUL[RIWKHVWUXFWXUHV T LVWKHZHLJKWRIWKHGURSSLQJPDVV [ LVWKH
YHFWRURIWKHG\QDPLFGLVSODFHPHQWVRIQRGHVRIWKHVWUXFWXUHV6ROYLQJWKH .Y
Z 0 Y HLJHQYDOXHSUREOHP
DQGQRUPDOLVHHLJHQYHFWRUVWR 0PDWUL[WKHVROXWLRQLV
[W º
ª
Q
§
7
T¨ FRVZ U W ·¸ 0[ VLQZ U W » ¦ YU YU «
»
«Z ©
¹ Z
U »¼
«¬ U
U
7KH PRGDO GDPSLQJ ZDV WDNLQJ LQWR FRQVLGHUDWLRQ ,I DOO HOHPHQWV RI WKH VWUXFWXUH KDYH WKH VDPH GDPSLQJ
FRQVWDQWWKHQ
J ª
º
§ J Z W
·
·
Q
U
¸ ZU W §¨
J ¸
»
7« ¨
[W ¦ YU Y U «
T H
FRVZU W ¸ H
¨¨ 0[ ZU T ¸¸VLQZU W » ¨
ZU
U ¸ ZU
«¬ZU ¨©
»¼
©
¹
¹
+HUH ZU
Z U J
J
- LVWKHORJDULWKPLFGHFUHPHQWRIGDPSLQJ
S
~ 64 ~
WK
,QWHUQDWLRQDO&RQIHUHQFHRQ1HZ7UHQGVLQ6WDWLFVDQG'\QDPLFVRI%XLOGLQJV
2FWREHU%UDWLVODYD
,ILQRXUPRGHOWKHUHDUHPDQ\WKRXVDQGVRIGHJUHHVRIIUHHGRPVROXWLRQRIWKHHQWLUHHLJHQYDOXHWDVNLVRXWRI
TXHVWLRQ$GHFLVLRQPXVWEHWDNHQRQQXPEHURIHLJHQYHFWRUVQHFHVVDU\LQWKHJLYHQDSSOLFDWLRQ)URP
9 7 0 9
, o 9 7 0 9 o 99 7 0 , Q
99 7 0T
8VLQJDOORIHLJHQYHFWRUV T
7
¦ Y U Y U 0T U 7RGHFLGH ZKHWKHUWKHQXPEHURIWKHFDOFXODWHGHLJHQYHFWRUVPQLIVXIILFLHQWWKHIRUFH YHFWRUREWDLQHGE\
WKHDSSUR[LPDWHVROXWLRQFDQEHFRPSDUHGZLWKWKHRULJLQDOYHFWRU>@
a
T
P
7
¦ Y U Y U 0T z T U :HFDQVHHWKHFRQYHUJHQFHRQ)LJLQFDVHRIGURSSLQJERG\LQWKHPLGGOHRIWKHVODE0RUHWKDQKXQGUHG
HLJHQYHFWRUVLVQHFHVVDU\IRUDFRUUHFWVROXWLRQ)LJVKRZVWKHGLVSODFHPHQWVRIDPLGGOHSRLQWRIVODEIURP
WKHVL[PHWHUKLJKGURSSLQJPDVVZLWKWR>@
N1
PLVWKHQXPEHURIFRPSXWHGHLJHQYHFWRUV
P P P P QXPEHURIQRGHV
)LJ7KHQHFHVVDU\QXPEHURIHLJHQYHFWRUV
'
L
V
S
O
D
F
H
P
H
Q
W
V
>P@
KRUL]RQWDOGLVS
YHUWLFDOGLVS
WLPH>V@
)LJ7KHGLVSODFHPHQWRIDVODEPLGGOHSRLQW
~ 65 ~
WK
,QWHUQDWLRQDO&RQIHUHQFHRQ1HZ7UHQGVLQ6WDWLFVDQG'\QDPLFVRI%XLOGLQJV
2FWREHU%UDWLVODYD
&$/&8/$7,2102'(/,1&$6(2)029,1*75$,1
'XULQJWKHWUDYHOOLQJGLIIHUHQWQXPEHURIWKHUDLOFDUVLVDERYHWKHEULGJH7KHUHIRUHWKHGHJUHHRIIUHHGRPRIWKH
V\VWHPDQGVL]HRIWKHPDWULFHVDQGYHFWRUVLVFKDQJLQJLQWLPH7KHVWUXFWXUHRIWKHPDWULFHVDQGYHFWRUVFDQEH
VHHQLQ)LJ
0%
.% X% 0 W . W & W U W .Y &Y 0Y XY )LJ7KHVWUXFWXUHVRIWKHPDWULFHVDQGYHFWRUVRIWKHYHKLFOHEULGJHV\VWHP
:H FDQVHHWKDWWKH 0 % . % PDWULFHV RIWKHVWUXFWXUHLVQRWFKDQJLQJ7KHQXPEHURIPDWUL[EORFNV RIWKH
YHKLFOHV\VWHPVLVFKDQJLQJEXWWKHPDWULFHVRIWKHVWDQGLQJUDLOFDU 0 Y & Y . Y ZLOOEHVDPH,QWKHHTXDWLRQ
V\VWHPDUHWKHWLPHGHSHQGHQW 0 W &W . W FRQWDFWPDWULFHV'XULQJWKHDQDO\VLVZHKDYHWRJHQHUDWH
RQO\FRQWDFWPDWULFHVHYHU\WLPHVWHS7KHPDWUL[GLIIHUHQWLDOHTXDWLRQRIWKHYHKLFOHEULGJHV\VWHPDIWHUWKDW
0 & 0 W W X && & W W X . & . W W X UW W ZKHUH 0 & & & DQG. & DUHWKHFRQVWDQWPDWULFHV 0 W W & W W DQG. W W DUHWKHWLPHGHSHQGHQWPDWULFHV/HW
XVUHZULWHWKHUHODWLRQVKLSLQWKHIROORZLQJIRUP
. & X U& UW W & &X 0 W W X
& W W X . W W X 0 &X
7KH PDWULFHV RQ WKH ULJKWKDQG VLGH DUH K\SHUGLDJRQDOV $FFRUGLQJO\ DOVR WKH . & Y Z 0 & Y HLJHQYDOXH
SUREOHPVSOLWVLQWZRSDUWV,IZHJHQHUDWHVRPHVPDOOHVWHLJHQYHFWRUVRUWKRQRUPDOIRUPDVVPDWUL[ERWKIRUWKH
VWUXFWXUHDQGWKHYHKLFOHDQGFROOHFWWKHHLJHQYHFWRUVLQDK\SHUGLDJRQDOPDWUL[9WKHVL]HRILWGHSHQGVIURP
WKHUDLOFDUQXPEHUDERYHWKHEULGJHZHFDQXVHWKHWHFKQLTXHRITXDVLPRGDODQDO\VLVLQWKLVFDVHWRR>@
8< > P@
Y PV
Y PV
3 OD FHRIWKHILUVWZKHHO>P@
)LJ9HUWLFDOGLVSODFHPHQWRIWKHTXDUWHUSRLQWRIWKHEULGJH
5()(5(1&(6
>@ *\|UJ\L-6]HUNH]HWHN'LQDPLNiMD%XGDSHVW0ĦHJ\HWHPL.LDGy
>@ *\|UJ\L-=VLGL=(|WW|YpQ\L7$QDO\VLV RI 5HDNWRU%RG\ IRU'URSSLQJRI)XHO)ODVNWK,QWHUQDO
&RQIHUHQFHRQ6WUXFWXUDO0HFKDQLFVLQ5HDFWRU7HFKQRORJ\%HLMLQJSS
>@ *\|UJ\L -6]DEy * '\QDPLF WUDLQEULGJH LQWHUDFWLRQ DW DUF EULGJH LQ WKH FDVH RI D GLIIHUHQW PRGHO
6ORYDN-RXUQDORI&LYLOHQJLQHHULQJ;,9
~ 66 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
OPTIMALIZÁCIA BETÓNOVEJ DOSKY MOSTA POUŽITÍM
PRVKU SOLID65
M. Hoľko 1 a J. Dický2
Abstract
This paper deals with an optimization of reinforcement deck in ANSYS program using SOLID65. The results of
optimal design we achieved are presented at the end of this paper.
Kľúčové slová
optimalizácia; betónová doska; návrhové parametre; cieľová funkcia
1
ÚVOD
Optimalizácia je proces získania najlepšieho výsledku pri splnení určitých kritérií. Každý optimalizačný problém
má tri základné zložky:
- optimalizačné premenné tiež nazývané návrhové premenné,
- cieľovú funkciu,
- obmedzenia.
Neexistuje jedna jediná efektívna metóda potrebná na riešenie všetkých optimalizačných problémov,
preto bolo vyvinutých niekoľko optimalizačných metód a postupov na riešenie optimalizačných úloh rôznych
typov. V tejto práci sme použili optimalizačnú metódu prvého rádu (first order optimization) s využitím
výpočtového programu ANSYS.
2
VÝPOČTOVÝ MODEL
2.1 Geometria
Riešená betónová doska mala rozmery 10x7,5m (obr. 1). Každé dva metre po dĺžke a každého 1,5m po šírke bola
definovaná iná hrúbka so začiatočnou hodnotou h = 0,5m (celkovo bolo zadaných 36 premenných). Riešená
konštrukcia bola modelovaná kombináciou prvkov SOLID65 a SOLID45 (obr. 2). V oboch prípadoch ide
o priestorové osemuzlové prvky, ktoré obsahujú v každom uzle tri zložky vektora premiestnenia (posuny v
smeroch osi X,Y a Z). Prvok SOLID65 je špecifický prvok na železobetónové konštrukcie, keďže je možné
v rámci prvku zadať výstuž, ktorá je rozmazaná v danom prvku.
1
Ing. M. Hoľko, Department of Structural Mechanics, Faculty of Civil Engineering, Slovak University of
Technology, Radlinského 11, 813 68 Bratislava, Slovakia, e-mail: [email protected]
2
Doc. J. Dický PhD., Department of Structural Mechanics, Faculty of Civil Engineering, Slovak University of
Technology, Radlinského 11, 813 68 Bratislava, Slovakia, e-mail: [email protected]
~ 67 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
POZDĹŽNY REZ
C30/37
PRIEČNY REZ
Obr. 1. Pozdĺžny a priečny rez riešenou zidealizovanou konštrukciou
Obr. 2. Geometria prvku SOLID65 (vľavo) a prvku SOLID45(vpravo)
2.2 Fyzikálne vlastnosti
Predpokladáme, že riešená doska je vytvorená z betónu hustoty 2400 kgm-3. Materiál riešeného modelu je
riadený nelineárnou funkciou (obr. 3). Začiatočný modul pružnosti bol zadaný hodnotou 35GPa a hodnota
Poissonovho čísla 0,3. Betón je vystužený oceľou s modulom pružnosti 210GPa a hodnotou Poissonovho čísla
výstuže 0,2 a hustotou 7850 kgm-3.
Obr. 3. Pracovný diagram σ-ε
2.3 Okrajové podmienky a zaťaženie
Na výpočtový model boli aplikované nasledujúce okrajové podmienky:
1)
na spodnej hrane dosky (X = 0m) sú predpokladané líniové okrajové podmienky (posuny v smeroch osí
X, Z a Y vo všetkých bodoch línie sú rovné nule),
2)
na spodnej hrane dosky (X = 10m) líniová okrajová podmienka (posun v smere osi Z je rovný nule).
Na obr. 4 je znázornené zaťaženie, zložené z vlastnej tiaže betónovej dosky (gravitačné zrýchlenie bolo
uvažované s hodnotou 9,8 ms-2) a stáleho spojitého zaťaženia s hodnotou 10,5 kNm-2 (vozovka 2,4 kNm-2
a spojité premenné zaťaženie 8,1 kNm-2), aplikované vo všetkých horných uzloch na hornom povrchu dosky.
~ 68 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Obr. 4. Okrajové podmienky a aplikované zaťaženia na výpočtovom modeli
Obr. 5 graficky znázorňuje veľkosť predbežne navrhovanej výstuže pri hornom aj spodnom povrchu v priečnom
aj pozdĺžnom smere, ktorú sme pomocou prvku SOLID65 aplikovali na výpočtový model. Obr. 6 znázorňuje
model dosky s vyznačenými líniami vo všetkých smeroch v pozdĺžnom smere a v izometrii s aplikovanou
výstužou. Pri výpočte bolo zvolené delenie každej línie na 3 časti.
POZDĹŽNY REZ
Obr. 5. Výstuž v pozdĺžnom a priečnom smere
Obr. 6. Model dosky s výstužou
3
OPTIMALIZÁCIA
Maximálny zvislý posun ( priehyb) dosky pred optimalizačným procesom bol 0,001579 m a maximálne von
Missesovo napätie na povrchu dosky pred optimalizačným procesom dosiahlo hodnotu 6891 kPa. Ako
optimalizačný proces bola zvolená optimalizácia prvého rádu (first order optimization) s maximálnym počtom
10 iterácií. Obmedzenia boli dané hodnotou maximálneho priehybu (0,05m) a hodnotou maximálneho
dosiahnutého napätia (30 000kPa). Cieľovou funkciou bol minimálny objem dosky V. Parametrami
optimalizácie boli hrúbky dosky vo zvolených úsekoch optimalizované v rozmedzí 0,1- 0,7 m. Optimalizačný
proces našiel optimálne prípustné riešenie v piatom iteračnom kroku.
~ 69 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
4
October 2013, Bratislava
ZÁVER
Na obr. 7 je znázornená topológia riešenej dosky po optimalizačnom procese s objemom V = 19,583m3. Na
doske po optimalizácii vznikne maximálne von Missesovo napätie s = 28894 kPa a maximálny priehyb wmax =
0,00764m. Na obr. 8 sú uvedené zmeny hrúbky dosky v pozdĺžnom a priečnom smere v priebehu
optimalizačného procesu.
Podrobnejšie výsledky spolu s obrázkami napätí pred a po optimalizačným procesom sú zahrnuté
v rozsiahlejšej verzii na USB nosiči.
Obr. 7. Optimalizovaný tvar betónovej dosky
Zmena
hrúbky
0,5
dosky po
Zmena hrúbky dosky po šírke (x = 10m)
1 set V = 37,5m3
2 set V = 20.454m3
3 set V = 19.911m3
4 set V = 19.851m3
5 set V = 19.583 m3
0,45
hrúbka dosky (m)
hrúbka dosky (m)
0,5
0,4
0,35
Zmena hrúbky dosky po šírke (x = 0m)
1 set V = 37,5m3
0,45
2 set V = 20.454m3
3 set V = 19.911m3
4 set V = 19.851m3
0,4
5 set V = 19.583 m3
0,35
0,3
0,3
0
1,5
3
4,5
šírka dosky (m)
6
7,5
0
1,5
3
4,5
šírka dosky (m)
6
7,5
hrúbka dosky (m)
Zmena hrúbky dosky po dĺžke (y = 3,75m)
1 set V = 37,5m3
2 set V = 20.454m3
3 set V = 19.911m3
4 set V = 19.851m3
5 set V = 19.583 m3
0,45
0,35
0,25
0,15
0
2
4
6
dĺžka dosky (m)
8
10
Obr. 8. Zmena hrúbky dosky v pozdĺžnom smere (vľavo) a v priečnom smere (vpravo)
POĎAKOVANIE
Vyjadrujeme vďaku grantovej agentúre VEGA za podporu projektu 1/1186/12 - Optimálny návrh konštrukcií
z hľadiska porúch stavieb a stavebných konštrukcií s dôrazom na aspekty spoľahlivosti a životnosti konštrukcii,
v rámci ktorého vznikla aj táto práca.
LITERATÚRA
[1]
[2]
[3]
ARORA, J. Optimization of Structural and Mechanical Systems, World Scientific Pub. Co. Inc, 2007,
595 s. ISBN 9812569626
CHRISTENSEN, P. - KLARBING, A. An Introduction to Structural Optimization, Springer, 2009, s.
214, ISBN 978-1-4020-8666-3
ANSYS Release 11 Documentation Preview
~ 70 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
EFEKTIVITA POSTUP" METODY DYNAMICKÉ RELAXACE
P#I ANALÝZE LANOVÝCH SOUSTAV
M. Hüttner1, J. Máca2, P. Fajman3
Abstract
The aim of this paper is to compare and evaluate the effectiveness of the procedures applied in the analysis of
cable structures using the dynamic relaxation. There will be compared using the method of the viscous damping
and kinetic damping. Furthermore, the influence of the distribution of fictitious mass to each node in proportion
to its current structure stiffness will be monitored and the effect of the conversion of mass when calculating the
convergence of the solution will be monitored. Efficiency and stability of different methods will be compared to
the nine reference examples. The cable is approximated as a tension bar, a catenary and a parabolic cable
element.
Klíová slova
dynamická relaxace; nelineární analýza; lanové konstrukce; kinetický útlum; viskózní útlum
1
ÚVOD
Pro numerickou analýzu lanových konstrukcí se nejastji používá idealizace konstrukce na soustavu lan (prvk%)
vzájemn spojených v uzlech (stynících). Každý uzel m%že mít v prostoru až ti stupn volnosti. Podpory
pedstavují zpravidla klouby a odebírají ti stupn volnosti. Pi uvažování malých deformací a velkých posun%
styník%, pedstavuje ešení lanových konstrukcí geometricky nelineární úlohu. K ešení tchto úloh lze použít
r%zných matematických postup%, tato práce se však bude zabývat pouze metodou dynamické relaxace (MDR).
2
APROXIMACE LANA
Lano bude aproximováno jako prutový prvek penášející pouze tah, etzovka (5 tažených prut% vzájemn
propojených klouby) a jako dokonale ohebný prvek (lanový prvek).
3
DYNAMICKÁ RELAXACE
3.1 Princip
MDR slouží ke zjištní statického rovnovážného stavu skutené konstrukce na základ umlé dynamické
analýzy s fiktivními veliinami (hmotnost, útlum, asový krok). Metoda patí mezi tzv. explicitní metody, které
1
Ing. M. Hüttner, &VUT v Praze, Fakulta stavební, katedra mechaniky; Thákurova 7, 166 29 Praha 6 – Dejvice,
&eská republika; +420 224 354 498; [email protected]
2
Prof. Ing. J. Máca, CSc., &VUT v Praze, Fakulta stavební, katedra mechaniky; Thákurova 7, 166 29 Praha 6 –
Dejvice, &eská republika; +420 224 354 477; [email protected]
3
Doc. Ing. P. Fajman, CSc., &VUT v Praze, Fakulta stavební, katedra mechaniky; Thákurova 7, 166 29 Praha 6
– Dejvice, &eská republika; +420 224 354 477; [email protected]
~ 71 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
pracují pouze s residuálními silami v jednotlivých stynících a tak není poteba sestavovat globální matici
tuhosti. Nevýhodou je však podmínná stabilita výpoetního postupu. Metodu poprvé pospal v roce 1965 A.S.
Day [1]. Tato metoda se bhem padesáti let bádání vyvinula do dvou základních technik – s viskózním útlumem
a s kinetickým útlumem. Viskózní útlum pracuje s p%vodní formulací a snaží nastavit fiktivní parametry tak, aby
došlo ke kritickému tlumení a tudíž i k rychlé konvergenci ešení. Technika kinetického útlumu naopak zavádí
nulový útlum a podle pr%bhu celkové kinetické energie systému v ase se snaží najít vrchol kinetické energie.
V jeho míst pak výpoet vlastn restartuje (vynuluje rychlosti všech stynících) a z této polohy pak zaíná nový
výpoet až do okamžiku než dojde k disipaci kinetické energie a tedy k nalezení rovnovážného stavu. V této
práci bude použito dohromady devt r%zných postup% využívajících ob základní techniky.
3.2 Postupy
Postupy A, A* a B sledují princip viskózního útlum. Postup A zavádí fiktivní veliiny M a C stejné pro všechny
styníky konstrukce, tyto parametry jsou ureny na základ kritického útlumu konstrukce [2]. Postup A* také
zavádí fiktivní veliiny M a C stejné pro všechny styníky konstrukce, tyto parametry jsou však na základ
opakovaných pokus% optimalizovány na co nejmenší poet iterací. Postup B vychází z postupu A, ale poítá
parametry Mi a Ci pro každý uzel i zvláš. Postupy C – E sledují princip kinetického útlumu s vrcholem
uprosted asové kroku [3]. V postupu C je M volena stejná pro celou konstrukci. V postupu D je Mi volena
r%zn pro každý styník i. V postupu E je také Mi volena r%zn pro každý styník i a navíc dochází k pepotu
hmotností po každém restartu kinetické energie. Postupy F – H jsou pak podobné jako postupy C – E s tím
rozdílem, že k urení vrcholu kinetické energie používají parabolickou aproximaci [4].
4
P#ÍKLADY
V práci jsou použité postupy testovány na celkem pti referenních píkladech, seazených podle složitosti od
nejjednoduššího k nejsložitjšímu. Kritériem pro ukonení výpotu byl pokles residuálních sil na 0.1%
(respektive 1% v pípad lanových element%) jejich p%vodní hodnoty. &asový krok 't = 1s.
5
ZÁV$R
Výsledky poítaových simulací jsou pehledn seazeny v Tab. 1. Z ní vyplývá, že nejefektivnjším postupem
pro konstrukce s malou nelinearitou je postup F. Dále lze konstatovat, že postupy s kinetickým útlumem jsou
stabilnjší než postupy s viskózním útlumem. Zp%sob aproximace vrcholu kinetické energie je nepodstatný.
Postup
prut
5 prut%
lano
Celkem
A
476(0)
2820(0)
310(1)
3606(1)
A*
B
C
405(0) 15847(0) 454(0)
2747(0) 110008(2) 2929(0)
255(1) 10735(0) 443(0)
3407(1) 136590(2) 3826(0)
D
453(0)
1598(1)
460(0)
2511(1)
E
758(0)
6129(0)
534(0)
7421(0)
F
427(0)
2788(0)
483(0)
3698(0)
G
420(0)
910(2)
611(0)
1941(2)
H
780(0)
6125(0)
496(0)
7401(0)
Tab. 1. Celkový poet iterací ze všech 5 píklad%. V závorce poet nekonvergujících píklad%.
POD$KOVÁNÍ
Tento lánek vznikl za podpory státních prostedk% Grantové agentury &eské republiky . P105/11/1529 a
Studentské grantové soutže &VUT . SGS13/034/OHK1/1T/11.
LITERATURA
[1] Day, A. S. An introduction to dynamic relaxation. In: Engineer, 219, (1965), pp 218-221, ISSN 0013-8029
[2] Barnes, M. R. Form and stress engineering of tension structures. In: Structural Engineering Review, 6 (3-4),
1994, pp 175-202, ISSN 0952-5807
[3] Topping, B.H.V. – Iványi, P. Computer Aided Design of Cable Membrane Structures. Kippen, Saxe-Coburg
Publications, 2008, 233 s. ISBN 978-1-874672-11-1
[4] Lewis, W. J. Tension structures: from and behaviour. London, Thomas Telford, 2003. 201 s. ISBN 0-72773236-6.
~ 72 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
9/$671e)5(.9(1&,(2&(ď29é&+1È'5äË
1RUEHUW-HQGåHORYVNê1 a ďXERPtU%DOiå 2
Abstract
In this paper the comparison of calculation methods with real experiment and evaluation of results is presented.
Frequencies of cylindrical tank were investigated three id different ways: FEM analyses, real experiment and
normative calculated.
.Đ~þRYpVORYi
e[SHULPHQWDQDOê]DYDOFRYiQiGUåPHWyGDNRQHþQêFKSUYNRY
1
Ò92'
V WRPWR SUtVSHYNX VD YHQXMHPH PRGHORYDQLX QiSOQH YDOFRYHM QiGUåH SRPRFRX PHWyG\ NRQHþQêFK SUYNRY
v NRPHUþQRP SURJUDPH $16<6 1iVOHGQH VPH SRURYQDOL YêVOHGN\ QXPHULFNpKR PRGHORYDQLD RFHĐRYHM
YDOFRYHMQiGUåHY\WYRUHQpKRSRPRFRX0.3DYêVOHGN\ H[SHULPHQWiOQHKRYêVNXPXNWRUêVPHXURELOLQDQDãRP
pracovisku. V SRVOHGQRP NURNX VPH SRURYQDOL ]tVNDQp YêVOHGN\ V normoYêP YêSRþWRP SRPRFRX NWRUpKR
PRåQRY\SRþtWDĢYODVWQpIUHNYHQFLHWDNHMWRNRQãWUXNFLH
2
125029e35('3,6Y
2.1 (XURNyG
3RK\E NYDSDOQHM QiSOQH Y WXKRP YDOFL PRåQR Y\MDGULĢ DNR V~þHW GYRFK RGGHOHQêFK SUtVSHYNRY ± ÄWXKpKR
impulzu³DÄkonvekcie³7XKiLPSXO]RYi ]ORåNDVSĎĖDSUHVQHRNUDMRYpSRGPLHQN\SULVWHQiFKDQDGQH QiGUåH
DOH VS{VREXMH QHNRUHNWQH Y]KĐDGRP N S{VREHQLX YĎQ Y G\QDPLFNHM RGR]YH QXORYê WODN QD ~URYQL YRĐQpKR
povrchu kvaSDOLQ\ SUL VWDWLFNHM VLWXiFLL .RQYHNWtYQD ]ORåND QHPHQt RNUDMRYp SRGPLHQN\ DOH zDEH]SHþXMH
VSOQHQLHNRUHNWQHMSRGPLHQN\URYQRYiK\QDYRĐQRPSRYUFKX
6~VWDYD QiGUå - NYDSDOLQD VD PRGHOXMH SRPRFRX GYRFK V\VWpPRY V MHGQêP VWXSĖRP YRĐQRVWL -HGHQ V\VWpP
]RGSRYHGiLPSXO]RYHM]ORåNHDSRK\EXMHVDVSROXVSRGGDMQRXVWHQRX'UXKêV\VWpP]RGSRYHGi NRQYHNWtYQHM
]ORåNH,PSXO]RYiDNRQYHNWtYQDRGR]YDVDNRPELQXM~QXPHULFNêPVSRþtWDQtP 9ODVWQpSHULyG\LPSXO]RYHMD
NRQYHNWtYQHMRGR]Y\YVHNXQGiFKVDXYDåXM~WDNWR
TIMP
Ci ˜
U
s
R
˜
1
H
E
3URI,QJ1RUEHUW-HQGåHORYVNê3K'6WDYHEQiIDNXOWD678%UDWLVODYD
e-mail.: [email protected]
2
,QJďXERPtU%DOiå6WDYHEQiIDNXOWD678%UDWLVODYDH-mail.: [email protected]
~ 73 ~
(1)
11th International Conference on New Trends in Statics and Dynamics of Buildings
TCON
October 2013, Bratislava
Cc ˜ R
(2)
Ci , Cc = V~þLQLWHOHSUHYêSRþHWLPSXO]QHMDNRQYHNWtYQHM]ORåN\QiMGHPHY>@
ȡ = REMHPRYiKPRWQRVĢNYDSDOLQ\
s = HNYLYDOHQWQi NRQãWDQWQi KU~END VWHQ\ YiåHQê SULHPHU QD RPRþHQHM YêãNH VWHQ\ QiGUåH YiKX
PRåQRXYDåRYDĢ~PHUQ~SRPHUQêPGHIRUPiFLiPYVWHQHQiGUåHNWRUpV~PD[LPiOQHSUL GQHQiGUåH
R = SRORPHUQiGUåH
H = YêãNDSRYRĐQêSRYUFKNYDSDOLQ\
E = PRGXOSUXåQRVWLPDWHULiOu niGUåH
V QDãRPSUtSDGHVPHVOHGRYDOLOHQLPSXO]Q~]ORãNXNWRU~VPHPRKOLRYHULĢH[SHULPHQWiOQH
kde:
3RGRVDGHQtYVWXSQêFKKRGQ{WGRY]ĢDKX (1) dostaneme hodnotu Timp = 0,02151 ĺ f = 46,48 Hz
2.2 Uniform building code
3RPRFRXY]ĢDKX] DPHULFNHMQRUP\MHPRåQp ]tVNDĢYODVWQ~SHULyGXYDOFRYêFKQiGUåt1tPVPHSRURYQiYDOL
GRVLDKQXWpKRGQRW\IUHNYHQFLt] QXPHULFNpKRYêSRþWXD z experimentu.
3
T
kde:
Ct .hn 4
(3)
T SHULyGDNPLWDQLDYVHNXQGiFK
hn YêãNDNRQãWUXNFLHYPHWURFK
Ct V~þLQLWHĐNRQãWUXNFLH&t = 0,02 - 0,0448)
3
T
3
4
Ct .hn 4 | 0,0448 ˜ 0,85 | 0,0432 Ÿ VYHOVUJE ˜ PREDPOKLADU
9êSRþHWYODVWQHMIUHNYHQFLH
f
1
(Hz)
T
(4)
3RGĐDY]ĢDKX3YLHPHSUHSRþtWDĢSHULyGX7NPLWDQLDQDYODVWQ~IUHNYHQFLX
3
180(5,&.é02'(/
9DOFRYiãNUXSLQDRFHĐRYiQiGUåQDYRGXERODPRGHORYDQiV\VWpPRP$16<6DY]KĐDGRPNH[SHULPHQWiOQHM
Y]RUNHEROY\WYRUHQêPRGHONWRUêQH]RKĐDGĖXMHSUHOLV\QDSOiãWLYDOFD
Parametre modelu aj H[SHULPHQWiOQHMY]RUN\ RFHĐRYêVXG
9êãND
87 cm
Priemer:
56 cm
+U~ENDVWHQ\D dna:
1,1 mm
0DWHULiO
RFHĐ( *3D
1iSOĖ
voda (gama=10 kN/m3)
3UHGVWDYHQiY]RUNDERODVN~ãDQiY troch krokoch:
4
1. 3Ui]GQ\VXG
2. 6XGQDSOQHQêGRSRORYLFHVYRMHMYêãN\
3. 3OQêVXG
32ýË7$ý29e02'(/29$1,(
9 SURJUDPH $16<6 VPH Y\WYRULOL NRQHþQRSUYNRYê PRGHO YDOFRYHM QiGUåH (SOHFKRYpKR VXGD) SRGĐD
SUHGGHILQRYDQêFKSDUDPHWURYUHiOQHMY]RUN\NWRU~VPHPDOLPRåQRVĢVN~ãDĢ3ULHVWRURYêPRGHOVPHY\WYRULOL
ako 3D teleso roYQDNêFK UR]PHURY DNR MH VNXWRþQê SOHFKRYê EDUHO 1D PRGHORYDQLH VWHQ\ D GQD YDOFRYHM
ãNUXSLQ\ VPH SRXåLOL ãNUXSLQRYê SUYRN 6+(// 2EMHP NYDSDOLQRYHM REODVWL MH Y\WYRUHQê RVHPX]ORYêP
NRQHþQêP SUvkom FLUID30 v PRGHORYHM UDGH ³$³ D ³%³ D NRQHþQêP SUYNRP )/8,' SUH PRGHORY~ UDGX
³&³
~ 74 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
4.1
October 2013, Bratislava
.RQHþQRSUYNRYpPodely
(1)
(2)
(3)
Obr. 1. Tri modely SUHYêSRþHWYODVWQHMIUHNYHQFLHY\WYRUHQpY programe ANSYS
5
(;3(5,0(17È/1(29(5(1,(9é6/('.29$1$/é=<
3ULPHUDQtVPHSRXåLOLSUHQRVQ~PHUDFLXDSDUDW~UXREU 2 Då57iWRPHUDFLDDSDUDW~UDSR]RVWiYD] KDUGYpUX
a ]RVRIWYpURYpKR Y\KRGQRFRYDFLHKR]DULDGHQLD1D PHUDQLH]PLHQ]UêFKOHQt Y\XåLWtP ]RWUYDþQêFK YODVWQRVWt
NRQãWUXNFLHVPHSRXåLOLSlĢSLH]RHOHNWULFNêFKDNFHOHURPHWURYRGVSRORþQRVWL%UHO.MDHU3ULPHUDQLDFKVPH
SRXåLOL -NDQiORYê $' SUHYRGQtN 9ãHWN\ DNFHOHURPHWHUH PDOL QDVWDYHQ~ URYQDN~ Y]RUNRYDFLX IUHNYHQFLX 10 Y]RULHN]DVHNXQGXSULþRPGĎåNDPHUDQpKRþDVRYpKR]i]QDPXEoODVHN~QG
Obr. 2. 3ULSUDYHQêPRGHO
Obr. 3. Detail akcelerometra
~ 75 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
1D Y\KRGQRWHQLH YêVOHGNRY VPH SRXåLOL OLFHQFRYDQê SURJUDP /DE9,(: 7HQWR SURJUDP IXQJXMH QD SULQFtSH
Y\WYRUHQLD YLUWXiOQHKR ]DULDGHQLD SRPRFRX YODVtQpKR SURJUDPX V SRåDGRYDQêPL YODVWQRVĢDPL D nastaveniami,
NWRUêPVPHVFKRSQtY\KRGQoWLĢ~GDMH] H[SHULPHQWiOQ\FKPHUDQt.
Merania EROLUREHQpQDWURFKPRGHORFK0Då0 SRGĐD PQRåVWYD Yody. V NDåGRPPRGHOLERORXUREHQêFK
PHUDQt. 7LHWREROLSRVWXSQHVSUDFRYDQpD YêVOHGN\] QLFKV~XYHGHQpY WDEXĐNH
6
=+2'127(1,(9é6/('.29
= SUHGPHWQHM DQDOê]\ Y\SOêYD åH VS{VRE PRGHORYDQLD UHVS t\S NRQHþQêFK SUYNRY Pi YSO\Y QD YêVOHGN\
QXPHULFNHM DQDOê]\ 7DNLVWR GUXK QRUPRYpKR YêSRþWX QiP GDO UR]GLHOQH YêVOHGN\ NWRUp EXG~ SUHGPHWRP
ćDOãLHKRYHGHFNpKRVN~PDQLD 1RUPRYpY]ĢDK\SRGĐD(XURNyGXVDGDM~SRXåLĢOHQSUHYDOFRY~QiGUåQDSOQHQ~
kvapalinou po okraj. V WRPWRSUtSDGHY\FKiG]DM~SRXåLWHĐQpYêVOHGN\V QXPHULFNêPSRþtWDþRYêPPRGHORPDM
H[SHULPHQWRP 3UH QiGUåH QDSOQHQp OHQ þLDVWRþQH QHPRåQR Y]ĢDK\ ] (XURNyGX SRXåLĢ Y WDNRPWR SUtSDGH VD
KRGLDY]ĢDK\]Uniform building codeNWRUp]RKĐDGĖXM~DM þLDVWRþQpQDSOQHQLHQiGUåH
V WDEXĐNH XYiG]DPHSRURYQDQLHKRGQ{WSUYêFK YODVWQêFK IUHNYHQFLt UHVSSHULyGNPLWDQLDVN~PDQpKR PRGHOX
YDOFRYHMãNUXSLQ\
9/$671È)5(.9(1&,$(Hz)
³02'(/³
³02'(/³
³02'(/³
³7<3$³
20,99
35,64
41,48
³7<3%³
-
291,18
291,18
³7<3&³
-
60,42
37,14
³(852.Ï' ³
-
-
46,48
³8%& ³
23,14
32,89
56,49
³(;3(5,0(17³
21,80
30,80
40,40
Tab.1. 3RURYQDQLHYêVOHGNRYQXPHULFNêFKDH[SHULPHQWiOQ\FKPRGHORY
32Ć$.29$1,(
- 7HQWRSUtVSHYRNY]QLNRO]DILQDQþQHMSRGSRU\JUDQWRYHMDJHQW~U\0â65DNRSURMHNW9(*$
- 3UHSRMHQLHYHGHFNpKRYêVNXPXD VWDYHEQHMSUD[HXPRåQLODVSRORþQRVĢ%LRSO\Q%XGþDVSROVUR
(OHNWUiUHQVNi 1 Bratislava 831 04.
ZRGSRYHGQê: ,QJ9LOLDP%HQGHOâtSRYi$%UDWLVODYD, t.þ3900654, e-mail : [email protected]
/,7(5$7Ò5$
[1]
(XURNyGþDVĢ 1DYUKRYDQLHNRQãWUXNFLtQDVHL]PLFN~RGROQRVĢ6871
[2]
62.2/ 0 795'È . '\QDPLNa VWDYHEQêFK NRQãWUXNFLt %UDWLVODYD 9\GDYDWHĐVWYR 678 VWUiQ,6%1-80-227-3587-2
[3]
Uniform building code ± 1630.2.2 Structure period, 1997
~ 76 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
ANALÝZA VÝŠKOVEJ BUDOVY OD HORIZONTÁLNYCH SÍL
Norbert Jendželovský1 a So(a Medvecká2
Abstract
The paper describes the impact of horizontal forces on high-rise office building, which has an irregular floor
plan. We analyzed the effect of wind flow in the construction in five directions and impact of the seismic load on
the construction. Based on the individual loads we considered deformations caused due to horizontal load
according to the limit state of serviceability. Then we calculated the necessary reinforcement for selected
elements of the limit state of the carrying capacity. The result is a comparison of different directions and
specifying the worst one.
1
ÚVOD
Vplyv horizontálnych síl na výškovú budovu je reprezentovaný silovými úinkami od vetra a seizmického
zaaženia. Vietor je pohyb vzduchu, ku ktorému dochádza v dôsledku premiestnenia vzduchových más vo vnútri
zemskej atmosféry. Tlak vetra pôsobiaci kolmo na plochy vytvára sily, ktoré sú kolmé na povrch konštrukcie
alebo jej fasádneho pláša. Výpoet zaaženia vetrom je spracovaný poda STN EN 1991-1-4. Pôvodom
seizmických úinkov na stavebné konštrukcie je kmitanie podložia, ktoré spôsobí aj rozkmitanie základových
konštrukcií objektu. Kmitanie vznikne pri uvonení vekého množstva energie pri náhlom posune dvoch
zemských krýh zemskej kôry na tektonickom zlome. Seizmický výpoet je možné urobi viacerými metódami:
kvázistatickou metódou, metódou spektier odozvy, priamou integráciou v ase. Výpoet zaaženia seizmicitou je
riešený poda STN EN 1998-1.
2
MODEL VÝŠKOVEJ KONŠTRUKCIE
V lánku prezentovaný výškový objekt je modelovaný a riešený pomocou programu Scia
Engineer ako 3D model. Výška objektu je 87,5m a šírka 34,5m. Zvislé konštrukcie sú
tvorené železobetónovými stpmi, stenami a stužujúcim jadrom. Stpy sú navrhnuté
z betónu C 40/50. Železobetónové jadro je tvorené stenami hrúbky 250 až 400 mm
z betónu C 35/45 . Osová vzdialenos stpov v smere “x“ a “y“ je 8,1m. Súasou
zvislých konštrukcií je aj suterénna stena, ktorá je realizovaná z vodotesného betónu.
Stropné konštrukcie sú tvorené obojsmerne vystuženými železobetónovými
bezprievlakovými doskami. Zhotovené sú z triedy betónu C30/37. Ich hrúbka sa mení
v jednotlivých podlažiach. Stropné dosky sú uložené prostredníctvom zdola viditených
betónových hlavíc. Týmto spôsobom vytvoríme strop s vyššou šmykovou odolnosou
okolo stpa, ím nám doska vyhovuje na pretlaenie. Doska je zhrubnutá v týchto
miestach o 100 mm. Stropné nosné konštrukcie podzemných podlaží sú po obvode
uložené na podzemné steny.
Základová doska má hrúbku 2000 mm. Pod stpmi a stužujúcimi jadrami sú
vekopriemerové v)tané pilóty s priemerom 1180 mm. Pod stpmi sú pilóty zdvojené
a pod najviac namáhanými stpmi aj strojené. Pod stužujúcimi jadrami sú rozmiestnené
pilóty v rastri cca vo vrcholoch rovnostranných trojuholníkov so stranou 1800mm.
Obr.2. 1 Axonometria
1
Prof. Ing. Norbert Jendželovský, PhD., Katedra stavebnej mechaniky, Stavebná fakulta, STU Bratislava,
Radlinského 11, 813 68 Bratislava, tel.: 02/59274364
2
Ing. So(a Medvecká, Katedra stavebnej mechaniky, Stavebná fakulta, STU Bratislava, Radlinského 11,
813 68 Bratislava
~ 77 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
3
October 2013, Bratislava
ZAAŽENIE VETROM
Zaaženie vetrom je charakteristické vodorovným smerom. Preto sme sa zaoberali analýzou súinitea
vonkajšieho tlaku cpe vzhadom na rôzny smer vetra na budovu. V norme je uvedený postup pre výpoet
súinitea vonkajšieho tlaku cpe pre budovy pravouhlého a valcového pôdorysu. Riešený objekt má ale
nepravidelný tvar, ktorý nezodpovedá pôdorysne ani jednej variante vyskytujúcej sa v norme. Je kombináciou
obidvoch typov. Presnejšie z dvoch strán je to kváder a z dvoch štvrvalec.
3.1. Urenie súinitea vonkajšieho tlaku cpe
Na obr. 3.1 – 3.5 je znázornený výpoet rozloženia tlaku na konštrukciu poda smeru pôsobenia vetra.
Obr.3. 1 Uvažované hodnoty cpe pre smer 1
Obr.3. 2 Uvažované hodnoty cpe pre smer 2
Obr.3. 3 Uvažované hodnoty cpe pre smer 3
Obr.3. 4 Uvažované hodnoty cpe pre smer 4
~ 78 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Obr.3. 5 Uvažované hodnoty cpe pre smer 5 a výstup z programu Ansys (vpravo).
4
SEIZMICKÉ ZAAŽENIE A VLASTNÉ TVARY
Pri výpote sme použili metódu spektier odozvy, ktorá je v súasnosti najpoužívanejšia. Uvažujeme
s referenným špikovým zrýchlením poda mapy oblasti seizmického rizika na Slovensku hodnotou
agr=0,65m/s. Triedu dôležitosti uvažujeme I = 1,0. Frekvencia prvého vlastného tvaru je f1 = 0,38 Hz, druhého
vlastného tvaru f2 = 0,56 Hz a tretieho vlastného tvaru je f3 = 0,74 Hz.
Po skonení modálnej analýzy a zistení vlastných frekvencií sme použili metódu spektier odozvy. Spektrum sme
zvolili typ 1 ( pre oblasti vzdialené od tektonického zlomu), podložie sme zatriedili do kategórie typu B v zmysle
STN EN 1998. Výsledkom riešenia boli vnútorné sily v konštrukcii a jej deformácie.
V *alšej kapitole je uvedená analýza horizontálnych posunov.
5
ANALÝZA HORIZONTÁLNYCH DEFORMÁCIÍ NA BUDOVU
5.1 Vyhodnotenie vodorovných úinkov od vetra
Limitné hodnoty premiestnení pre budovy so stužujúcimi stenami a jadrom sú:
u max ≤ u lim
Δ j ≤ Δ j.lim
H
2000
vj
1500
Tab.5.1 Horizontálne premiestnenia vo vrchole od vetra
Posúdenie výchylky:
u max
43.6mm ≤ u lim
43.75mm
Tab.5.2 Vzájomný posun dvoch stropov od vetra
Posúdenie vzájomnej výchylky:
Δ j.max
2.1mm ≤ Δ j.lim
~ 79 ~
2.5mm
(1)
(2)
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
5.2 Vyhodnotenie vodorovných úinkov od seizmicity
Limitné hodnoty premiestnení pre budovy so stužujúcimi stenami a jadrom sú:
H
umax ≤ ulim
500
vj
Δ j ≤ Δ j.lim
100
Tab.5.1 Horizontálne premiestnenia vo vrchole od seizmicity
Posúdenie výchylky:
u max
66.3mm ≤ u lim
(3)
(4)
175mm
Tab.5.2 Vzájomný posun dvoch stropov od seizmicity
Δ j.max
Posúdenie vzájomnej výchylky:
6
Δ j.max
3.7mm ≤ Δ j.lim
3.7mm ≤ Δ j.lim
37.5mm
37.5mm
ZÁVER
Pri medznom stave používatenosti nám prevládali výchylky od seizmického zaaženia, ale súasne vyhovujúce
normovým požiadavkám. Pri vetre bol maximálny horizontálny posun v smere 1.
Pri medznom stave únosnosti na stpoch je najkritickejší smer vetra . 5. Tento smer prevládal v štyroch z piatich
vybraných stpových prvkoch pri analýze objektu.
Pri urovaní vplyvu iba od zaaženia vetra a seizmicity na prvky sa nedá jednoznane uri, ktorý vplyv je horší.
To preto, že jednotlivé prvky sú rôzne umiestnené a preto na nich jednotlivé zaažovacie stavy pôsobia rôzne.
V danej lokalite poda SHMÚ prevláda severozápadný smer vetra. Tento smer je približne totožný s nami
zvoleným smerom vetra 4. Pre tento smer vetra budova spoahlivo prenáša horizontálne zaaženie od vetra a ani
v jednom prípade nám nevyšli maximálne hodnoty od tohto smeru vetra.
Najmenšie úinky sme zaznamenali v smeroch 2 a 4, pretože celková tuhos konštrukcie je v daných smeroch
väšia.
POAKOVANIE
Tento príspevok vznikol za finannej podpory grantovej agentúry MŠ SR, ako projekt VEGA 01/0629/12.
LITERATÚRA
[1]
[2]
BIL&ÍK, J., FILLO, +., BENKO, V., HALVONÍK, J., Betónové konštrukcie – navrhovanie poda STN EN
1992-1-1, Bratislava: Retoning s.r.o., 2005
HARVAN, I. : Betónové konštrukcie. Vysoké budovy: Navrhovanie poda spoloných európských noriem.
Bratislava: STU v Bratislave, 2011
[3]
STN EN 1991: Zaaženie konštrukcií
[4]
STN EN 1998: Navrhovanie konštrukcií na seizmickú odolnos
~ 80 ~
Proceedings of the 11th International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
INFLUENCE OF SOIL TYPE ON THE STRESSES IN THE
BUILDING STRUCTURE IN FACE OF MINING EXPLOITATION
M. Kadela1 and L. Chomacki2
Abstract
Mining exploitation inherent disclosure influences on the surface. In order to verify that it is safe acquisition
inflows by the structure of the building was carried out numerical analysis calculation. Cooperation with the
ground mining structure depends on the type and the parameters of the soils.
In the present study was analyzed four different types of soil commonly found in Upper Silesia. For each soil
received different values of forces generated by the influence of mining on the foundations and walls embedded
in surface on the selected building. After the impact analysis of soil type obtained the different stresses in the
masonry structure of the building, which may indicate the possibility of damage in selected places.
Key Words
eksploatacja górnicza; naprężenia w konstrukcji budynku; spełzanie gruntu
1
WPROWADZENIE
Na Górnym Śląsku obiekty budowlane są poddawane nietypowym w skali kraju obciążeniom – pochodzącym
od wpływów górniczych. Obciążenia te niejednokrotnie mają duży wpływ na stan budynków i prowadzą do ich
uszkadzania [4,7].
Na tak zwanych terenach spokojnych sposoby oddziaływania gruntu na fundamenty i ściany w nim zagłębione
zostały ustalone i są niezmienne w okresie istnienia budynku. Na terenach górniczych ośrodek gruntowy się
uaktywnia, grunt zaczyna czynnie oddziaływać na budynek. W wyniku tego zostaje zmieniony w sposób
zasadniczy stan pierwotny naprężenia w gruncie. Oddziaływanie to jest zależne od wielu czynników m.in.
położenia eksploatowanej ściany pokładu, rodzaju i stanu gruntu.
Dlatego fundamenty budynków zlokalizowanych na terenach górniczych oprócz przekazywania obciążeń
pionowych na podłoże gruntowe, powinny być również przystosowane do bezpiecznego przejęcia skutków
oddziaływań górniczych występujących w poziomie posadowienia. Wartości sił, powstających od poziomych
odkształceń terenu, występujących w fundamentach posadowienia bezpośredniego zależą od:
— naprężeń stycznych w podstawie fundamentów τ,
— naprężeń stycznych na bocznych powierzchniach fundamentów, uwzględnianych dla części fundamentu,
które zostały wykonane bezpośrednio w gruncie rodzimym τh,
— naporu gruntu na boczne powierzchnie ław, usytuowanych prostopadle do kierunku odkształceń podłoża
w przypadku rusztu fundamentowego zpp (rys. 1).
1
Dr Eng. M. Kadela, Building Research Institute Silesian Branch, Department of Building Construction
Elements and Building Structures on Mining Areas, Poland, 40-152 Katowice, Al. Korfantego 191, phone: +48
32 730 29 47, email: [email protected]
2
M.Sc. L. Chomacki, Building Research Institute Silesian Branch, Department of Building Construction
Elements and Building Structures on Mining Areas, Poland, 40-152 Katowice, Al. Korfantego 191, phone: +48
32 730 29 70, email: l. [email protected]
~ 81 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Rys. 1. Obciążenie ław rusztu fundamentowego spowodowane poziomymi odkształceniami terenu [5].
Dodatkowo na ściany szczytowe budynku działa napór gruntu.
Od wielu lat prowadzone są analizy mające na celu szacowanie możliwych do wystąpienia uszkodzeń
i zapobieganie ich powstawaniu. Niestety często nie przykłada się należnej uwagi do warunków gruntowych,
w których posadowiono budynki. Pomimo, że wszystkie powyższe wielkości są w sposób bezpośredni zależne
od geometrii fundamentów budynku oraz rodzaju gruntu. Oszacowanie wielkości wpływu parametrów
geotechnicznych gruntu na naprężenia w konstrukcji budynku o znanej geometrii w obliczu eksploatacji
górniczej jest tematem niniejszej pracy.
2
OPIS WYTYPOWANEGO OBIEKTU
Do obliczeń wybrano budynek wzniesiony ok. 1930 roku w technologii tradycyjnej jako całkowicie
podpiwniczony, o 3 kondygnacjach nadziemnych (fot. 1). Konstrukcję nośną stanowią ścianowe układy
podłużne murowane z cegły o grubości od 0,40 do 0,52 m. Budynek posadowiono prawdopodobnie
na ceglanych ławach fundamentowych na głębokości ok. 1,80 m (z). Wysokość ławy fundamentowej – 0,60 m.
Wymiary gabarytowe obiektu w rzucie poziomym wynoszą 35,40x10,20 m. Stropy nad piwnicą zostały
wykonane jako ceglane odcinkowe na dźwigarach stalowych, a powyżej założono stropy drewniane.
Fot. 1. Widok na wytypowany budynek.
3
WPŁYW RODZAJU GRUNTU NA SIŁY DZIAŁAJĄCE NA FUNDAMENT
3.1 Charakterystyka geologiczno-geotechniczna analizowanego rejonu
Analizowany obiekt znajduje się w Rudzie Śląskiej, przy ul. Edmunda Kokota. Obszar ten należy w całości
do mezoregionu Wyżyna Katowicka, który wchodzi w skład Wyżyny Śląsko-Krakowskiej [6]. Fundament
Wyżyny Śląskiej tworzą węglonośne skały karbońskie wypełniające nieckę, na którą od południa są nasunięte
płaszczowiny karpackie. Na obszarze Rudy Śląskiej wyodrębnia się Płaskowyż Bytomsko-Katowicki,
przez który przebiegają rzeki (Odra i Wisła).
~ 82 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Rys. 1. Obszar Rudy Śląskiej.
Pod względem budowy geologicznej obszar miasta położony w północnej części masywu górnośląskiego,
w zasięgu występowania Górnośląskiego Zagłębia Węglowego (GZW), jest częścią paleozoicznej struktury
waryscyjskiej, pociętej uskokami. Budowę geologiczną tego obszaru tworzą:
⎯ piętro waryscyjskie złożone z utworów karbonu górnego,
⎯ piętro pokrywowe, które stanowią utwory triasu, neogenu i czwartorzędu (rys. 2).
Rys. 3. Przekrój geologiczny A–B (rys. 2) przez rejon Rudy Śląskiej [9].
~ 83 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Grunty stanowią czwartorzędowe osady plejstoceńskie, wykształcone jest w postaci piasków i żwirów
wodnolodowcowych, glin zwałowych z otoczakami i okruchami skał, i holoceńskie osady rzeczne i bagienne. Są
to drobnoziarniste piaski, ku górze przechodzące w muły bagienne [2,3].
Do analizy wybrano 4 rodzaje gruntów (piasku gliniastego – clsiSa, gliny piaszczystej – sasiCl, piasku średniego
– mSa, gliny – clSi), charakterystycznych dla analizowanego obszaru, o parametrach zgodnych z [8] (tab. 1).
Parametry
γ [kN/m3]
IL
Φ [̊]
cu [kPa]
Rodzaj gruntu
clsiSa
clsiSa
clsiSa
20
22
16,5
0,2
0,2
0,6
19
35
36
32
20
0
Tab. 1. Charakterystyka wybranych gruntów rejonu Śląska.
clsiSa
20,5
0,4
15
21
3.2 Wyznaczenie siły i naprężeń generowanych przez wpływy górnicze na konstrukcję budynku
Na podstawie [4] i [5], przeprowadzono obliczenia naprężeń i sił generowanych przez wpływy górnicze
dla poziomych odkształceń terenu o charakterze ściskań równych ε= -4‰. Na rys. 4 przedstawiono rozkład
działających na analizowany budynek obciążeń.
a)
b)
Rys. 4. Schemat obciążenia ław: a) podłużnych, b) poprzecznych.
3.2.1.
Naprężenia styczne w podstawie fundamentów
Graniczne naprężenie styczne w podstawie fundamentu jest określone wzorem:
· · gdzie :
σ – naprężenie normalne pod fundamentem, równe 0,137 MPa
K – współczynnik zależny od naprężenia normalnego pod fundamentem, przyjęty zgodnie z [5] jako 0,632
c – spójność gruntu.
Dla poszczególnych gruntów obliczono graniczne naprężenie styczne, a wyniki przedstawiono w tab. 2.
~ 84 ~
(1)
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Rodzaj gruntu
clsiSa
sasiCl
mSa
clSi
49,99
73,19
62,84
36,44
[kPa]
Tab. 2. Naprężenia styczne w podstawie fundamentów w zależności od rodzaju gruntu.
Wartość siły rozciągającej w dowolnym przekroju oddalonym od środka odosobnionego fundamentu o odcinek x
wynosi:
,
(2)
, · gdzie:
b, L – odpowiednio szerokość i długość fundamentu.
Rodzaj gruntu
Szerokość ławy
fundamentowej [m]
clsiSa
sasiCl
mSa
clSi
0,8
40,0
58,4
50,4
28,8
0,6
30,0
43,8
37,8
21,6
0,5
25,0
36,5
31,5
18,0
Tab. 3. Wyznaczone siły w [kN] od naprężeń stycznych w podstawie fundamentów w zależności od rodzaju
gruntu i szerokości ław fundamentowych.
3.2.2. Naprężenia styczne na bocznych powierzchniach fundamentów
W analizowanym przypadku pomija się wpływ naprężeń stycznych na boczne powierzchnie fundamentowe.
3.2.3. Napór gruntu na boczne powierzchnie ław
Siłę wywołaną naporem gruntu na pionową ściankę ławy usytuowaną prostopadle do kierunku poziomych
odkształceń terenu, określa się według wzoru:
0,85 · · (3)
gdzie:
σ0 – naprężenie normalne w polach międzyławowych w poziomie posadowienia,
a – rozstaw ław poprzecznych w świetle.
Wartość naporu nie może przekroczyć:
wartości jednostkowej siły wynikającej z naprężeń ścinających w gruncie, w polu międzyławowym νp,
wartości jednostkowej siły wynikającej z naporu granicznego na boczne ściany ławy dp [5].
[kN/m]
clsiSa
25,2÷51,2
Rodzaj gruntu
sasiCl
mSa
27,1÷54,9
15,4÷31,3
clSi
25,7÷52,1
Tab. 4. Wyznaczone siły w zależności od rozstawu ław poprzecznych w świetle.
3.2.4.
Parcie gruntu na ściany szczytowe
Dodatkowy napór gruntu spowodowany zagęszczaniem pg powiększa działające na ścianę parcie czynne gruntu
pa. Przyjmuje się jednak, że łączna wartość parcia gruntu, która oddziałuje na ścianę zagłębioną w gruncie nie
może być większa niż parcie bierne pb, obliczane z wzoru:
(
(
%
%
! · · tan% &45 ) 2 · · tan &45 )
Rozkład parcia biernego w zależności od zagłębienia w gruncie został przedstawiony na wykresie 1.
~ 85 ~
(4)
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Ɖď ΀ŬWĂ΁
Ϭ
ϱϬ
ϭϬϬ
ϭϱϬ
ϮϬϬ
ϮϱϬ
Ϭ͕ϬϬ
Ϭ͕ϮϬ
ĐůƐŝ^Ă
Ϭ͕ϰϬ
ƐĂƐŝů
nj΀ŵ΁
Ϭ͕ϲϬ
Ϭ͕ϴϬ
ŵ^Ă
ϭ͕ϬϬ
Đů^ŝ
ϭ͕ϮϬ
ϭ͕ϰϬ
ϭ͕ϲϬ
ϭ͕ϴϬ
Wyk. 1. Rozkład parcia biernego dla wybranych rodzajów gruntu.
4.
NAPRĘŻENIA W KONSTRUKCJI BUDYNKU PODDANEGO WPŁYWOM
EKSPLOATACJI GÓRNICZEJ
4.2. Model obliczeniowy
Do przeprowadzenia analizy wykorzystano program Autodesk Structural Analysis ROBOT. Jest to program
bazujący na Metodzie Elementów Skończonych (MES). Na potrzeby przeprowadzenia obliczeń stworzono
trójwymiarowy model obliczeniowy (rys. 5), w którym uwzględniono geometrię obiektu oraz prawdopodobne
parametry wytrzymałościowe materiałów.
Rys. 5. Trójwymiarowy model obliczeniowy konstrukcji.
W tworzeniu modelu nie uwzględniono stropów powyżej parteru, gdyż są to stropy drewniane i nie mają
wpływu na przestrzenną sztywność budynku, a jedynie przekazują obciążenia na nośne ściany budynku.
Przyjęto mur o parametrach: E = 910MPa , γ = 18kN / m 3 , co odpowiada słabemu murowi o wytrzymałości
elementu murowego f b = 10MPa , wytrzymałości zaprawy f m = 1MPa wytrzymałości muru na ściskanie
~ 86 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
f k = 2,2 MPa oraz pozwala na osiągnięcie wytrzymałości muru na ścinanie: od 0,1 MPa (w górnych partiach
ściany), do 0,22 MPa (w poziomie stropu nad piwnicą).
W kierunku pionowym model podparto wzdłuż wszystkich ław fundamentowych, a w kierunkach poziomych
uniemożliwiono ruch w osiach ław poprzecznych przebiegających w połowie długości budynku.
Do modelu przyłożono obciążenia stałe i użytkowe wyliczone zgodnie z normami oraz obciążenia poziomymi
odkształceniami gruntu o charakterze ściskań pochodzącymi od wpływów górniczych (pkt 3).
4.3. Wyniki obliczeń numerycznych
Przykładowe wyniki ścinających naprężeń głównych τ 12 dla wewnętrznej ściany podłużnej dla poszczególnych
rodzajów przedstawiono na rys. 6÷9. Wartości naprężeń podane w MPa.
Z porównania wyników uzyskanych z obliczeń można stwierdzić, że im lepsze parametry podłoża gruntowego
tym wyższe naprężenia w konstrukcji budynku. Najbardziej niekorzystne wartości naprężeń otrzymano dla gliny
piaszczystej w stanie twardoplastycznym (rys. 7) i są nawet o 60% wyższe od wartości najniższych uzyskanych
dla gliny w stanie plastycznym (rys. 9).
Rys. 6. Mapa głównych naprężeń ścinających τ 12 dla wewnętrznej ściany podłużnej dla piasku
gliniastego w stanie twardoplastycznym.
Rys. 7. Mapa głównych naprężeń ścinających τ 12 dla wewnętrznej ściany podłużnej dla gliny
piaszczystej w stanie twardoplastycznym.
Rys. 8. Mapa głównych naprężeń ścinających τ 12 dla wewnętrznej ściany podłużnej dla piasku
średniego średniozagęszczony małowilgotny.
~ 87 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Rys. 9. Mapa głównych naprężeń ścinających τ 12 dla wewnętrznej ściany podłużnej dla gliny w stanie
plastycznym.
Wyniki wskazują na możliwość powstania uszkodzeń przede wszystkim w piwnicznej części budynku, z uwagi
na przekroczenie głównie w tych rejonach, wytrzymałości muru na ścinanie, która wynosi 0,2÷0,22MPa.
5.
WNIOSKI
W artykule oszacowano dla wybranego budynku wpływ czterech różnych, powszechnie występujących
na Górnym Śląsku, gruntów na obciążenia jego fundamentów i ścian szczytowych generowanych przez wpływy
górnicze dla poziomych odkształceń terenu o charakterze ściskań równych ε= -4‰.
Następnie dla różnych wariantów obciążeń otrzymano odmienne mapy naprężeń ściskających i ścinających,
które świadczą o wytężeniu elementów konstrukcyjnych. Można zauważyć, że największe wartości otrzymano
dla gliny piaszczystej (sasiCl) w stanie twardoplastycznym.
Największe wartości głównych naprężeń ścinających otrzymano dla gliny piaszczystej (sasiCl) w stanie
twardoplastycznym, a najmniejsze dla gliny (clSi) w stanie plastycznym. Poszczególne wyniki różnią się o około
60%.
Ponadto w miejscach, w których naprężenia przekroczyły wytrzymałości muru, można z pewnym
prawdopodobieństwem przewidywać powstanie uszkodzeń.
Podsumowując można stwierdzić, że uzyskane wyniki rozkładu naprężeń w konstrukcji budynku świadczą
o tym, jak duże znaczenie na rozkład naprężenia w istniejącej konstrukcji murowej budynku ma rodzaj gruntu,
na jakim są posadowione budynki. Wskazuje to na potrzebę dokładniejszej weryfikacji warunków gruntowych
przy odpowiednim projektowaniu nowych oraz sprawdzaniu odporności istniejących budynków, gdyż siły
generowane przez wpływy górnicze w dużym stopniu zależą od gruntu.
REFERENCES
[1]
Eurokod 7. Projektowanie geotechniczne. Część 1: Zasady ogólne
[2]
GÓRNIK M., 1998 – Dokumentacja hydrogeologiczna ustalająca zasoby eksploatacyjne wód podziemnych
ujmowanych przez wyrobiska KWK Polska-Wirek. Agencja Konsultingowa LIBRA, Bytom.
[3]
JANIK G., KUŚ R., 1997 – Dokumentacja geologiczna w kategorii A, B, C1, C2 złoża węgla kamiennego
„Halemba II” w Rudzie Śląskiej. Arch. Urzędu Marszałkowskiego w Katowicach.
[4]
Kawulok M.: Szkody górnicze w budownictwie. Wydawnictwo ITB, Warszawa 2010.
[5]
Kawulok M.: Projektowanie budynków na terenach górniczych. Wydawnictwo ITB, Warszawa 2006.
Instrukcja ITB nr 416/2006.
[6]
Kondracki J., 2002 – Geografia regionalna Polski. Wyd. Nauk. PWN, Warszawa
[7]
Kwiatek J.: Obiekty budowlane na terenach górniczych. Wydawnictwo GIG, Katowice 2007.
[8]
PN-81/B-03020: Grunty budowlane. Posadowienie bezpośrednie budowli. Obliczenia statyczne
i projektowanie.
[9]
Wyczółkowski J., 1957 – Szczegółowa mapa geologiczna Polski 1:50 000, ark. Zabrze. Państw. Inst. Geol.,
Warszawa.
~ 88 ~
WK
3URFHHGLQJVRIWKH ,QWHUQDWLRQDO&RQIHUHQFHRQ
1HZ7UHQGVLQ6WDWLFVDQG'\QDPLFVRI%XLOGLQJV
2FWREHU%UDWLVODYD6ORYDNLD
)DFXOW\RI&LYLO(QJLQHHULQJ678%UDWLVODYD
6ORYDN6RFLHW\RI0HFKDQLFV6$6
7+(,1)/8(1&(2)6721(&2/8016)250$7,21
7(&+1,48(217+(&2162/,'$7,217,0(2)7+(
6855281',1*62,/
37.DQW\DQG-$6ĊNRZVNL
$EVWUDFW
6WRQH FROXPQV FRXOG EH IRUPHG LQ WZR PHWKRGV G\QDPLF UHSODFHPHQW '5 RU YLEUR UHSODFHPHQW 95 %RWK
WHFKQLTXHVDUHRIWHQXVHGWRVWUHQJWKHQWKHZHDNVRLOVXQGHUURDGHPEDQNPHQW,WLVVDLGWKDWVWRQHFROXPQLWVHOI
ZRUNVDVDGUDLQDJHLQIOXHQFLQJWKHFRQVROLGDWLRQWLPHRIVXUURXQGLQJVRLO%XWWKHUHLVQRNQRZOHGJHKRZWKH
FROXPQLQVWDOODWLRQWHFKQLTXHLQIOXHQFHVWKLVWLPH
7KH WKHVLV ZDV SXW IRUZDUG WKDW WKHKHDY\WDPSLQJ LQ G\QDPLF UHSODFHPHQW PHWKRGH[WHQGV WKHFRQVROLGDWLRQ
WLPH RI JURXQG QHDU WKH FROXPQ 7R YHULI\ WKLV WKHVLV D VHULHV RI ODERUDWRU\ WHVWV ZHUH FRQGXFWHG 7KUHH '5
FROXPQVDQGWKUHH95FROXPQVZHUHPRGHOHGRQDJHRPHWULFVFDOHRI$VZHDNJURXQGVLOW\FOD\LQVRIW
VWDWH ZDV XVHG 7KH FROXPQV ZHUH IRUPHG IURP JUDYHO 7KH\ ZHUH XQGHU FRQVWDQW ORDG RYHU GD\V 7KH
FRQVROLGDWLRQFXUYHVJURXQGXSOLIWPRLVWXUHRIVRLOVDQGFROXPQVVKDSHZHUHWDNHQXQGHUFRQVLGHUDWLRQ
.H\:RUGV
'\QDPLFUHSODFHPHQWYLEURUHSODFHPHQWVWRQHFROXPQVODERUDWRU\WHVWVSV\FKLFDOPRGHOLQJ
,1752'8&7,21
%RWK '\QDPLF 5HSODFHPHQW '5 DQG 9LEUR 5HSODFHPHQW 95 WHFKQLTXHV DUH XVHG WR UHLQIRUFH ZHDN VRLOV
HVSHFLDOO\VRLOVZKLFKFDQEHVLJQLILFDQWO\FRPSUHVVHGHJVRLOVZLWKRUJDQLFFRQWHQWZHDNFOD\VRLOVDQGORRVH
DQWKURSRJHQLFVRLOV
,QG\QDPLFUHSODFHPHQWPHWKRGWKHVRLOLVUHLQIRUFHGE\LQLWLDOO\GURSSLQJDODUJHZHLJKWW\SLFDOO\WIURP
DVLJQLILFDQW KHLJKW XS WR P 7KH FUHDWHG FUDWHU LV ILOOHG ZLWK D VWURQJHU PDWHULDO JUDYHO UXEEOH VWRQH
DJJUHJDWHGHEULVDQGWKHZHLJKWLVGURSSHGRQFHRUPXOWLSOHWLPHVDJDLQ)XUWKHURQWKHFUHDWHGFUDWHULVDJDLQ
ILOOHGZLWKWKHVWURQJHUPDWHULDODQGWKHSURFHGXUHFRQWLQXHVXVXDOO\WRWKHSRLQWZKHUHWKHGURSSHGZHLJKWGRHV
QRWSHQHWUDWHWKHVRLODQ\ IXUWKHU7KHSURFHGXUHUHVXOWVLQDFROXPQRIDVWURQJHUPDWHULDOZKLFK FDQVXVWDLQ
PXFKKLJKHUORDGVWKDQWKHVRLOLQLWVLQLWLDOFRQGLWLRQ,Q3RODQGWKHPRVWFRPPRQFROXPQGLDPHWHULVDERXW
PDQGWKHLUOHQJWKLVXSWRP
,QYLEURUHSODFHPHQWPHWKRGFROXPQVDUHIRUPHGZLWKDVSHFLDOYLEUDWRU)LUVWRIDOOWKHYLEUDWRUSHQHWUDWHVWKH
VRLO XS WR WKH GHVLJQHG GHSWK &RDUVH DJJUHJDWH LV LQWURGXFHG WR WKH DLU FKDPEHU ZLWK WKH ORFN ORFDWHG LQ WKH
XSSHUSDUWRIWKHYLEUDWRU7KHQLWLVPRYHGWRZDUGVHVFDSHKROHSODFHGDWWKHERWWRPLQWKHYLEUDWRUWLS7KH
DJJUHJDWHOHDYHVWKHYLEUDWRUWLSDVWKHYLEUDWRULVSXOOHGXS,QWKHQH[WVWDJHZKLOHWKHYLEUDWRULVSXOOHGXSLQ
DUHFLSURFDWLQJ PRWLRQ WKH DJJUHJDWH LV FRPSDFWHG DQG SUHVVHG WR WKH VLGHV 7KH FROXPQV IRUPHG ZLWK YLEUR
06F37.DQW\XO$NDGHPLFND*OLZLFHSLRWUNDQW\#SROVOSO
3URI-$6ĊNRZVNLXO$NDGHPLFND*OLZLFHMHU]\VHNRZVNL#SROVOSO
~ 89 ~
WK
,QWHUQDWLRQDO&RQIHUHQFHRQ1HZ7UHQGVLQ6WDWLFVDQG'\QDPLFVRI%XLOGLQJV
2FWREHU%UDWLVODYD
UHSODFHPHQWPHWKRGDUHDOVRNQRZQDVJUDYHOFROXPQV7KHLUGLDPHWHUVYDU\EHWZHHQDQGPDQGWKH\DUH
XSWRPORQJ7KHFROXPQGLDPHWHUGHSHQGVRQWKHYLEUDWRUGLPHQVLRQV
,QFDVHRIERWKPHWKRGVWKHJURXQGVXUURXQGLQJWKHFROXPQLVDOVRVWUHQJWKHQHGDVWKHFUHDWHGFROXPQDFWVDV
DGUDLQWRWKHRULJLQDOQRZVRPHZKDWFRPSUHVVHGVRLOZKLFKDLGVLWVFRQVROLGDWLRQ
:KLOH DQDO\WLFDO PHWKRGV RI GHVLJQLQJ YLEURFROXPQ UHLQIRUHPHQW H[LVW WKHUH DUH QR DOJRULWKPV UHODWLQJ WR
GULYHQFROXPQVZKLFKZRXOGWDNHLQWRDFFRXQWWKHVSHFLILFPHWKRGRIWKHLUFRQVWUXFWLRQ:KLOHGHVLJQLQJVXFK
FROXPQV WZR IDFWRUV DUH WDNHQ LQWR FRQVLGHUDWLRQ FROXPQ
V EHDULQJ FDSDFLW\ DQG VHWWOHPHQWV RI WKH V\VWHP
FRQVLVWLQJ RI FROXPQ DQG LWV VXUURXQGLQJ 3URMHFWV WKDW WDNH LQWR DFFRXQW GUDLQDJH HIIHFW DUH YHU\ UDUH
,QWHUQDWLRQDOOLWHUDWXUHGHVFULEHVWKLVHIIHFWZKHQLWFRPHVWR95FROXPQVZKHUHDVIRU'5FROXPQVLWKDVQRW
EHHQH[DPLQHG\HW7KHUHVHDUFKGHVFULEHGEHORZDUHWKHILUVWDWWHPSWRIWKHDXWKRUVWRGHWHUPLQHWKHHIILFLHQF\
RI'5FROXPQGUDLQDJHLQFRPSDULVRQWR95FROXPQ
5(6($5&+0(7+2'2/2*<
'HVFULSWLRQRIWHVWVWDQG
7KHWKHVLVZDVSXWIRUZDUGWKDWLPSXOVHHIIHFWVRFFXUULQJZKLOHWKHFROXPQLVUDPPHGLQG\QDPLFUHSODFHPHQW
PHWKRGH[WHQGVWKHWLPHRIVRLOFRQVROLGDWLRQ7RYHULI\LWDVHULHVRIODERUDWRU\PRGHOWHVWVZHUHFRQGXFWHGIRU
WKUHH YLEUR UHSODFHPHQW DQG WKUHH G\QDPLF UHSODFHPHQW FROXPQV $IWHU WKH WHVWV FKDQJHV RI VRLO PRLVWXUH
GHSHQGLQJRQWKHGLVWDQFHWRWKHFROXPQZHUHYHULILHG
7KH WHVWV ZHUH FRQGXFWHG LQ JHRPHWULF VFDOH (DFK FROXPQ ZDV IRUPHG LQD WXEH RI FP GLDPHWHU DQG
FPKHLJKW7KHWXEHVZHUHILOOHGZLWKVDQGXSWRWKHKHLJKWRIFPDQGWKHQDOD\HURIVLOW\FOD\ RIWKH
VDPH WKLFNQHVV ZDV SODFHG %RWK PDWHULDOV ZHUH SODFHG OD\HU E\ OD\HU DQG FRPSDFWHG XQWLO WKHLU EXON GHQVLW\
UHDFKHG WKH YDOXHV LQGLFDWHG LQ7DEOH 7KH WXEH ZDV SODFHG RQ QRQZRYHQ JHRWH[WLOH IDEULF ZKLFK DOORZHG
ZDWHU WR GUDLQ IUHHO\ 6RLO SDUDPHWHUV XVHG LQ WKHUHVHDUFKWDEOH ZHUH GHWHUPLQHG RQ WKH EDVLV RI VWDQGDUG
ODERUDWRU\WHVWV
0R>[email protected] ZLQL
Fµ
N
FX
I¶
UG
6RLOW\SH
>FPV@
>N3D@
>R@ >N3D@
>JFP@
V N3D >@
VLOW\FOD\
VDQG
JUDYHO
95'5
7DE6RLOSDUDPHWHUVXVHGLQWKHWHVWUHVHDUFK
'5 FROXPQV ZHUH IRUPHG ZLWK D J F\OLQGULFDO ZHLJKWZKLFK ZDV FP LQKHLJKW DQG FPLQ GLDPHWHU
(YHU\FROXPQZDVIRUPHGE\GURSV IURPDKHLJKWRIFPDQGGURSVIURPFP$IWHUHDFKGURSWKH
IRUPHGFUDWHUZDVUHILOOHG'XULQJWKHSURFHVV RI FROXPQIRUPDWLRQJURXQGXSOLIWRIWKHVXUURXQGLQJVRLOZDV
PHDVXUHG 7R IRUP 95 FROXPQV D FPGLDPHWHU WXEH ZDV VFUHZHG LQ XS WR WKH GHPDQGHG GHSWK DQG WKHQ
XQVFUHZHG UHPRYLQJ WKH VRLO RQ WKH VXUIDFH RI WKH JURXQG ,Q RUGHU WR SUHYHQW G\QDPLF HIIHFWV WKH FROXPQ
PDWHULDOZDVQRWFRPSDFWHGDVLQUHDOFRQGLWLRQVZKHQWKHYLEUDWRULVSXOOHGRXWLQDUHFLSURFDWLQJPRWLRQ7KH
IRUPHGFUDWHUZDVILOOHGIURPDERYHZLWKJUDYHO
(YHQWKRXJKWKHJUDYHOWKDWWKHFROXPQVZHUHIRUPHGIURPGLIIHUHGLQGHQVLW\YROXPHVRIERWKFROXPQVZHUH
VLPLODU'5FROXPQ±FP95FROXPQ±FP
2QFHWKHFROXPQVKDYH EHHQFRPSOHWHGILJDVWHHOORDGVRIWRWDOPDVVDERXWNJZHUHSODFHGRQHDFK
VDPSOH 6WHHO ORDGV ILJ E ZHUH SXW RQH E\ RQH RQ WKH VXUIDFH RI WKH VDPSOHV 7KH RSHUDWLRQ ODVWHG
DSSUR[LPDWHO\PLQXWHV7KXVVWUHVVRIDERXWN3DZDVLQGXFHG6HQVRUVRIDFFXUDF\PPZHUHXVHG
WRPHDVXUHYHUWLFDOGLVSODFHPHQWV:KLOHWKHORDGVZHUHEHLQJSODFHGWKUHHVHQVRUVORFDWHGFORVHWRWKHHGJHV
SHUIRUPHGWKHPHDVXUHPHQWV$IWHUIHZKRXUVRQO\RQHVHQVRUORFDWHGLQWKHFHQWHURIWKHXSSHUORDGZDVXVHG
ILJE
7KH PHDVXUHPHQWV ZHUH FRQGXFWHG GXULQJ KRXUV GD\V 7KHUHDGLQJV ZHUH SHUIRUPHG LQLWLDOO\ HYHU\
VHFRQGVDQGHYHU\PLQXWHVDQGRQIXUWKHUVWDJHV±HYHU\PLQXWHV
~ 90 ~
WK
,QWHUQDWLRQDO&RQIHUHQFHRQ1HZ7UHQGVLQ6WDWLFVDQG'\QDPLFVRI%XLOGLQJV
D
2FWREHU%UDWLVODYD
E
)LJ6DPSOHVXVHGLQWHVWVDEHIRUHWKHORDGVZHUHDSSOLHGEZLWKVWHHOORDGVRQWKHVXUIDFH
0RLVWXUHFKDQJHVWHVWV
GD\VODWHUDIWHUILQDOYHUWLFDOGLVSODFHPHQWVKDYHEHHQUHJLVWHUHGWHVWV\VWHPVZHUHVXFFHVVLYHO\GLVPDQWOHG
DQGVDPSOHVZHUHWDNHQWRSHUIRUPPRLVWXUHWHVWV6LPXOWDQHRXVO\FROXPQVVKDSHZDVLQYHQWRULHG
6DPSOHV IRU PRLVWXUH WHVWV ZHUH WDNHQ IURP OHYHOV DQG FP VDQG DQG FP VLOW\ FOD\ PHDVXULQJIURPWKHERWWRPRIWKHWXEH$WHDFKOHYHOVDPSOHVZHUHWDNHQIRXUDWDQGFPIURPWKH
FROXPQ D[LV 7KH\ ZHUH WDNHQ IURP SHUSHQGLFXODU D[HV RI WKH WXEH 0RUHRYHU VDPSOHV RI PDWHULDO ZHUH
FROOHFWHG IURP GLIIHUHQW OHYHOV RQ WKH D[LV RI WKH V\VWHP ,Q WRWDO WKH PRLVWXUH RI DOPRVW VDPSOHV ZDV
H[DPLQHG7KHPRLVWXUHYDOXHVRIVDPSOHVWDNHQIURPWKHVDPHORFDOL]DWLRQZHUHDYHUDJHG
&RQVROLGDWLRQFXUYHVREWDLQHGIURPPHDVXUHPHQWVRIYHUWLFDOGLVSODFHPHQWVZHUHSURFHVVHGLQVSUHDGVKHHW7KH
UHVXOWVZHUHLQWHUSUHWHGRQWKHEDVLVRIWKHDYHUDJHYDOXHIURPWKHPHDVXUHPHQWV
5(68/76
0RLVWXUHFKDQJHYDU\LQJGHSHQGLQJRQWKHGLVWDQFHIURPWKHFROXPQDQGFRQVROLGDWLRQFXUYHVRIFROXPQZHDN
VRLOV\VWHPSUHVHQWHGEHORZDUHWKHNH\UHVXOWVRIWKHUHVHDUFK7KHUHVHDUFKPHDVXUHGDOVRZHDNVRLOXSOLIWDQG
VWRQHFROXPQVVKDSH+RZHYHUWKH\DUHQRWWKHREMHFWRIGHWDLOHGDQDO\VLVLQWKLVSDSHU
&RQVROLGDWLRQ
7KHUHDUHQRVLJQLILFDQWGLIIHUHQFHVaEHWZHHQWKHFRQVROLGDWLRQVHWWOHPHQWVUHJLVWHUHGIRU'5FROXPQDQG
95 FROXPQ ILJ D 6HWWOHPHQWV RI '5 V\VWHP DUH VPDOOHU SUREDEO\ EHFDXVH RI WKH GLIIHUHQFH LQ FROXPQ
PDWHULDO GHQVLW\ '5 FROXPQ PDWHULDO LV PRUH FRPSDFWHG 6PDOOHU VHWWOHPHQWV PD\ DOVR EH WKH UHVXOWV RI WKH
FROXPQIRUPDWLRQPHWKRGLWVHOIZKLFKFKDQJHVWKHSDUDPHWHUVRIWKHVXUURXQGLQJVRLO
)LJ&RQVROLGDWLRQFXUYHVRI'5DQG95FROXPQVV\VWHPVDQDWXUDOVFDOHEORJDULWKPLFWLPHVFDOH
,WLVQRWHZRUWK\WKDWWKHFRQVROLGDWLRQFXUYHVDUHDOPRVWSHUSHQGLFXODUIURPWKHEHJLQQLQJ7KHRQO\GLIIHUHQFH
FDQEHVHHQZKHQWKHORDGLVSODFHGILJE7KXVLWVHHPVWKDWRQWKLVVFDOHWKHPHWKRGRIFROXPQIRUPDWLRQ
~ 91 ~
WK
,QWHUQDWLRQDO&RQIHUHQFHRQ1HZ7UHQGVLQ6WDWLFVDQG'\QDPLFVRI%XLOGLQJV
2FWREHU%UDWLVODYD
GRHV QRW LQIOXHQFH WKH FRQVROLGDWLRQ WLPH RI WKH FROXPQ VXUURXQGLQJ 7KH FRQVROLGDWLRQ VHWWOHPHQW YDOXH ZLOO
GHSHQGRQILOWUDWLRQSDUDPHWHUVRIWKHV\VWHPDQGRQWKHFROXPQPDWHULDOGHQVLW\
0RLVWXUH
6DPSOHVIRUPRLVWXUHLQYHVWLJDWLRQZHUHFROOHFWHGDVGHVFULEHGDERYH,QLWLDOO\WKHDYHUDJHYDOXHRIVLOW\FOD\
PRLVWXUHIRU'5FROXPQZDVDQGIRU95±6DQGPRLVWXUHZDVWKHVDPHIRUERWKFROXPQV±
$IWHU GD\V RI FRQVROLGDWLRQ VRLO PRLVWXUH YDULHG GHSHQGLQJ RQ WKH GLVWDQFH IURP WKH FROXPQ )LJXUHV SUHVHQWWKHUHVXOWVRIWKHLQYHVWLJDWLRQ
)LJ5HVXOWVRIPRLVWXUHLQYHVWLJDWLRQRIWKHPRGHO
,WKDVEHHQREVHUYHGWKDWWKHPRLVWXUHRI ERWKVLOW\ FOD\DQGVDQGLVKLJKHUIRUGULYHQFROXPQLQDOPRVWHYHU\
PHDVXULQJSRLQW7KHGLIIHUHQFHVDUHLQVLJQLILFDQWDERXW7HVWSUHFLVLRQZDVDOVRGHWHUPLQHGWREH
+LJKHU PRLVWXUH YDOXHV IRU '5 FROXPQV V\VWHP PD\ EH UHODWHG WR ORZHU ILOWUDWLRQ FDSDFLW\ RI WKHVH FROXPQV
7KH LQFOLQDWLRQ RI PRLVWXUH PHDVXUHPHQWV UHVXOWV LV QRWLFHDEOH LQ ERWK FDVHV ,Q WKH XSSHU SDUW RI WKH V\VWHP
K FPPRLVWXUHYDOXHVDUHVLPLODUDQGDUHQRWLQIOXHQFHGE\WKHGLVWDQFHIURPWKHFROXPQ' ,WLV
FOHDUO\YLVLEOHLQWKHORZHUSDUWRIVLOW\FOD\K FPWKDWWKHPRLVWXUHYDOXHGURSVLQWKHYLFLQLW\RIWKHFROXPQ
DQGULVHVQH[WWRWKHWXEHVLGHV' :KHQLWFRPHVWRVDQGWKHGLIIHUHQFHVDUHQRWELJ' EXW
PRLVWXUH YDOXHV WHQG WR EH KLJKHU XQGHUWKH FROXPQ 7KHPHDVXUHPHQWV LQGLFDWHG WKHKLJKHVW PRLVWXUH YDOXHV
XQGHUWKHFROXPQDQGWKHORZHVW±LQVDQGDGMDFHQWWRWKHWXEHVLGHV7KHVHREVHUYDWLRQVLQGLFDWHWKHH[LVWHQFHRI
YHUWLFDODQGKRUL]RQWDOZDWHUIORZLQWKHDQDO\]HGV\VWHP7KHLQIOXHQFHRIYHUWLFDOILOWUDWLRQLVGLVWLQFWLYH
2%6(59$7,216
7KH GHVFULEHG WHVWV VKRZHG QR YLVLEOH GLIIHUHQFH LQ WKH FRXUVH RI FRQVROLGDWLRQ SURFHVV RI FROXPQZHDN VRLO
V\VWHP IRU'5DQG95FROXPQV2QWKHEDVLVRQVPDOOVFDOHWHVWVLWFDQEHVWDWHGWKDWWKHVHWWOHPHQWYDOXHLV
GHWHUPLQHGE\WLPHZD\RIORDGSODFLQJYROXPHDQGGHQVLW\RIGUDLQPDWHULDODQGQRWE\WKHPHWKRGRIFROXPQ
IRUPDWLRQ+RZHYHULWVKRXOGEHQRWHGWKDWGULYHQFROXPQVZHUHIRUPHGLQVRLOZLWKDJUDPPHUZKHUHDV
LQQDWXUDOVFDOHDUDPPHURIWLVXVHG7KHUHLVDULVNWKDWGXHWRVPDOOGURSHQHUJ\REWDLQHGLQODERUDWRU\
VRPHRIWKHSURFHVVRFFXUULQJLQVLWXPD\QRWKDYHWDNHQSODFHGXULQJWKHLQYHVWLJDWLRQ0RLVWXUHWHVWVVKRZHG
RQO\ D OLWWOH GLIIHUHQFH LQ FRQVROLGDWLRQ RI WKH WZR V\VWHPV ZKLFK VKRXOG EH FRQVLGHUHG DV QHJOLJLEOH LQ
GHVLJQLQJ+RZHYHUWKHDQDO\VLVRISURFHVVHVRFFXUULQJGXULQJWKHUHLQIRUFHPHQWFRQVWUXFWLRQFOHDUO\LQGLFDWHV
WKDWWKHUHDUHWHQGHQFLHVWRFKDQJHV
,QIXWXUHWKHDXWKRUV
DLPLVWRFDUU\RXWQXPHULFDODQDO\VLVUHIOHFWLQJWKHSUHVHQWHGUHVHDUFKFRPSDUHWKHUHVXOWV
ZLWKWKHPHDVXUHPHQWVRIDV\VWHPZLWKRXWWKHFROXPQDQGSHUIRUPRWKHUVHULHVRIWHVWVRQDELJJHUVFDOH
'XHWRWKHOLPLWHGQXPEHURISDJHVIRUVXEPLVVLRQELEOLRJUDSKLFUHIHUHQFHVFRQFHUQLQJWKHGLVFXVVHGSUREOHP
DUHSUHVHQWHGZLWKWKHIXOOYHUVLRQRIWKHDUWLFOHRQ&'
~ 92 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
PROPOZYCJA KLASYFIKACJI KONSTRUKCJI
TYPU TENSEGRITY
A. Kasprzak1
Abstract
There is a number of structures called tensegrity, but not all of them have properties adequate for this type of
structural principle. The paper presents a precise, mechanically reasonable definition of pure tensegrity and
tensegrity-like structures. Examples of structures are presented and classified on the basis of the definition.
Key Words
Tensegrity; Tensegrity classification; Tensegrity bridge
1
WSTP
Historia idei konstrukcji typu tensegrity siga pierwszej połowy XX wieku. Za pierwszych autorów uwaa si
Davida Georgesa Emmericha, Richarda Buckminstera Fullera i Kenneth’a Snelsona, którzy niezalenie od
siebie, w latach 60. opatentowali zblione do siebie konstrukcje, dzi powszechnie nazywane tensegrity.
Konstrukcje składaj si z niecigłego układu elementów ciskanych (zastrzały) wewntrz cigłego układu
elementów rozciganych (cigna). Sztywno konstrukcji jest niezalena od obcie zewntrznych (w tym siły
cikoci) i moe by zwikszana poprzez wstpne sprenie, wprowadzajce siły normalne do tworzcych j
elementów. Cigna i zastrzały tworz przestrzenn siatk i wzajemnie stabilizuj si. Istnieje jednak wiele
rozbienych definicji tensegrity, zarówno pod wzgldem cech wymienionych powyej jak i innych cech
konstrukcyjnych. Przykładowe moduły tensegrity przedstawiono na Rys. 1.
Rys. 1. Przykładowe moduły tensegrity
Czy zatem, jak niektórzy twierdz, balon wypełniony powietrzem albo rowerowe koło s tensegrity? Celem
niniejszej pracy jest okrelenie jednoznacznej definicji konstrukcji tensegrity oraz przedstawienie klasyfikacji
konstrukcji pod wzgldem ich cech. Definicja opiera si na właciwociach podstawowych konstrukcji typu
tensegrity, odróniajcych je od innych konstrukcji prtowych. Podlegaj one jednoznacznej ocenie za pomoc
metod mechaniki konstrukcji i pozwalaj na precyzyjne zdefiniowanie pojcia tensegrity przy ograniczeniu
1
Mgr in. A. Kasprzak, Warsaw University of Technology, Faculty of Civil Engineering, Institute of Roads and
Bridges, Al. Armii Ludowej 16, 00-637 Warsaw, Poland, e-mail: [email protected]
~ 93 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
rozwaa do struktur kratowych. Zostanie równie okrelona szeroka definicja konstrukcji majcych jedynie
cz z cech tensegrity. Definicja posłuy ocenie przykładowych konstrukcji, które niejednokrotnie zbyt
pochopnie zaliczane s do zbioru tensegrity.
2
CECHY MECHANICZNE KONSTRUKCJI TYPU TENSEGRITY
Ze wzgldu na wystpowanie w konstrukcjach tensegrity jedynie elementów, w których wystpuj wyłcznie
siły normalne, do opisu mechaniki tyche konstrukcji mona zastosowa mechanik kratownic [3]. W przypadku
niepodpartych kratownic warunek statycznej wyznaczalnoci okrela wzór Maxwella:
3n − e − 6 = 0,
(1)
gdzie: n – liczba wzłów konstrukcji, 6 – liczba skoczonych ruchów sztywnych w przestrzeni
trójwymiarowej, e – liczba prtów.
Powysze wyraenie mona uogólni [2], poniewa istniej konstrukcje stabilne, które maj mniejsz ni
okrelona przez wzór (1) liczb prtów. Dzieje si tak, gdy w konstrukcji wystpuje infinitezymalny mechanizm,
równowaony przez samorównowany układ sił, który mona nazwa stanem samonaprenia (ang. self-stress).
Mechanizm infinitezymalny opisuje lokaln geometryczn zmienno w zakresie nieskoczenie małych
przemieszcze, w przeciwiestwie do mechanizmów skoczonych, zwizanych z dowoln geometryczn
zmiennoci konstrukcji. Uogólniony wzór Maxwella ma nastpujc posta:
3n − e − 6 = k − s,
(2)
gdzie: k – liczba mechanizmów infinitezymalnych, s – liczba stanów samonaprenia.
Kratownica nabiera cech tensegrity, kiedy pojawia si w niej infinitezymalny mechanizm stabilizowany przez
stan samonaprenia. Mona udowodni, e w tensegrity uzyskanym na skutek zmiany konfiguracji prtów
kratownicy, pewne długoci cigien maj wartoci minimalne albo długoci zastrzałów maj wartoci
maksymalne. Zatem w tensegrity w sposób naturalny, na skutek działania obcie zewntrznych lub stanu
samonaprenia, w cignach pojawiaj si siły rozcigajce, a w zastrzałach ciskajce.
3
DEFINICJE TENSEGRITY
Istnieje wiele rónych definicji tensegrity, przez co niemal niemoliwe jest klasyfikowanie ustrojów do tej klasy
konstrukcji bez podania jej precyzyjnej definicji. W literaturze mona znale definicje bardzo restrykcyjne,
oparte na pierwszych patentach, nakładajce ograniczenia takie jak: warunek równej długoci wszystkich
elementów ciskanych czy zakaz stykania si elementów ciskanych w jednym wle. Z drugiej strony, liberalne
podejcie do kwestii definicji tensegrity pozwala zakwalifikowa do tej grupy wszystkie struktury, w których
wystpuje integracja sił ciskajcych i rozcigajcych. Fuller stwierdził nawet, e: „Wszystkie konstrukcje
właciwie rozumiane, od Układu Słonecznego do atomu, s konstrukcjami tensegrity.” [1]
3.1 Wybrane definicje
Kilka z definicji jest uznawanych przez wiksze grono naukowców i czsto wystpuje w literaturze przedmiotu.
Jedn z nich jest do szeroka definicja, przedstawiona przez Anthonego Pugha: „System tensegrity jest
ustanowiony kiedy niecigły układ elementów ciskanych oddziałuje z cigłym układem elementów
rozciganych, okrelajc stał objto w przestrzeni.” [6]
Definicj t, o wymogi samonaprenia oraz zawierania si ciskania wewntrz rozcigania, zawził Motro:
„System tensegrity jest systemem znajdujcym si w stabilnym stanie samonaprenia, zawierajcym niecigły
układ elementów ciskanych w cigłym układzie elementów rozciganych.” [5]
Odmienne podejcie prezentuj Skelton i de Oliveira. Okrelaj oni pojcie konfiguracji tensegrity, bdcej
układem brył sztywnych, które staj si konstrukcj tensegrity jeli zostan połczone układem elementów
rozciganych [7]. Autorzy dodatkowo podkrelaj moliwo połczenia w wle wicej ni jednego elementu
ciskanego. Maksymalna liczba elementów ciskanych w wle okrela „klas” tensegrity.
3.2 Autorska definicja i klasyfikacja konstrukcji typu tensegrity
Z punktu widzenia mechaniki konstrukcji, najwaniejsz z cech tensegrity jest wystpowanie przynajmniej
jednego stanu samonaprenia jako usztywnienia mechanizmów infinitezymalnych. To włanie te cechy
decyduj o wyjtkowoci konstrukcji i o fakcie wystpowania prtów wyłcznie rozciganych, które mona
zastpi cignami, nawet bez wstpnego sprenia. Natomiast ze wzgldu na przestrzenny charakter konstrukcji,
~ 94 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
jej integralno, niezaleno od obcie zewntrznych i warunków podparcia, istotny jest warunek
niecigłoci ciskania wewntrz rozcigania. W zwizku z tym proponuje si nastpujc definicj „czystego
tensegrity”, opart na mechanice kratownic:
Konstrukcja typu tensegrity jest kratownic, w której wystpuj mechanizmy infinitezymalne usztywniane przez
samorównowane układy sił. Elementy ciskane stanowi niecigły układ wewntrz cigłego układu elementów
rozciganych, nieposiadajcych sztywnoci na ciskanie.
Stosowanie takich ustrojów w konstrukcjach inynierskich jest bardzo ograniczone, dlatego wprowadza si
pojcie „konstrukcji o cechach tensegrity”, łagodzce wymogi powyszego opisu. Definicja oparta jest na
szeregu cech, decydujcych o właciwociach tensegrity. Mówimy o konstrukcji o cechach tensegrity, jeli
spełnia ona wszystkie obligatoryjne i przynajmniej jeden z pozostałych wymogów zgodnie z Tab. 1. Weryfikacja
wymogów posłuy do oceny i klasyfikacji konstrukcji pretendujcych do miana tensegrity.
Obligatoryjno
Cecha
Oznaczenie
+
Konstrukcja jest kratownic%.
K
+
W konstrukcji wystpuje stan samonapr&enia (ang. self-stress).
S
W konstrukcji wystpuje mechanizm infinitezymalny stabilizowany przez S.
M
spełnienie min.
Układ elementów ciskanych jest nieci%gły.
N
jednego wymogu
Elementy ciskane znajduj si wewn%trz układu elementów rozciganych.
W
+
Elementy rozcigane nie maj sztywnoci na ciskanie – s ci&gnami.
C
Tab. 1. Wymogi definicji konstrukcji o cechach tesnegrity
4
KLASYFIKACJA WYBRANYCH KONSTRUKCJI
4.1 Podstawowe moduły tensegrity
Podstawowe moduły tensegrity, takie jak pokazane na Rys. 1., pod warunkami opisanymi w rozdziale 2,
spełniaj wszystkie wymogi stawiane przez definicj czystego tensegrity. Podobne cechy wykazuj równie
niektóre konstrukcje wie, utworzonych z połczenia takich modułów.
K
+
S M N W C
+ + + + +
Klasyfikacja
Czyste tensegrity
Tab. 2. Klasyfikacja podstawowych modułów tensegrity
a)
b)
c) [4]
Rys. 2. Klasyfikowane konstrukcje
4.2 Kopuły tensegrity
Ustroje cignowe konstrukcji dachowych Rys. 2.a., zwane czsto kopułami tensegrity, nie maj mechanizmów
infinitezymalnych, a elementy ciskane znajduj si wewntrz rozciganych jedynie lokalnie2 – globalnie cigna
rozparte s pomidzy ciskan obrcz – tak jak w konstrukcji koła rowerowego. Jest to konstrukcja o cechach
tensegrity.
2
Efekty lokalne zaznaczono w Tab. 3. i Tab. 4. symbolem +*
~ 95 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
K
+
S M N W C
+ - + +* +
October 2013, Bratislava
Klasyfikacja
Konstrukcja o cechach tensegrity
Tab. 3. Klasyfikacja kopuł tensegrity
4.3 Kładka Kurilpa
Cechy tensegrity Kładki Kurilpa w Brisbane Rys. 2.b. dotycz przede wszystkim struktury stanowicej poziome
usztywnienie konstrukcji – poziomych zastrzałów zawieszonych pomidzy cignami. Maj one zatem charakter
lokalny, s jednak istotne dla pracy całej konstrukcji. Cechy tensegrity wykazuj równie elementy
podtrzymujce dach.
K S M N W C
+ +* - +* +* +
Klasyfikacja
Konstrukcja o cechach tensegrity
Tab. 4. Klasyfikacja kładki Kurilpa
4.4 Odwrócona kratownica Finka
Konstrukcje zastosowane na przykład w projekcie kładki KL-03 nad tras S-7 Rys. 2.c. [4], czy w projekcie
kładki przez Odr we Wrocławiu [8], przez autorów przytoczonych artykułów nazywane s tensegrity. S to
jednak jedynie sprone kratownice, w których elementy rozcigane zostały zastpione cignami. Pod wzgldem
mechaniki, w takich konstrukcjach moliwo uycia cigien wynika z wprowadzenia wstpnych sił sprenia
zalenych od kierunku działania obcienia – nie ma stanu samonaprenia. Specyfika tensegrity polega
natomiast na tym, e siły okrelonych znaków pojawiaj si w elementach w sposób naturalny, niezalenie od
sprenia konstrukcji. Sprenie w tensegrity, jeli zostaje wprowadzone, nie zaley od kierunku działania siły
cikoci – układ sił stanu samonaprenia jest samorównowany (integralno). Brak równie przestrzennego
charakteru konstrukcji i spełnienia warunku niecigłoci elementów ciskanych wewntrz rozciganych.
K
+
S M N W C
- - - - +
Klasyfikacja
Kratownica
Tab. 5. Klasyfikacja odwróconej kratownicy Finka
5
WIOSKI
Inynierowie poszukujc nowych, nietypowych konstrukcji coraz chtniej sigaj po tensegrity. Wielo i
niejednoznaczno definicji sprawia jednak, e niejednokrotnie to okrelenie uywane jest zbyt pochopnie.
Konstrukcje tensegrity róni si od innych struktur okrelonymi cechami, które mona precyzyjnie okreli na
podstawie narzdzi mechaniki budowli. Przedstawione w niniejszej pracy definicje jednoznacznie okrelaj co
moe by nazywane tensegrity, a co i w jakim stopniu ma tylko cz właciwoci tensegrity. Wykazano take,
e nazwa tensegrity jest uywana równie w odniesieniu do konstrukcji, które tych własnoci nie maj.
LITERATURA
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
Buckminster Fuller, R.: Synergetics: Explorations in the Geometry of Thinking. Macmillan Publishing Co.
Inc., New York 1975.
Calladine, C. R: Buckminster Fuller’s “Tensetrity” Structures and Clerk Maxwell’s Rules for the
Construction of Stiff Frames. Int. J. Solids Structures, 1978, Vol. 14, pp. 161-172.
Gilewski, W. - Kasprzak, A.: Wstp do Mechaniki Modułów Tensegrity, edited by: Jemioło S., Lutomirski
Sz., Teoretyczne podstawy budownictwa. Vol. I. Mechanika materiałów i konstrukcji. OWPW, Warsawa
2012, pp. 83-94.
Markocki, B. – Oleszek, R.: Konstrukcje Tensegrity w Zastosowaniu Mostowym na Przykładzie Koncepcji
Kładki KL-03 nad Tras S-7 Salomea-Wolica, VII Konferencja Estetyka Mostów, Warszawa-Jachranka
2011, pp. 109-116.
Motro, R.: Tensegrity: Structural Systems for the Future, Kogan Page Science, London 2003.
Pugh, A.: An Introduction to Tensegrity. University of California Pres, Ltd., Berkeley 1976.
Skelton, R. E. – de Oliveira, M. C.: Tensegrity Systems. London 2009.
Szybiski J.: Konstrukcje Tensegrity w Budownictwie Mostowym. Mosty, 1, 2013 pp. 46-50.
~ 96 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
NUMERICAL ANALYSES OF THIN TEXTILE REINFORCED
CONCRETE PLATES ON BASIS OF LABORATORY TESTS
RESULTS
B. Kotala1 and M. WĊJORU]2
Abstract
Textile Reinforced Concrete (TRC) is a building material especially suited for lightweight precast members such
as shells, road-VFUHHQVDQGIDoDGHHOHPHQWV'XHWRUHVLVWDQFHWRFRUURVLRQLWFDQEHXVHGZLWKDWKLFNQHVVLQWKH
range of 10 to 40 mm, which cannot be achieved with standard steel reinforcement, and with minimal concrete
cover for bond. Strong fabrics available today are manufactured from glass, carbon or, in recent years, also
from basalt fibres. Contrary to steel reinforcement, such fibres in the textile can be positioned in almost any
direction and subsequently can be nearly perfectly adopted to the orientation of the applied load. Therefore, it is
possible to create an extremely effective reinforcement. On the other hand, the stress-strain relations are quite
different in steel (with yielding) and in textiles (fully linear). This influences significantly the behaviour under
loading. In this paper, the results of FEM analyses are compared with WKHWHVWV¶UHVXOWVRIYHU\WKLn, only 40 mm
thick TRC plates.
Key Words
Textile reinforced concrete, thin RC-plates, AR-Glass textile fabrics, FEM analyses.
1
INTRODUCTION
Mechanic behaviour of textile reinforced concrete (TRC) elements differs significantly from conventionally
reinforced concrete elements: stress-strain relations are quite different in steel (with yielding) and in woven
textiles (fully linear). Since the diameter of the fibres in the textile reinforcement is lower than the necessary
diameter of steel reinforcement and there is no minimum concrete cover requirement, the casting of very thin
concrete members is possible. Nevertheless, despite many thin elements applications [1], mechanical
characterization of the TRC is on-going and still incomplete. The mechanics of the TRC is governed by the load
transfer across fibre-matrix interface and by yarns itself. Due to complex microstructure of yarns, stress
distribution of core and sleeve fibers is different. The general aim of our research is comparison of load-bearing
behaviour of different kinds of textiles as reinforcement of the thin concrete plates with comparison to
conventional, steel reinforced concrete. On basis of laboratory tests results, the modeling of TRC elements is
developed by means of FEM simulations.
2
MATERIAL PROPERTIES
The microstructure of non-metallic, textile reinforcement differs significantly from traditional, steel
reinforcement. If steel bars can be considered as homogenous, the textile reinforcement is composed of rovings
1
2
Dr. B. Kotala, Silesian University of Technology, (0048) 32-237-23-35, [email protected]
'U0:ĊJORU], Silesian University of Technology, (0048) 32-237-23-35, [email protected]
~ 97 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
combined with a binding matrix (usually polymeric). Textiles can be produced of different types, with various
fibres (e.g. made from alkali resistant-glass, carbon or basalt), at reasonable cost using modern, automated
manufacturing techniques. The mechanic behaviour of TRC composite is highly influenced by mechanic of
textile reinforcement itself. The stress distribution in yarns embedded in concrete matrix is related to production
processes. The fabrics for TRC are produced from dry rovings consisting of fine filaments with cross section of
just 10-25 Pm. Embedding the fabrics in a cementitious matrix forms a highly heterogeneous bond structure
during the curing phase. Under loading the heterogeneity of the bond leads to damage mechanisms special to
TRC [2]. Especially, stress levels of core and sleeve rovings are different, and ± in many cases ± randomly
distributed in yarns (Fig. 1).
Fig. 1. Illustration of the stress levels in the rovings
It is known from tests that single rovings show slightly different behaviour in comparison to yarns. Single
rovings at tension are characterized by linear-elastic behaviour up to rapture, whereas the yarns at tension show
pre-dominant linear-elastic behaviour, but with yield and softening [Fig. 2]. In numerical model, complex
microstructure of yarns was simplified: realistic, heterogeneous and irregular cross section of yarns was replaced
by equivalent, homogenous cross section. Furthermore, in these, preliminary calculations, for textile
reinforcement: simplified, linear-elastic material model was applied.
Notation:
± stresses in yarns,
± strains in yarns,
± characteristic tensile strength of yarn,
± angles,
± yield strength of yarn,
± elastic modulus of yarn,
± characteristic strain at rapture of yarn,
± characteristic yield strain.
Vf
Hf
ffyk
Df, Ef
ftyk
Ef
Hfuk
Hfyk
Fig. 2. $XWKRUV¶SURSRVDOIRUVLPSOLILHGPRGHORIWH[WLOHIDEULFV
3
OUTLINE OF LABORATORY TESTS
3ODWHVZLWKGLPHQVLRQVî mm in plane and only 40 mm in depth were subjected to bending tests [3].
The elements were tested as simply supported along two edges, in three-point load scheme with concentrated
force linearly distributed at mid-span. The plot of laboratory stand is shown in Fig. 3.
~ 98 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Fig. 3 ,QVWDQWDQHRXVWHVWV¶VHW-up: a) static scheme, b) test stand. Dimensions in [mm].
4
NUMERICAL MODEL
Theoretical calculations were done with use of MAFEM3D (by S. Majewski and G. Wandzik, in Structural
Engineering Department, Silesian University of Technology, Gliwice). Preliminary analysis was based on data
obtained from two test elements, i.e. steel reinforced cross-section and textile, AR-Glass fabrics reinforced plate.
'XH WR V\PPHWU\ RI WKH WHVWV¶ SODWHV WKH TXDUWHU RI WKH SODWH ZDV analysed [Fig. 4]. Mean material properties
obtained from material tests and applied in the model are listed in Tab. 1.
Material
Concrete
Reinforcement
Steel reinforcement
AR-Glass reinforcement
fcm = 49.87 MPa,
fctm = 3.62 MPa,
Ecm = 37.17 î103 MPa,
Q = 0.20,
Es = 215.66 î103 MPa,
fyk = 243.91 MPa,
ftk = 373.99 MPa,
as = 238,754 î10-6 m2/mb.
fcm = 41.88 MPa,
fctm = 3.14 MPa,
Ecm = 35.55 î103 MPa,
Q = 0.19,
Ef = 82.08 î103 MPa,
ffyk = 1206.15 MPa,
fftk = ffyk = 1206.15 MPa.
af # aprox. 46,296 î10-6 m2/mb.
Tab. 1. Material properties
Fig. 4. Numerical model made from finite elements: solids and bars
The load was applied by incremental steps of deflection. Deflection was applied into stiff bar at the end of the
analysed element. The number of loading steps was equal to 50 and the last step of loading means failure of the
element.
5
RESULTS
In the numerical analysis the correlation between theoretical results and the results of laboratory tests is much
better in case of traditional, steel reinforcement [Fig. 5, 6]. Nevertheless, in the first, pre-cracking phase, also
numerically modelled, textile reinforced plates show good correlation with the tests results. The differences
appeared in post-cracking phase. Here, the differences between theory and practice arose. Undoubtedly the
phenomena of structural behaviour of TRC composite after cracking still requires better understanding.
~ 99 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
10.0
a)
b)
10.0
8.0
Force [kN]
Force [kN]
8.0
6.0
4.0
SR-test
SR-FEM
2.0
0.0
October 2013, Bratislava
0.0
2.5
5.0
7.5
Deflection [mm]
6.0
4.0
AR-test
AR-FEM
2.0
0.0
10.0
0.0
5.0
10.0
15.0
Deflection [mm]
20.0
Fig. 5. Force-deflection plots for: a) steel-reinforced (SR) composite, b) AR-glass reinforced composite from tests
and FEM analysis
a)
b)
Fig. 6. Stress ratio of concrete at failure: a) steel-reinforced (SR) composite, b) AR-glass reinforced composite
ACKNOWLEDGEMENT
6FLHQWLILFUHVHDUFKKDVEHHQFDUULHGRXWDVDSDUWRIWKH3URMHFW´,QQRYDWLYHUHFRXUVHVDQGHIIHFWLYHPHWKRGVRI
safety improvement and durability of buildings and transport inIUDVWUXFWXUH LQ WKH VXVWDLQDEOH GHYHORSPHQW´
financed by the European Union from the European Fund of Regional Development based on the Operational
Program of the Innovative Economy.
REFERENCES
[1]
Deutsches Zentrum Textilbeton, Dresden, http://textilbetonzentrum.de.
[2]
Mumenya, S.: Evaluation of mechanical behaviour of textile concrete. Mechanical properties of textile
FRQFUHWHVXEMHFWHGWRGLIIHUHQWHQYLURQPHQWDOH[SRVXUHV9'09HUODJ'U0OOHU6DDUEUFNHQ
[3]
Ajdukiewicz, A. - Kotala, B. - :ĊJORU]0 Behaviour of precast concrete plates reinforced with textile
fabrics under short-term and long-term loading, Proceedings of the 9th Central European Congress on
&RQFUHWH(QJLQHHULQJ:URFáDZ, 2013.
~ 100 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
COMPARISON OF HYDRODYNAMIC PARAMETERS OF
RECTANGULAR TANKS ACCORDING TO MODELS BY
MALHOTRA AND HOUSNER
K. Kotrasová1 and E. Kormaníková2
Abstract
Ground-supported tanks are used to store a variety of liquids. During earthquake activity the liquid exerts
impulsive and convective pressures (sloshing) on the walls and bottom of the rectangular tank. Knowledge of
forces, pressures acting on the walls and bottom of containers during an earthquake is important for good
design of earthquake resistance structure/facility – tanks. This paper provides comparative study according to
models by Malhotra and Housner for calculating of hydrodynamic effect of fluid developed during an
earthquake in liquid storage ground-supported rectangular container.
Key Words
rectangular container, fluid, earthquake
1
INTRODUCTION
Ground-supported tanks are used to store a variety of liquids, e.g. water for drinking and fire fighting,
petroleum, chemicals and liquefied natural gas. Satisfactory performance of tanks during strong ground
shaking is crucial for modern facilities.
Knowledge of forces, pressures acting on the walls and bottom of containers during an earthquake is
important for good design of earthquake resistance structure/facility – tanks, which are made from steel or
concrete.
2
DYNAMIC MODEL
The motion of fluid contained in a rigid container may be expressed as the sum of two separate contributions,
called “rigid impulsive” and “convective” respectively [2, 7 – 14]. The “rigid impulsive” component satisfies
exactly the boundary conditions at the walls and the bottom of the tank, but gives (incorrectly, due to the
presence of the waves in the dynamic response) zero pressure at the original position of the free surface of
fluid in the static situation. The “convective” term does not alter those boundary conditions that are already
satisfied, while fulfilling the correct equilibrium condition at the free surface. When a tank containing liquid
vibrates, the liquid exerts impulsive and convective hydrodynamic pressure on the tank wall and the tank base,
1
Ing. K. Kotrasová, PhD., Technical University of Košice, Civil Engineering Faculty, Vysokoškolská 4,
042 00 Košice, +421 55 602 4394, [email protected]
2
Doc. Ing. E. Kormaníková, PhD., Technical University of Košice, Civil Engineering Faculty,
Vysokoškolská 4, 042 00 Košice, +421 55 602 4168, [email protected]
~ 101 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
in addition to the hydrostatic pressure. Seismic design of liquid storage tanks has been adopted in [2, 3, 6, 7,
12].
The dynamic analysis of a liquid – filled tank may be carried out using the concept of generalized single
degree of freedom (SDOF) systems representing the impulsive and convective modes of vibration of the tank
– liquid system as shown in Figure 1. For practical applications, only the first convective mode of vibration
needs to be considered in the analysis, mechanical model, see Fig. 1. The impulsive mass of liquid mi is
rigidly attached to tank wall at height hi (or hi' ). Similarly convective mass mc is attached to the tank wall at
height hc (or hc' ) by a spring of stiffness kc. The mass, height and natural period of each SDOF system are
obtained by the methods described in [6, 9].
For a horizontal earthquake ground motion, the response of various SDOF systems may be calculated
independently and then combined to give the base shear and overturning moment. The most tanks have
slimness of tank γ, whereby 0.3 < γ < 3. Tank’s slimness is given by relation γ = H/L or γ = H/R, where H is
the height of fluid’s filling in the tank and R is inside radius or 2L is inside width of tank [6 - 9].
kc/2 mc
kc/2
H
hc
( hc' )
hi
mi
( hi' )
2L or 2R
L
2L or 2R
Fig. 1. Spring mass model
2.1 Malhotra model
For a ground supported rectangular tank, in which the wall is rigidly connected with the base slab, the natural
period of the impulsive mode of vibration Ti = Tf in seconds, is given by [7, 11]
Tf = 2 ⋅ π ⋅ d f g
(1)
where df is the deflection of the wall on the vertical centre-line and at the height of the impulse mass, when
wall is loaded by a load uniform in the direction of the ground motion and of magnitude mig/(4BH), where B
is the half with perpendicular to the direction of loading (earthquake direction) and mi is the impulsive mass.
The mass can be obtained from the equivalent cylindrical tank results and should include the wall mass [11].
For tanks without roofs the deflection df may be calculate assuming the wall to be free at the top and fixed on
the other three sides.
For a ground supported rectangular tank, in which the wall is rigidly connected with the base slab, the natural
period of the convective mode of vibration Tc = T1, in seconds, is given by
T1 = 2 ⋅ π
L g
⎛π H ⎞
tanh ⎜ ⋅ ⎟
2
⎝2 L⎠
π
(2)
Total base shear V of ground supported tank at the bottom of the wall can be also obtained by base shear in
impulsive mode and base shear in convective mode, eq. (3). Total base shear V’ of ground supported tank at
the bottom of base slab is given also by base shear in impulsive mode and base shear in convective mode too,
eq. (4).
The bending moment M of ground supported tank immediately above the base plate is given also by, eq. (5)
and the overturning moment M’ of ground supported tank immediately below the base plate is given also by,
eq. (6).
(3)
V = (mi + m w + m r )S e (Ti ) + (mc )S e (Tc ) ,
~ 102 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
V ' = (mi + mw + mb + mr )S e (Ti ) + (mc )S e (Tc ) ,
M = (mi hi + m w hw + m r hr )S e (Ti ) + (mc hc )S e (Tc ) ,
(
)
(
)
M ' = mi hi' + mw hw + mb hb + mr hr S e (Ti ) + mc hc' S e (Tc ) ,
(4)
(5)
(6)
where mc is the impulsive mass of fluid, mi - the convective mass of fluid, hi - height of wall pressure resultant
for the impulsive component, hc - height of wall pressure resultant for the convective component, hi' - height
resultant of pressures on the wall and on the base plate for the impulsive component, hc' - height resultant of
pressures on the wall and on the base plate for the convective component, given by [7]; mw - mass of the tank
wall; mb - mass of the tank base plate; mr - mass of the tank roof; hw - the height of center of gravity of wall
mass; hb - the height of center of gravity of base plate mass; hr - the height of center of gravity of roof mass.
Se(Ti) is impulsive spectral acceleration, which obtained from a 2% damped elastic response spectrum for steel
and prestressed concrete tanks, or a 5% damped elastic response spectrum for concrete and masonry tanks;
Se(Tc) - convective spectral acceleration, is obtained from a 0.5% damped elastic response spectrum.
The base shear and the moment on the foundation may be evaluated on the basis of expressions (4) and (6).
The values of the impulsive and convective masses as fractions of the total liquid mass mi and mc, the
corresponding impulsive and convective heights as fraction of the height of the liquid in the cylindrical tank
above the base hi , hc , hi' , hc' , calculated for cylindrical tanks and given by [7]; (by using of Malhotra simple
procedure for seismic analysis of liquid-storage tanks [7, 11]) may be adopted for the design of rectangular
tanks as well (with L replacing R), with an error less than 15% [11].
2.2 Housner model
We consider ground supported rectangular tank of length L and width B, where horizontal earthquake loading
is acting along length L. The spring mass model for ground supported rectangular tank is based on work of
Housner, (2, 12).
mi tanh (0.866 L H )
=
m
0.866 L H
mc
tanh (3.16 H L )
= 0.264
m
H L
hi
= 0.375 , pre H L ≤ 1.5
m
0.09375 , for
hc
cosh(3.16 H L ) − 1.0 and
H L >1.5
= 0. 5 −
=1−
m
3.16 H L sinh(3.16 H L )
H L
hi'
0.866 L H
=
− 0.125 , pre H L ≤ 1.33 and = 0.45 , pre H L >1.33
m 2 tanh (0.866 L H )
hc'
cosh (3,16 H L ) − 2,01
=1−
m
3,16 H L sinh (3,16 H L )
(7)
(8)
(9)
(10)
(11)
(12)
Equivalent masses mi and mc and heights hi , hc , hi' and hc' of accelerating liquid can be determined from eq. 7
- 12 depending on H/L ratios, where L is inside length of tank parallel to the direction of seismic force.
Time period of impulsive mode
(13)
Ti = 2 ⋅ π ⋅ d f g ,
where d is deflection of the tank wall on the vertical centre-line at a height h , when loaded by uniformly
distributed pressure q.
⎛ mi
⎞
mi
h
+ mw ⎟ g
⎜
hi + mw
2
⎝
⎠
2
, h= 2
q=
mi
Bh
+ mw
2
mw is mass of one tank wall perpendicular to the direction of seismic force, and B is inside width of tank.
Time period of convective mode of vibration, Tc in seconds, is given by
~ 103 ~
(14)
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
(15)
Tc = C c L g ,
where Cc is time period for convective mode. Value of Cc can be obtained from (16), and L is inside length of
tank parallel to the direction of seismic force.
2π
(16)
Cc =
3,16 tanh (3,16(H / L ))
Total base shear V of ground supported tank at the bottom of the wall and total base shear V’ of ground
supported tank at the bottom of base slab are given by eq. (3) and (4). Bending moment M of ground
supported tank immediately above the base plate and overturning moment M’ of ground supported tank
immediately below the base plate are given by eq. (5) and (6).
Maximum sloshing wave height is given by
d max = S e (Tc )
3
L
2
(17)
SOLUTION, RESULTS AND DISCUSSION
Let us have a ground supported rectangular endlessly long shipping channel, dimension of L = 5 m and height
Hw = 3 m. Walls have uniform thickness of 0.25 m. The base slab is h = 0.4 m thick. Shipping channel is filled
with water to the height 2.5 m. There is no roof slab on the tank. The tank is located on hard soil.
We consider only horizontál earthquake loading by using of recording of real accelerogram Loma Prieta,
California (18.10.1989) along x - direction. We consider with 1 m length of shipping channel.
Impulsive mass, convective mass and equivalent heights related to these masses, periods and height are seen
from Table 1. Resultant base shears, resultant bending moment, resultant overturning moment and maximum
sloshing wave height are seen from in Table 2.
Model
mi [kg]
mc [kg]
hi [m]
hi' [m]
hc [m]
hc' [m]
Ti [s]
Tc [s]
by Malhotra
7267
5723
1.094
1.871
1.607
2.032
0.041
2.63
by Housner
7266
6124
0.975
2.000
1.530
2.173
0.041
2.62
Table 1. Hydrodynamic parameters
Model
V [kN]
V’ [kN]
M [kNm]
M’ [kNm]
dmax [m]
by Malhotra
12.81
18.13
16.58
28.76
0.051
by Housner
12.89
18.21
15.83
30.18
0.051
divergence
0.62 %
0.44 %
4.74 %
4.94 %
0%
Table 2. Base shears, bending moments and maximum sloshing wave height
ACKNOWLEDGEMENT
This research has been supported by the Scientific Grant Agency of the Ministry of Education of Slovak
Republic and the Slovak Academy of Sciences under Project 1/0201/11.
REFERENCES
[1]
Dogangun, A., Livaoglu, R.: A comparative study of the seismic analysis of rectangular tanks according
to different codes. In: The 14th world Conference on Earthquake Engineering. China. 2008.
~ 104 ~
Proceedings of the 11th International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
URýENIE KOEFICIENTU INTENZITY NAPÄTIA V OKOLÍ
KOREĕA TRHLINY PRI I. MÓDE
Janka Kováþiková 1 and OĐga Ivánková 2
Abstract
The topic of this paper is 2D analysis of fracture parameters. Considered was a finite plate in tension with a
central crack. The aim is to compare methods of calculating and results of those methods. Modeled were various
geometries of cracks.
Key Words
fracture; parameter; crack; method
1
ÚVOD
Hlavným cieĐom mechaniky telies je navrhnúĢ konštrukciu a prvky konštrukcie tak, aby táto konštrukcia a jej
prvky boli schopné bezpeþne odolávaĢ statickým a dynamickým zaĢaženiam. V mnohých prípadoch staþí
urþenie maximálneho statického alebo dynamického napätia a navrhnúĢ konštrukciu a jej prvky tak aby vyhoveli
limitom stanoveným v normách. Tento prístup, ale nestaþí pri urþovaní mechanického správania sa telies, kde je
potrebné namodelovaĢ konštrukciu, resp. prvok už so vzniknutým defektom. Pri vyšetrovaní havárií,
spôsobených defektmi konštrukcií sa zistilo, že najviac je ich zapríþinených trhlinami. Materiály obsahujú
mikroskopické trhliny, ale problém nastane ak vznikne rozvíjajúca sa trhlina. Jej vznik môže maĢ za následok
kolaps celej konštrukcie.
Pri skúmaní podmienok vzniku porušenia konštrukcie vplyvom trhliny vznikol vedný odbor lomová mechanika.
Historicky prvý hlavný krok v urþovaní úþinkov vzniku trhlín urobil C. E. Inglish. V roku 1913 publikoval
analýzu napätia eliptického otvoru na teoreticky nekoneþne veĐkej sklenenej platni. V roku 1920 A. A. Griffith
rozšíril Inglishovu prácu. Skúmal taktiež teoreticky nekoneþne veĐkú platĖu, ale s trhlinou. Formuloval
energetické kritérium pre vznik samorozvíjajúcej sa trhliny a zistil závislosĢ medzi veĐkosĢou trhliny a napätím.
Jeho teória poskytuje zhodu s experimentálnymi meraniami na krehkých materiáloch, ale u húževnatých
materiálov vznikajú nereálne vysoké napätia v þele trhliny. Po II. svetovej vojne, v roku 1956, G.R. Irwin
rozvinul skoršie poznatky získané z prác C. E. Inglisha, A. A. Griffitha a iných. Poznatky aplikoval na húževnaté
materiály, ako oceĐ, a uvedomil si, že významnú úlohu v lome tvárnych materiálov zohráva plasticita.
V húževnatých materiáloch sa plastická zóna vyvíja v okolí koreĖa trhliny a aplikáciou zvyšujúceho sa zaĢaženia
sa táto zóna zväþšuje až kým nevznikne trhlina a materiál sa poruší. Takto dokázal súvislosĢ medzi energetickým
a napäĢovým prístupom. Definoval parameter G (hnaciu silu trhliny) ako zmenu potenciálnej energie v blízkosti
koreĖa trhliny pre lineárne- elastické materiály a aj ćalší lomový parameter K (koeficient intenzity napätia).
V roku 1968 vytvoril J. R. Rice výpoþtový model správania sa nelineárneho materiálu v blízkosti koreĖa trhliny
1
Ing. Janka Kováþiková., Katedra stavebnej mechaniky, Stavebná fakulta, STU Bratislava, Radlinského 11,
813 68 Bratislava, mail: [email protected]
2
Doc. Ing. OĐga Ivánková, PhD., Katedra stavebnej mechaniky, Stavebná fakulta, STU Bratislava, Radlinského
11, 813 68 Bratislava, tel.: 02/59274260, mail: [email protected]
~ 105 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
a definoval na základe energetického prístupu dráhovo nezávislý integrál, J-integrál. Medzitým definoval A. A.
Wells parameter CTOD (rozovretie koreĖa trhliny).
V súþasnosti prebiehajú rozsiahle výskumy ohĐadne definovania dynamických lomových parametrov, ktoré sú
spomenuté napr. v [1] a [2]. Tiež je prekukázané, že pre urþenie predpokladu rozvoja a šírenia trhliny
nepostaþuje poznaĢ len jeden lomový parameter. Na tomto základe je v súþastnosti rozpracovaná aj teória Tnapätí, ktorá definuje druhý lomový parameter ako T- napätie. Touto teóriou sa zaoberajú napr. v [3] a [4].
2
MODELOVANIE S TRHLINOU
Namodelované boli oceĐové platne s trhlinou v strede dĎžky (Obr.1a), zaĢažené napätím s hodnotou ı= 100 MPa.
Platne mali šírku b/2= 50mm s troma rôznymi dĎžkami trhlín a to: a=5mm, a=10mm, a=15mm (Obr.1b,c,d).
Materiál platne bola oceĐ s Youngovým modulom E=200 GPa a s Poissonovou konštantou Ȟ= 0.3. Na vytvorenie
geometrie a výpoþet bol použitý program ANSYS. Prvky boli zvolené 2D a to konkrétne prvky PLANE82,
ktoré umožĖujú modelovaĢ singularitu v okolí koreĖa trhliny a podporujú výpoþet lomových parametrov.
Obr 1. Schéma modelu
2.1 Metódy výpoþtu
Na výpoþet koeficientu intenzity napätia, boli použité dve metódy, ktoré poskytuje samotný program ANSYS
a tieto koeficienty boli následne porovnané aj podĐa Katalógu lomových charakteristík [5].
2.1.1 Extrapolaþná metóda
Prvá metóda, ktorá je dostupná v programe ANSYS je extrapolaþná metóda. Ide o metódu využívajúcu na
výpoþet premiestnenia. Jej výhoda oproti napäĢovému prístupu je hlavne v tom, že hodnoty premiestnení nie sú
výrazne ovplyvnené singularitami v þele trhliny. Extrapolaþná metóda pri uvážení módu I využíva na výpoþet
KIN vzĢahy:
KI
­cos ș( ț cos ș)½
®
¾
¯ sin ș( ț cos ș) ¿
I
2ȝ
2 ʌ ­°u ½°
® ¾
r ° vI °
¯ ¿
(1)
E
; ț je parameter, ktorý umožĖuje simultánne uvažovanie stavu rovinnej deformácie a napätosti;
2(1 Ȟ)
E- Youngov modul a Ȟ- Poissonova konštanta.
kde ȝ
2.1.2 Metóda J- integrálu
Druhá metóda implementovaná v programe je metóda J- integrálu. J- integrál je zovšeobecnením hnacej sily
trhliny a umožĖuje použitie aj v prípadoch plastickej deformácie väþšieho rozsahu:
~ 106 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
J
October 2013, Bratislava
d
(A U)
da
(2)
kde A je práca vonkajších síl pôsobiacich na teleso a U je deformaþné energia telesa.
Treba si však uvedomiĢ, že presnosĢ výsledkov je výrazne ovplyvnená voĐbou polohy bodu, teda vzdialenosti
bodu od koreĖa trhliny. Aby sa eliminovali nepresnosti, je potrebné poþítaĢ hodnoty K vo viacerých bodoch
a takto získané hodnoty následne spriemerovaĢ. Výsledná hodnota K sa v našom prípade, kde platia podmienky
LELM (lineárne elastická lomová mechanika), potom získa pomocou vzĢahu: K
EJ
3
ZHODNOTENIE VÝSLEDKOV
Priebehy napätí ıx a ıy získané programom ANSYS sú na Obr. 2; 3 pre všetky tri varianty geometrie
namodelovaných platní, t. z. pre platne s veĐkosĢami trhlín a=5mm, a=10mm a a=15mm.
a) a=5 mm
a) a=10 mm
a) a=15 mm
Obr 2. Priebehy napätí ıx pre platĖu s trhlinou a)a=5mm, b) a=10mm, c) a=15mm
a) a=5 mm
a) a=10 mm
a) a=15 mm
Obr 3. Priebehy napätí ıy pre platĖu s trhlinou a)a=5mm, b) a=10mm, c) a=15mm
Hodnoty koeficientov napätia sú uvedené v tabuĐke 1. a obr. 4.
a
[mm]
5
10
15
K
[N/mm2/3]
Metóda
J- integrálu
374,392528
537,3764723
697,9056451
Extrapolaþná
metóda
399,88424
579,5666878
735,065087
Tab.1. Hodnoty koeficientov intenzity napätia K
~ 107 ~
Katalóg lomových
charakteristík[5]
237,688
475,377
713,065
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Obr. 4. Grafické porovnanie hodnôt koeficientov intenzity napätia K
4
ZÁVER
V tomto príspevku boli porovnávané koeficienty intenzity napätia (KIN) troma metódami, a to konkrétne
v programe ANSYS: extrapolaþnou metódou a metódou J- integrálu a podĐa Katalógu lomových charakteristík
[5]. Najväþšie hodnoty KIN sme dostali použitím extrapolaþnej metódy. Priaznivejšie hodnoty vyšli pre druhú
metódu v programe ANSYS, metódu J- integrálu, ale len pre dĎžky trhlín a= 5mm a a=10mm. Najmenšie
hodnoty vyšli pri porovnaní s Katalógom lomových charakteristík okrem dĎžky trhliny a= 15mm. Pri porovnaní
prvých dvoch metód najväþší percentuálny rozdiel bol 7,28%. Pri porovnaní extrapolaþnnej metódy a metódy Jintegrálu s [5] sa percentuálny rozdiel pohyboval od 2,99%- 26,05%. Najväþšie rozdiely vznikli pri trhline s
a=5mm, þo je zapríþinené vznikom nezanedbateĐných plastických napätí v koreni trhliny.
LITERATÚRA
[1]
Fett, T. - Mattheck, C. - Munz, D.: On the calculation of crack opening displacement from the stress
intensity factor. Engineering Fracture Mechanics, 1987, Bde. Volume 27, Issue 6.
[2]
Xu, L. R. – Huang, Y. Y. – Rosakis, A. J.: Dynamic crack deflection and penetration at interfaces in
homogeneous materials: experimental studies and model predictions. Journal of the Mechanics and
Physics of Solids 51: Elsevier. 2003, 461-486.
[3]
Henry, B. S. – Luxmoore, A. R.: Three- dimensional evaluation of the T- stress in center cracked plate.
Int. J. Fracture 70, 1995, 35-50
[4]
SLADEK, J. - SLADEK, V. Evaulations of the T-stress for interface cracks by the boundary element
method. Engineering Fracture Mechanics. Vol. 56, No. 6: Elsevier Science Ltd. 1997. 813 - 825.
[5]
SIRATORI, M. - MIES, T. - MACUSITA, Ch. VyþisliteĐnaja mechanika razrušenia. Moskva: Mir.
1986. 334.
[6]
IVANKOVÁ, O. Vybrané problémy z lomovej mechaniky. Habilitaþná práca zo študijného odboru
aplikovaná mechanika. Slovenská technická univerzita v Bratislave , VydavateĐstvo STU. 2007. 85.
978-80-227-2681-8.
[7]
DRZIK, M. - IVANKOVÁ, O. J-integral evaluation in elasto-plastic materials by optical shadow
visualisation. Engineering Fracture Mechanics Vol. 48, No. 6: Elsevier Science Ltd.. 1994. 837-845.
[8]
KOVÁýIKOVÁ, J. – IVÁNKOVÁ, O. Vplyv poruchy na deformácie a napätia dreveného nosníka.
Juniorstav 2013, Vysoké uþení technické v BrnČ, 2013, 269
[9]
Manuál ANSYS 13.
POĆAKOVANIE
Projekt bol realizovaný za finanþnej podpory zo štátnych prostriedkov prostredníctvom Grantovej agentúry SR.
Registraþné þíslo projektu je 1/1186/12.
~ 108 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
DEFORMATION OF THE FRAME
OF COLD-FORMED MEMBERS IN FIRE
B. Kowolik1
Abstract
The deformation of the frame of cold-formed sections of steel sheets, in which the bars are connected by means
of bolts. A problem of this type of structures may be the necessity of achieving the required resistance to fire. The
paper presents an example of the deformation of a latticed frame, caused by increasing temperature due to
conflagration. The analysis includes also the effect of the rigidity of the nodes described by the function of
moment - angular displacement (M-φ) and the function of force – displacement (N-δ, V-δ) upon the values of
displacements of the nodes in the frame.
Key Words
Frame, cold-formed section, fire, node, rigidity, deformation, displacement
1
Wprowadzenie
W obecnych czasach coraz wicej projektuje si lekkich obiektów z kształtowników gitych na zimno z blach.
W konstrukcjach tych obiektów wykorzystuje si ekonomiczne przekroje zamknite, otwarte i półotwarte.
Zastosowane w nich połczenia prtów na łczniki sworzniowe umoliwiaj szybki i sprawny monta
elementów nonych konstrukcji [1]. Połczenia te charakteryzuj si podatnoci, któr naley uwzgldni
w analizie statyczno-wytrzymałociowej. Istotnym problemem przy projektowaniu konstrukcji z kształtowników
gitych na zimno jest uzyskanie wymaganej przepisami odpornoci ogniowej. Kształtowniki te charakteryzuj
si duym współczynnikiem ekspozycji na działanie poaru a ich zabezpieczenie jest bardzo trudne i kosztowne.
Z kolei ekrany lub płyty izolacji termicznej przesłaniaj ciekaw form konstrukcji, na co architekt moe nie
wyrazi zgody. W tej sytuacji jedynym rozwizaniem moe si okaza zastosowanie samoczynnych systemów
ganiczych. W referacie przedstawiono wpływ wzrostu temperatury spowodowanej poarem na deformacj
przykładowej ramy kształtowników gitych na zimno.
2
RAMA Z KSZTAŁTOWNIKÓW GITYCH NA ZIMNO
Kratow ram o rozpitoci 20,0 m (rys. 1) zaprojektowano z kształtowników gitych na zimno o ciankach
gruboci 5,0 mm opisanych na rys. 1. Zastosowano w połczeniach sworznie jednostronne typu BOM R16-6 [2],
przy czym w wle nr 1 ich liczba wynosi 8 sztuk, w wzłach 4, 12 i 21 – 6 sztuk a w pozostałych – 4 sztuki.
Wprowadzono niewspółrodkowe połczenia krzyulców z pasami rygla, które wyeliminowały blachy wzłowe
1
Bernard Kowolik, Ph.D, Silesian University of Technology in Gliwice, Faculty of Civil Engineering, Poland,
44-100 Gliwice, ul. Akademicka 5, e-mail: [email protected]
~ 109 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Rys. 1. Schemat ramy kratowej o z kształtowników gitych
z konstrukcji ramy. Konstrukcj wybranych wzłów dla ramy na rys. 1 pokazano w pracy [1]. Przekroje
poprzeczne i liczba łczników wynika z analizy nonoci prtów i wzłów [1]. Naley nadmieni, e w pracach
np. [1] i [3] przedstawiono analiz rozkładu sił wewntrznych, nonoci i sztywnoci dla rónych typów ram
w zalenoci od zdefiniowanych sztywnoci jej wzłów.
3
SZTYWNOCI POŁCZE
W analizie uwzgldniono sztywnoci połcze uzyskane na podstawie bada wykonanych przez dr hab. in.
Waltera Wuwera z Politechniki lskiej i przedstawionych w monografii [4]. W tym przypadku charakterystyka
siła S1 – przemieszczenie δ pojedynczego sworznia jest nastpujca (rys.2):
S1 = as (1 − e−bsδ ) ,
(1)
gdzie: as = 58,580 [kN], bs = 0,8456 [1/mm] a przemieszczenie δ jest wyraone w [mm].
Charakterystyk poszczególnych połcze o n liczbie łczników, obcionych siłami osiowymi, poprzecznymi
i momentami zginajcymi przy jednakowych odległociach łczników od rodka obrotu, wyznaczono ze
wzorów:
N = n S 1,
V = n S1,
(2)
n
M=
oraz
ri ⋅ S1 =n ⋅ r ⋅ as (1 − e−b rφ ) ,
s
(3)
i =1
Sztywno połczenia zaley od właciwoci fizycznych łcznika i materiału łczonego. Wobec braku bada
charakterystyki łczników omawianego typu w wysokiej temperaturze przyjto pewne załoenia. Z tablicy 6.11.
normy EN 1993-1-8 [5] wynika, e współczynnik sztywnoci k11 dla ruby cinanej zaley od wytrzymałoci
ruby fub a współczynnik sztywnoci k12 dla ruby dociskanej zaley od wytrzymałoci materiału łczonego fu.
Charakterystyki wytrzymałociowe ruby i materiału zale do temperatury. Do oblicze przyjto współczynnik
redukcyjny nonoci połczenia ks,θ jako warto redni współczynnika redukcyjnego granicy plastycznoci
stali ky,θ (tablica 3.1 w normie EN 1993-1-2 [6]) i współczynnika redukcyjnego wytrzymałoci ruby kb,θ
(tablica D1 w normie [6]). Uwzgldnione w dalszej analizie krzywe S1 – δ dla wybranych temperatur
przedstawiono na rys. 2.
4
DEFORMACJA RAMY
Obliczenia statyczne ramy wykonano za pomoc programu Autodesk Robot Structural Analysis Professional,
wykorzystujc opcj nieliniowych zwolnie prtów oraz wzłów kompatybilnych. Dla porównania wyników
analizowano nastpujce warianty ram:
~ 110 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
60
50
20oC
400oC
200oC
S1 [kN]
40
N
30
500oC
20
600oC
10
700oC
0
0
0,5
1
1,5
2
2,5
3
δ [mm]
Rys. 2. Krzywe S1 – δ w zalenoci od temperatury przyjte do analizy
- rama z wzłami sztywnymi (oznaczenie „s” na rys. 4),
- rama z krzyulcami i słupki połczonymi z pasami przegubowo oraz z przegubowym oparciem słupów na
fundamencie (oznaczenie „p” na rys.4),
- rama z wzłami podatnymi ze wzgldu na przesuwy i obrót (oznaczenie „r” na rys.4).
Konstrukcje z uwagi na warunki poarowe projektuje si przyjmujc wyjtkow kombinacj oddziaływa.
W zwizku z tym uwzgldniono obcienie stałe ciarem własnym i pokryciem, obcienie niegiem ze
współczynnikiem kombinacyjnym Ψ1 = 0,2 (zgodnie z arkuszem krajowym do normy [7]) oraz obcienie
wzrostem temperatury.
Na rys. 3 pokazano deformacje ramy. W warunkach normalnych przemieszczenie wzła nr 10 w kalenicy jest
zgodne z kierunkiem działania obcie grawitacyjnych (oznaczone na wykresach ze znakiem minus „-„) – rys.
3a. Pod wpływem wzrostu temperatury deformacja ramy powoduje przemieszczenia si wzła kierunku
przeciwnym (rys. 3b). Przy temperaturze ok. 500oC obserwuje si tendencj do zmiany kierunku przemieszcze,
tak aby powyej temperatury 600oC znów osign wartoci ujemne (rys. 3c). Spowodowane jest to znacznym
spadkiem sztywnoci prtów ramy na skutek zmniejszenia wartoci modułu sprystoci podłunej stali (patrz
Tabl. 3.1. w normie [6])
a)
b)
c)
Rys. 3. Deformacje ramy
~ 111 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Uzyskane z analizy statycznej wartoci przemieszcze pionowych wzła w kalenicy nr 10 (rys. 1) pokazano na
rys. 4. Linie przerywane dotycz odkształce ramy pod wpływem wzrostu temperatury bez uwzgldniania
obcie zewntrznych. W tym przypadku rónice w wartociach przemieszcze dla analizowanych wariantów
wynosz kilkanacie procent. Natomiast uwzgldniajc wyjtkow kombinacj oddziaływa w warunkach
poaru otrzymano ju due rónice przemieszcze. W zwizku z tym, e dla ramy z wzłami podatnych
uwzgldniono równie podatno wzłów na przesuw, otrzymano w przypadku wyszych temperatur wartoci
przemieszcze wzła 10 wiksze ni dla ramy z wzłami przegubowymi.
200
r
s
150
u10 [mm]
100
p
50
Θ [οC]
0
0
100
200
300
400
500
600
700
800
900
1000
-50
s
-100
r
p
-150
-200
Rys. 4. Wartoci przemieszcze pionowych wzła w kalenicy
5
WNIOSKI
Wykonana wstpnie w warunkach poaru analiza deformacji ramy z kształtowników gitych na zimno wykazała
istotny wpływ sztywnoci połcze sworzniowych na wartoci przemieszcze. Konieczna jest dalsza analiza
rozkładu sił wewntrznych oraz nonoci elementów, która powinna okreli odporno ogniow tego typu
konstrukcji. Naley zwróci uwag, e przepisy normowe [6] nie okrelaj sposobu wyznaczenia sztywnoci
połcze w wysokich temperaturach.
LITERATURA
[1]
Wuwer, W. – Kowolik, B.: Ramy z kształtowników cienkociennych z wzłami podatnymi. VII
Sympozjum z cyklu: „Nowe Osignicia Nauki i Techniki w Budownictwie: Kształtowanie Konstrukcji,
Konstrukcje Cignowe, Konstrukcje z Blach Fałdowych”, Rzeszów 2005, Referaty, s. 355÷366.
[2]
Aprobata Techniczna ITB, Nr AT-15-3487/99. Sworznie typu Huck, 1999.
[3]
Wuwer, W. – Kowolik, B.: Projektowanie połcze jednocitych w ramach z kształtowników gitych na
zimno. Konstrukcje stalowe, kwiecie 2009, s. 34-40.
[4]
Wuwer, W.: Podatne połczenia na sworznie jednostronne w prtowych konstrukcjach cienkociennych.
Zeszyty Naukowe Politechniki lskiej, z. 1710, Gliwice 2006
[5]
PN-EN 1993-1-8:2006. Eurokod 3: Projektowanie konstrukcji stalowych. Cz 1-8: Projektowanie
wzłów.
[6]
PN-EN 1993-1-2:2007. Eurokod 3: Projektowanie konstrukcji stalowych. Cz 1-2: Reguły ogólne –
Obliczanie konstrukcji z uwagi na warunki poarowe.
[7]
PN-EN 1991-1-2:2006. Eurokod 1: Oddziaływania na konstrukcje. Cz 1-2: Oddziaływania ogólne.
Oddziaływania na konstrukcje w warunkach poaru.
~ 112 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
PROCEDURES OF DESIGNING METAL STRUCTURES IN FIRE
IN COMPLIANCE WITH THE NATIONAL ANNEX
OF EUROCODE
B.Kowolik1
Abstract
Eurocodes suggest alternative procedures of designing structures exposed to fire. Generally, they comprise four
stages, viz. selection of the relevant design fire scenarios, determination of the corresponding design fires,
calculation of temperature evolution within the structural members, calculation of the mechanical behaviour of
the structure exposed to fire. This paper presents these procedures, paying special attention to the
determination of Polish national annex of Eurocode.
Key Words
Fire, temperature, procedures of designing, Eurocode
1
WPROWADZENIE
Ze wzgldu na to, e poar stanowi bardzo due zagroenie dla ludzi oraz mienia, Prawo budowlane i inne akty
prawne nakładaj na projektanta liczne obowizki w celu zapewnienia odpowiedniego bezpieczestwa
w przypadku powstania poaru. Zgodnie z obowizujcym Prawem budowlanym [1] kady obiekt budowlany
naley projektowa, budowa, uytkowa i utrzymywa zgodnie z przepisami techniczno-budowlanymi oraz
zasadami wiedzy budowlanej w sposób zapewniajcy spełnienie wymaga podstawowych, dotyczcych:
bezpieczestwa konstrukcji, bezpieczestwa poarowego, bezpieczestwa uytkowania, odpowiednich
warunków higienicznych i zdrowotnych oraz ochrony rodowiska, ochrony przed hałasem i drganiami,
oszczdnoci energii i odpowiedniej izolacyjnoci cieplnej przegrody.
Zgodnie z Rozporzdzeniem Ministra Infrastruktury z dnia 12 kwietnia 2002 r. (z póniejszymi zmianami)
w sprawie warunków technicznych, jakim powinny odpowiada budynki i ich usytuowanie [2] (porównaj
Przedmowy do Eurokodów oraz Dyrektyw [3]) budynek i urzdzenia z nim zwizane powinny by
zaprojektowane i wykonane w sposób zapewniajcy w razie poaru:
− nono konstrukcji przez czas wynikajcy z rozporzdzenia,
− ograniczenie rozprzestrzeniania si ognia i dymu w budynku,
− ograniczenie rozprzestrzeniania si poaru na ssiednie budynki,
− moliwo ewakuacji ludzi,
− bezpieczestwo ekip ratowniczych.
1
Bernard Kowolik, Ph.D, Silesian University of Technology in Gliwice, Faculty of Civil Engineering, Poland,
44-100 Gliwice, ul. Akademicka 5, e-mail: [email protected]
~ 113 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
2
PROCEDURY I ETAPY PROJEKTOWANIA
NA WARUNKI POAROWE
October 2013, Bratislava
KONSTRUKCJI
Z UWAGI
W procedurach projektowania konstrukcji z uwagi na warunki poarowe mona wyróni dwa podejcia:
− bazujce na poarach nominalnych, czyli tradycyjne,
− oparte na właciwociach uytkowych, posługujce si parametrami fizyko-chemicznymi rozwoju
poaru.
Okrelenie oddziaływa mechanicznych i warunków brzegowych mona przeprowadzi na podstawie:
− danych tabelarycznych, jeli s dostpne (tylko przy analizie elementu opartej na regułach tradycyjnych),
− prostych modeli obliczeniowych (jeli s dostpne),
− zaawansowanych modeli obliczeniowych.
Alternatywne procedury projektowania przedstawiono w Przedmowie do kadego Eurokodu.
Naley mie na uwadze, e czci 1-2 Eurokodów dotyczcych poarów zawieraj wyłcznie reguły róne lub
dodatkowe w stosunku do reguł projektowania przy normalnej temperaturze otoczenia.
Podane w Eurokodach wytyczne projektowania i obliczania konstrukcji w warunkach poaru dotycz tylko
konstrukcji niezabezpieczonych na działanie poaru lub zabezpieczonych rodkami biernymi. W Eurokodzie
1991-1-2 [4] zapisano, e w czciach poarowych Eurokodów Konstrukcyjnych zajto si specyficznymi
aspektami biernej ochrony przeciwpoarowej z uwzgldnieniem projektowania konstrukcji oraz ich czci
w celu zapewnienia odpowiedniej nonoci i ograniczenia rozprzestrzeniania si poaru. Eurokod nie ingeruje
w ogólnobudowlane przepisy ochrony przeciwpoarowe (np. podziału na strefy poarowe, lokalizacji wyj
ewakuacyjnych czy stosowania instalacji zraszajcych systemów ganiczych), pozostawiajc je w gestii innych
aktów prawnych o wymiarze europejskim lub krajowym. Eurokody nie słu ocenie stanu konstrukcji po
poarze.
Etapy projektowania konstrukcji na warunki poarowej pokazano na rys. 1.
Rys. 1. Etapy projektowania konstrukcji z uwagi na warunki poarowe
3
SCENARIUSZ POAROWY A POAR OBLICZENIOWY
Zgodnie z definicj podan w Eurokodzie PN-EN 1991-1-2 [4] scenariusz poarowy to jakociowy opis
przebiegu poaru w czasie, podajcy kluczowe zdarzenia, które charakteryzuj poar i odróniaj go od innych
moliwych poarów. Typowy scenariusz opisuje proces zapalenia i rozwoju poaru, faz pełnego rozwoju, faz
zaniku oraz charakteryzuje rodowisko budowlane i systemy które wpływaj na przebieg poaru. Wymaga si
tutaj od projektanta bardzo dobrej znajomoci inynierii poarowej. Natomiast obliczeniowy scenariusz
poarowy to okrelony scenariusz poaru na podstawie którego bdzie przeprowadzana analiza. Do kadego
obliczeniowego scenariusza poarowego przyjmuje si odpowiedni poar obliczeniowy.
W załczniku krajowym NA do normy PN-EN 1991-1-2 [4] zalecono „przy przyjmowaniu temperatury gazów
g, stosowanie nominalnych krzywych temperatura-czas (…) lub zaawansowanych naturalnych modeli poaru
opartych na modelach numerycznej mechaniki płynów” (patrz NA.2 [4]). Nie zaleca si stosowania
uproszczonych modeli poaru, jeeli w polskich przepisach techniczno-budowlanych nie zostan wprowadzone
inne postanowienia (patrz NA.3 [4]). Natomiast w punkcie NA.1 [4] podano: „zaleca si, przy analizie
temperatury w elemencie, stosowanie przedziałów czasu podanych w polskich przepisach techniczno-
~ 114 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
budowlanych, wykorzystujc nominaln krzyw temperatura-czas, jeeli w polskich przepisach technicznobudowlanych nie zostan wprowadzone inne postanowienia”.
4
ANALIZA TEMPERATURY
W Eurokodzie PN-EN 1993-1-2 [5] podano sposób wyznaczenia temperatury elementów stalowych dla trzech
przypadków, w których s one (p. 4.1(1) [5]): nieosłonite, osłonite materiałami izolacji ogniochronnej,
chronione ekranami cieplnymi. Schematy wyznaczenia temperatury w przekroju niesłonitym i osłonitym
izolacj przedstawiono w pełnej wersji referatu.
W Załczniku krajowym NA.1 normy PN-EN 1991-1-2 [4] zaleca si, „przy analizie temperatury w elemencie,
stosowanie przedziałów czasu podanych w polskich przepisach techniczno-budowlanych wykorzystujc
nominaln krzyw temperatura-czas, jeeli w polskich przepisach techniczno-budowlanych nie zostan
wprowadzone inne postanowienia”.
5
ANALIZA MECHANICZNA
Poar przy projektowaniu konstrukcji budowlanych jest traktowany w normach europejskich jako wyjtkowa
sytuacja obliczeniowa. Eurokod oraz arkuszu krajowy:
− zaleca przy ustalaniu odpowiednich efektów oddziaływa w wyjtkowej sytuacji obliczeniowej jak jest
poar, wyznaczajc kombinacj oddziaływa mechanicznych, uwzgldnia czst warto 1,1 Q1 jako
reprezentatywn warto oddziaływania zmiennego Q1 (arkusz NA),
− nie zaleca redukcji obcie spowodowanych operacjami przemysłowymi (p. 4.2.1 (3) normy [4]),
− nie wymaga uwzgldnia oddziaływa wynikajcych z operacji przemysłowych (p. 4.2.1 (5) normy [4]),
− zaleca uwzgldnienie oddziaływania spowodowanego uderzeniem na skutek zniszczenia elementów
konstrukcyjnych lub/i cikich maszyn (NA 6 normy PN-EN 1991-1-2 [4]),
− zaleca uwzgldnienie czst warto obcieniem niegiem (NA 6 normy PN-EN 1991-1-2 [4]); w czci
głównej poddano spraw obcienia niegiem w czasie poaru pod rozwag projektanta.
Ocen bezpieczestwa poarowego konstrukcji lub jej elementów mona przeprowadza według jednego
z trzech kryterium: czasu, nonoci, temperatury. Schemat postpowania w przypadku zastosowania kryterium
nonoci przedstawiono na rys. 2 [7].
Odporno ogniow wyznacza si korzystajc:
− z danych tabelarycznych,
− z prostych modeli obliczeniowe dla elementu,
− z zaawansowanych modeli obliczeniowych dla elementu, podukładu lub całej konstrukcji,
− z bada dowiadczalnych.
W Załczniku krajowym NA.4 normy PN-EN 1993-1-2 [5] zapisano, e decyzja co do stosowania
zaawansowanych modeli obliczeniowych powinna by uzgodniona midzy inwestorem i projektantem na etapie
załoe projektowych.
Zgodnie z punktem 2.4 w normach poarowych analiza moe dotyczy elementu, podukładu konstrukcji, całej
konstrukcji. Zgodnie z uwag 2 do punktu 2.4.1 normy PN-EN 1993-1-2 [5] w przypadku weryfikacji wymaga
zwizanych z poarem normowym, wystarczajco miarodajna jest analiza elementu.
6
WNIOSKI
Eurokody przedstawiaj róne cieki postpowania przy projektowaniu konstrukcji z uwagi na warunki
poarowe. Mona stwierdzi, e tylko niektóre z nich (a czsto tylko jedna) s na tyle proste i stosunkowo
dobrze opisane, aby mógł z nich skorzysta projektant, który nie ma przygotowania w zakresie inynierii
poarowej i bardziej zaawansowanych metod oblicze mechaniki konstrukcji. Dlatego te w ramach realizacji
dwóch pierwszych etapów projektowania konstrukcji z uwagi na warunki poarowe, tj. wyboru właciwego
scenariusza poarowego i odpowiadajcych im poarów obliczeniowych, przyjmuje si krzyw standardow
temperatura gazu-czas. Takie postpowania zalecaj równie polskie arkusze krajowe Eurokodów. Przyjcie
zawansowanych (naturalnych) modeli poarów bdzie wymagało sporego nakładu pracy, wykorzystania
odpowiedniego programu komputerowego i niejednokrotnie konsultacji z inynierem poarnictwa. Kolejny etap
projektowania dotyczy ustalenia temperatury w elementach. W tym przypadku mona korzysta np.
z przygotowanych tablic i nomogramów opracowanych dla konkretnej izolacji ogniochronnej. Analiza
mechaniczna jako ostatni etap projektowania konstrukcji z uwagi na warunki poarowe, równie nie powinna
stwarza problemów, jeeli zostanie ograniczona do elementu konstrukcyjnego. Wówczas warunki nonoci
ustalone dla normalnej temperatury, zgodnie z podstawowymi czciami Eurokodów, s modyfikowane
~ 115 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
/:;<>[email protected]?:E;BEGCDEHBCE>AJD>[email protected][email protected]
BEBEGC
K<BAMDD:;@AN;QJDST<UE>VXD
SGYAZ<TDST<[email protected]
[email protected]<\V><BC<X
N;@V><DTAZ:A;<T^;<DH<@^_ G@<SD >VZ<H<B<DE?:E;BEDEHBCE><D
c;@AN;QJD
ES\EBCTV
c;@VJGCADZ<TA;C<\[email protected]<GJCDEHBCEGY;EBBAJ
[email protected]<[email protected][email protected]<\V><D>DSVT^<GJCD
:E<;E>AJD
c;@VJGCADH;[email protected]<GJCD
[email protected]<[email protected]:A;<T^;VDD
AUAZABT^DDST<UE>AHED :;@VD>VZ<H<BAJDE?:E;BEGCD
[email protected]<[email protected]:A;<T^;VDDAUAZABT^DD
ST<UE>AHED :;@VD>VZ<H<BAJD
E?:E;BEGCD
[email protected]><D><;TEDBEBEGCDAUAZABT^D
>DTAZ:A;<T^;@AD [email protected]><D><;TEDE?:E>CA?BCAHED
[email protected]<\V><D > SVT^<GJCD
:E<;E>AJ
x
_h<STESE><[email protected]<GJDjJAAUCDBCADbV\<D:;EJANTE><B<q
_ h>[email protected];[email protected]<GJC
_hZCABCD;E?@<JDZ<TA;C<\[email protected]<GVJBAHED
vUAZABTD@<:;EJANTE><BVD:E:;<>[email protected]^><HCDB<D
><;^BNCD:E<;E>A
Rys. 2. Schemat sprawdzania odpornoci ogniowej w dziedzinie nonoci [4]
z uwzgldnieniem właciwoci mechanicznych materiałów w podwyszonych temperaturach. Dla obiektów
nietypowych (np. wysokich budynków) konieczna moe okaza si bardziej zaawansowana analiza konstrukcji
z uwagi na warunki poarowe. Wówczas jednak powołuje si zespoły midzybranowe, w skład których
powinien wchodzi kompetentny inynier poarnictwa.
LITERATURA
[1]
Ustawa z dnia 7 lipca 1994 r. Prawo budowlane (tekst jednolity z póniejszymi zmianami).
[2]
Rozporzdzenie Ministra Infrastruktury z dnia 12 kwietnia 2002 r. w sprawie warunków technicznych,
jakim powinny odpowiada budynki i ich usytuowanie. (tekst jednolity z póniejszymi zmianami).
[3]
Dyrektywa 89/106/EEC z 21 grudnia 1988 r. Rady Wspólnot Europejskich w sprawie zblienia ustaw
i aktów wykonawczych Pastw Członkowskich dotyczcych wyrobów budowlanych, ITB,Warszawa 1994.
[4]
PN-EN 1991-1-2:2006. Eurokod 1: Oddziaływania na konstrukcje. Cz 1-2: Oddziaływania ogólne.
Oddziaływania na konstrukcje w warunkach poaru.
[5]
PN-EN 1993-1-2:2007. Eurokod 3: Projektowanie konstrukcji stalowych. Cz 1-2: Reguły ogólne –
Obliczanie konstrukcji z uwagi na warunki poarowe.
[6]
PN-EN 1990:2004. Eurokod: Podstawy projektowania konstrukcji.
[7]
Kowolik, B.: Projektowanie konstrukcji metalowych z uwagi na warunki poarowe. Referat zamówiony
na XXVII Ogólnopolskie Warsztaty Projektanta Konstrukcji „Nowoczesne rozwizania konstrukcyjnomateriałowo-technologiczne. Konstrukcje metalowe”. Szczyrk 7-10 marca 2012 r, tom III, s.241-350.
~ 116 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
NUMERICKÉ METÓDY PRE RIEŠENIE SPO'AHLIVOSTI
KONŠTRUKCIÍ
J. Králik1 a M. Klabník2
Abstract
The aim of this work was to demonstrate the benefits of using probabilistic analysis to deterministic analysis.
Direct integration method of Monte Carlo - Direct Sampling was used in the calculation. Calculation
significantly highlights the main disadvantage of this method - particularly high number of simulations in
determining ( in the required accuracy of calculation ). Three calculations were made with the number of
simulations 100, 1000, 10000
Kúové slová
Pravdepodobnostné metódy; Spo!ahlivos"; Monte Carlo; Priehyb; Napätie
1
ÚVOD
Pravdepodobnos poruchy je možne vyjadri vo forme integrálu , ak je odpor konštrukcie R a úinok zaaženia
E. Všeobecná integrálna formulácia neplatí pre veký poet obecných konštrukcií , napríklad pre staticky
neurité konštrukcie a konštrukcie s nelineárnym správaním ako je teória 2. rádu alebo plastické výpoty.
V takomto prípade , problematika spoahlivosti stavebných konštrukcii už nie je len problematika dvoch
náhodných veliín. Pre definovanie medzných stavov konštrukcie je potrebné uri viacero náhodných veliín
medzi ktorými môže existova štatistická závislos . Pre prípad medzných stavov je vhodné vyjadrenie
pravdepodobnosti poruchy vo forme integrálu funkcie združenej hmoty. Zložitá priama integrácia, obzvláš
problematická pre problémy viacero náhodných veliín , bola nahradená a približnými metódami pre praktické
riešenia úloh .
Vo všeobecnosti možno rozdeli" približné pravdepodobnostné metódy na dve základné skupiny :
1. simulané metódy založené na metóde Monte Carlo
2. aproximané simulané metódy
2
METÓDA TYPU MONTE CARLO
Je numerická metóda , ktorá používa náhodné realizácie vstupných dát. Vstupné veliiny je potrebné generova
poda ich teoretického modelu rozdelenia pravdepodobnosti. Generovaniu náhodných veliín predchádza
generovanie náhodných ísel z intervalu 0 až 1.
1
Prof. Juraj Králik, Ph.D, Faculty of Civil Engineering, Slovak University of Technology in Bratislava, 813 68
Bratislava, Radlinského 11, telephone : +421.2.59 274 690 , e-mail. : [email protected]
1
Ing. Maroš Klabník, Faculty of Civil Engineering, Slovak University of Technology in Bratislava, 813 68
Bratislava, Radlinského 11, telephone : +421.2.59 274 206 , e-mail. : [email protected]
~ 117 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
2.1 Generátor náhodných ísel a pseudonáhodné ísla
Generátor náhodných ísel na intervale 0 – 1 je bežná súas programovacích jazykov. Poväšine ide o lineárne
konfigurané generátory. Závisia od spôsobu zobrazovania náhodných ísle na poítai. Sekvencia náhodných
ísel sa po uritom intervale opakuje. Tieto generátory sa tiež nazývajú generátory pseudonáhodných ísiel
z intervalu 0 až 1.
Pseudonáhodné ísla sú ísla vytvárajúce postupnos , ktorá vyzerá ako náhodná ale v skutonosti je generovaná
deterministickým algoritmom (algoritmus, ktorý na rovnaké poiatoné podmienky reaguje vždy rovnako
a v každom jeho kroku je vždy jednoznane definovaný i nasledujúci krok). Predpona pseudo- sa používa pre
rozlíšenie tohto typu náhodných ísel od „skutone náhodných ísel “, ktoré vznikajú ako výsledok náhodných
fyzikálnych procesov. Pre generovanie skutoných náhodných ísel je v poítai potrebný hardwarový generátor
, ktorý môže by založený na meraní šumu polovodiového prechodu. Postupnos generovania náhodných ísel
je periodická , po uritej vemi dlhej dobe sa opakuje. Pre zvýšenie kvality pseudonáhodných ísel existujú
rôzne štatistické testy , ktorými sa zisuje i rozdelenie jednotlivých ísel vyhovuje zadaniu, i sú jednotlivé
leny navzájom nezávislé , poetnos výskytu rôznych pravdepodobnosti.
!xi(xi )
1
uij
0
xij
xj
Obr. 1. Postup pre generovanie náhodných ísel metódou Monte Carlo
2.2 Klasická metóda Monte Carlo
Vo svojom pôvode je táto metóda oznaovaná ako klasická , priama , jednoduchá. Názornos blízka
inžinierskemu mysleniu. Reálne simuluje chovanie konštrukcie. Postup metódy spoíva v numerickej simulácii
riešeného problému - v opakovanom riešení funkcie poruchy g(X) vždy s iným náhodne generovaným vektorom
vstupných náhodných veliín X. jednotlivé kroky simulácie sú nasledovné ( vždy popisujeme obecne j-tu
simuláciou , j=1,2,... N, kde N je celkový poet simulácií )
Formálny matematický vzah pre pravdepodobnos funkcie poruchy možno formulova pomocou funkcie
a pre X patriacej do oblasti poruchy ( pre
) , v prípade ak
nadobúda funkcia
nulové hodnoty
. Integrálny vzah pre pravdepodobnos poruchy možno napísa ako
(1)
kde
je oblas integrácie cez všetky X. Numericky je vzah riešený pomocou sumácie.
(2)
Odhad pravdepodobnosti závisí od celkového potu simulácií a ráde odhadovanej pravdepodobnosti. &ím je
, tým je odhad realistickejší. Pravdepodobnos poruchy je tiež náhodná veliina a jej
väšia hodnota N a tiež
odhad predstavuje uritú realizáciu náhodnej veliiny . Ak zmeníme zdrojové ísla náhodných veliín dostaneme
trocha iný odhad. Varianý koeficient pravdepodobnosti poruchy sa môže pre malé pravdepodobnosti zapísa
v tvare:
(3)
~ 118 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Ak odhadujeme pravdepodobnos poruchy rádu
a použijeme N =
je varianý koeficient
pravdepodobnosti 10 % . V stavebnej praxi sa stretávame s malými pravdepodobnosami. K odhadu
pravdepodobnosti je nutné uskutoni veký poet simulácií MC, ktoré silne obmedzujú použitie tejto metódy.
•
o
3
o
o
Výhody :
Výsledné hodnoty rezervy spoahlivosti (alebo funkcie odozvy) možno priebežne zobrazova vo forme
histogramov alebo kumulatívnej distribunej funkcie
Zrozumitenos a názornos
Je možné odhadnú štatistickú chybu odhadov na uritej hladine významnosti
•
o
o
Nevýhody :
Veký poet simulácií pre malé pravdepodobnosti
Pomalí výpoet pre komplikovanejšie komplexné problémy
POSÚDENIE MAXIMÁLNEHO NAPÄTIA A PRIEHYBU DOSKY
Pravdepodobnostné posúdenie dosky oceovej dosky bolo realizované prostredníctvom výpotového programu
Ansys. Na výpoet bola použitá doska s rozmermi 100 x 100 mm. Oceový plech mal hrúbku 1 mm a v strede
bol zaažený silou 100 kN. Za premenné vstupné parametre boli zvolené : džka , hrúbka, Yangov modul
pružnosti , a hustota. Pravdepodobnostné vstupné veliiny boli zadefinované vo forme histogramov poetnosti.
Sledované boli premenné výstupné parametre maximálny priehyb a maximálne ekvivalentné napätie. Ako
pravdepodobnostná metóda bola zvolená priama metóda typu Monte Carlo. Výpoet sa realizoval tri krát
s rôznym potom simulácii a to 100 , 1000 a 10000 simulácii.
3.1 Modelovanie problému
K modelovaniu dosky bol využitý prvok z knižnice Ansys. Ide o prvok Shell 63. Prvok je 8 uzlový so šiestimi
stup(ami vonosti v každom bode.
Obr. 2. Prvok Shell 63 a výpotový model
Oceový plech má rozmery 100 x 100 mm a hrúbku 1 mm. Džka a hrúbka sú premenné vstupné veliiny.
Zadefinované vo forme histogramu s log normálnym priebehom. Po dvoch rovnobežných okrajoch je kbovo
podopretý.
Tab. 1 a 2. Použité materiálové charakteristiky a
prvky programu Ansys
~ 119 ~
Obr. 3. Histogram poetnosti náhodnej vstupnej
veliiny - hustota
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Tab. 3 . Použité histogrami poetnosti
3.2 Výpoet a výsledky
V programe Ansys boli realizované 3 pravdepodobnostné výpoty. Použitá bola priama integraná metóda typu
Monte Carlo.
Tab. 4 . Nastavenie pravdepodobnostné riešia
Výsledky analýzy boli spracované na troch rôznych úrovniach. Vyhodnotenie v tabuke , pomocou histogramov
poetnosti jednotlivých výstupných veliín a citlivostnou analýzou . Ako sa javí prvé dve simulácie nevykazujú
dostatonú presnos, preto možno konštatova ,že poet simulácii 100 a 1000 je v prípade priamej integranej
metódy Monte Carlo.
4
ZÁVER
Cieom práce bolo poukáza na výhody použitia pravdepodobnostnej analýzy voi deterministickej analýze. Vo
výpote bola použitá priama integraná metóda typu Monte Carlo – Direct Sampling . Výpoet znane
poukazuje na hlavnú nevýhodu tejto metódy a to hlavne vo vysokom pote simulácii pri stanovenej požadovanej
presnosti výpotu. Boli realizované tri výpoty s potom simulácií 100 , 1000 , 10000. &o sa týka
zrozumitenosti metódy pre inžiniersky prístup k problému je vemi výhodná . Nevýhodnou sa stáva z hadiska
asovej náronosti výpotu, preto aj priama integraná metóda typu MC je dnes využívaná minimálne a je
nahrádzaná modifikovanými obmenami. Citlivostná analýza poskytuje obraz o správaní sa konštrukcie a otvára
dvere k riešeniu optimalizácie.
POAKOVANIE
Projekt bol realizovaný za pomoci finan#nej podpory zo štátnych prostriedkov Grantovej agentúry Slovenskej
republiky. Registra#ní #íslo projektu je VEGA 1/0740/11.
LITERATÚRA
[1] Králik,J.: Safety and Reliability of Nuclear Power Buildings in Slovakia. Earthquake-Impact-Explosion.
[2]
[3]
Monograph. Published by STU Bratislava, 2009, 307pp. ISBN 978-80-227-3112-6.
Králik,J.-Králik,J.,jr.: Seismic Analysis of Reinforced Concrete Frame-Wall Systems Considering
Ductility Effects in Accordance to Eurocode. Engineering Structures. Elsevier 2009, ISSN 0141-0296,
Vol.31, Issue 12, pp. 2865 - 2872, December 2009.
Králik,J.-Králik,J.,ml.: Deterministický a pravdepodobnostný prístup k posudzovaniu spoahlivosti
výškových stavieb. Stavebné a environmentálne inžinierstvo, ŽU Žilina, ISSN 1336-5835, 2007, ro. 3,
.1, s.12-27.
~ 120 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
PROPERTIES OF STEEL REINFORCED POLYMERS
IN COMPARISION WITH OTHER FIBER REINFORCED
COMPOSITES
R. Krzywon1
Abstract
Steel reinforced polymers are relatively new composites based on ultra-high strength steel wires formed in cords
and assembled into a fabric in a polymeric (SRG) or cementitious matrix (SRP). They have excellent tensile
strength in the direction of the fibers, comparable with Carbon FRP polymers. Also flexibility and weight ratio is
similar to fiber composites rather than steel. Thankfully to that phenomena strengthening with use of SRP and
SRG composites usually is designed with use of well known procedures developed for CFRPs, neglecting the
nonlinear stress - strain relationship. The paper provides a discussion of the correctness of the assumption on
the basis of original stress ± strain curve and gives some recommendations for the design.
Key Words
steel reinforced polymers; elasticity, strengthening of structures.
1
INTRODUCTION
Based on ultra-high tensile strength steel (UHTS) reinforcement tapes SRP (Steel Reinforced Polymer) and SRG
(Steel Reinforced Grout) are representing a relatively new branch of composite materials. They can achieve
tensile strength comparable only with carbon fibers. Reinforcing steel wires are based on the same perlite steel
used for making the reinforcement of automotive tires. Twisting of wires into the strands creates mechanical
interlock between concrete and steel and additionally integrates filaments. On the other side, a disadvantage of
the twisting is a slight reduction of the mechanical properties.
To control the density of the cords (number of cords per centimeter of width), unidirectional tendons are joined
by knit yarns forming a fabric. Linked fabric can be stretched or bent, without losing its integrity. Mechanical
properties are dependent on the density of filaments, they can be spaced up to 6mm, what additionally allows for
the use of a wide range of matrices with different viscosity: from high viscosity epoxy resins to the cementitious
mixtures.
As the most of FRP reinforcing materials, also SRP/SRG composites characterize excellent tensile strength in
the direction of the filaments and negligible strength in the transverse direction. UHTS steel is about 5 times
stronger than B500C steel commonly used as standard reinforcement. UHTS steel is also more ductile than other
³WUDGLWLRQDO´RUJDQLFFRPSRVLWHV
Steel is compatible with most of the organic (thermo±set and thermoplastics) and inorganic matrices, what
allows the impregnation with cementitious paste, reducing material costs, enhancing the fire resistance. The use
of cement matrix extends the possibilities of the use in historical buildings.
1
Dr. R. Krzywon, Silesian University of Technology, Akademicka 5, 44-100 Gliwice, Poland, tel. +48
322372262, [email protected]
~ 121 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Another important aspect in terms of the cost and easiness of application, is the weight of the laminate.
Composites based on steel wires are, in dependence of filaments density, up to five times lighter than steel. The
execution of FRP usually requires former surface preparation to assure a correct bond. In case of application of a
cementitious matrix, it may play a UROHRI ³UHJXODUL]LQJ´ PRUWDU so there is no necessity for use of additional
leveling layer.
2
STRESS-STRAIN RELATIONSHIP APPROPRIATE FOR DESIGN
Actual tests show a very similar behaviour of SRP and CFRP specimens under the flexure [1]. It means, that
principles for the design of RC elements strengthened with CFRP may be also used for SRP materials. Initially
the behavior of SRP composite is similar to other high carbon cold drawn steels (for example prestressing steel):
there is no perfect plasticity at yield stress level and ideal elasticity to the moment of rupture. Inelastic behavior
of SRP laminate may be described with use of parabolic function. On the basis of the test of six specimens made
of fabrics with two densities (12 and 20 cords/inch) based on the most popular 3SX cord type following formula
was proposed to describe SRP stress train relationship.
V srp
4
212000H srp 4730H srp
(1)
Stress-strain nonlinearity means in the design the necessity of degradation of modulus of elasticity. For
observed, ultimate strain around 2%, secant modulus decreases about 19% in comparison to the initial one.
General principles for the analysis of CFRP strengthening are based on assumption of ideal elasticity, question
is: how the changes in the elasticity of UHTS may affect the results of bearing capacity analysis and deflection
control. On the basis of well-known EC2 design procedures [2], modified by the dependence (1) some
calculations of beams were made for various strengthening to concrete area ratio.
As can be supposed, decreasing of the elasticity of SRP strengthening tape enlarges the section rotation. In the
ultimate situation it means the decrease of the height of concrete compression zone and the rise of maximum
compressive stress ± finally slight reduction of flexural bearing capacity is observed usually in comparison with
model based on constant modulus of elasticity, equal 200GPa. Similarly, up to a few percent difference may be
expected in the analysis of deflection.
3
CONCLUSIONS
Paper shows a new composite material, based on UHTS steel, in flexural strengthening of rectangular reinforced
concrete beams. Mechanical properties of SRP are competitive to carbon fiber composites. The authors are in
the process of comparative tests of beams strengthened with SRP and CFRP composites.
SRP strengthening may be effectively designed with use of well-known procedures developed for CFRP
materials. Nonlinear stress strain relationship may be taken into the account only when precise analysis is
required, for normal situation assumption of linear elasticity seems to be sufficient, if modulus of elasticity is
reduced to the 200GPa.
ACKNOWLEDGEMENT
Research program partly supported by the National Science Centre of Poland and the EU project INSYSM
(according to the contract number: IAPP-2009-251373).
REFERENCES
[1]
Mitolidis G., Salonikios T., Kappos A.: Test results and strength estimation of R/C beams strengthened
against flexural or shear failure by the use of SRP and CFRP, Composites: Part B 43 (2012) pp. 1117±
1129.
[2]
Gorski M., Krzywon R.: Polish standardisation proposal for design procedures of FRP strengthenings.
Proceedings of the 8th international conference FRPRCS 2007, Patras, Grece 2007, pp 552-554.
~ 122 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
Analýza tenkých desek metodou sítí a výpoetní náronost úlohy
J. Kubošek1 a O. Sucharda2
Abstract
The paper describes the analysis of thin slabs. The method used for the analysis is the finite differences method.
Matlab was used for the algorithmising of the task. The paper includes two computational tasks. Two
alternatives are described for the second task. Complexity in terms of time is compared for various detailed
solutions and for the methods of the system of linear equation solution.
Klíová slova
Metoda sítí; tenké desky; analýza; deformace
1
ÚVOD
Cílem píspvku je provedení analýzy tenké desky metodou sítí. Pro analýzu jsou zvoleny pr%hyby a mrné
ohybové a krouticí momenty. Výpoet byl algoritmizován a proveden v programu Matlab [6], pro kontrolu a
srovnání výsledk% byl použit program Scia Engineering 2012 [7]. Jeden z dalších možných pístup% k
algoritmizaci inženýrských uvádí [5]. Dalším cílem bylo porovnat vybrané metody výpotu soustav lineárních
rovnic [3] v závislosti na hustot sít. Pro porovnání byly vybrány dv pímé metody a dv vnitní funkce
programu Matlab [6].
2
METODA SÍTÍ
Pro analýzu tenkých desek je zvolena metoda sítí. Metoda se také asto oznauje jako diferenní. Vytvoený
algoritmus pedpokládá, že ešená konstrukce spl(uje podmínky dle Kirchoffovy teorie [1, 2]. Neznámou
promnou pi ešení desky je pr%hyb w, který lze získat ešením deskové rovnice:
∂4 w
∂4 w ∂4 w p
+
+
=
2
∂x 4
∂x 2 y 2 ∂y 4 D
(1)
kde w je funkce pr%hybu desky, p je velikost zatížení a D je desková tuhost.
Základní princip metody sítí je založen na rozdlení konstrukce na uzly a postupná úprava deskové diferenciální
rovnice (1) pomocí diferenních náhrad na systém lineárních rovnic pro uzlové hodnoty pr%hybu. Pro vytvoení
soustavy rovnic bylo využito diferenního schématu, které pro každý bod sít definuje jeho okolí a tím umož(uje
tvorbu soustavy lineárních rovnic. K výpotu byl použit tzv. redukovaný pr%hyb, který závisí na skuteném
pr%hybu, dle vztahu:
1
Jan Kubošek, VŠB – TU Ostrava, Fakulta stavební, Katedra stavební mechaniky, L. Podéšt 1875/17, CZ 708
33 Ostrava Poruba, [email protected]
2
Ing. Oldich Sucharda, Ph.D., VŠB – TU Ostrava, Fakulta stavební, Katedra stavební mechaniky, L. Podéšt
1875/17, CZ 708 33 Ostrava Poruba, tel.: (+420) 597 321 391, [email protected]
~ 123 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
W=
October 2013, Bratislava
D
⋅w
a ⋅b
(2)
kde a a b jsou vzdálenosti mezi uzly sít (diferenní krok), D je desková tuhost a w je skutený svislý posun
bodu sít (pr%hyb). Pi použití redukovaného pr%hybu se pravá strana diferenní rovnice pro jednotlivé body
rovná:
P = p ⋅ a ⋅b + F
(3)
kde F je hodnota osamlého bemena p%sobícího v uzlovém bod. Jelikož pro diferenní schéma je poteba
13 okolních bod%, které mohou pesahovat okraje desky, je nutné tyto vnjší body definovat pomocí okrajových
podmínek.
3
NUMERICKÝ P#ÍKLAD
Analyzovaná betonová deska ešená metodou sítí je po obvod prost uložena a je zatížena rovnomrným
zatížením p = 50 kNm-2. Rozmry desky jsou b = 5 m, l = 5 m, tlouška desky h = 0,3 m, statický modul
pružnosti E = 30 GPa a Poisson%v souinitel je 0,2. Výpoet je proveden pro 20 vnitních bod%.
Maximální vypotené hodnoty pr%hybu byly w = 1,7958 mm, ohybové momenty mx = my = 54,943 kNm
a krouticí momenty mxy = ±45,647 kNm. Pro kontrolu výsledk% z programu Matlab [6] byl proveden výpoet
také programu Scia Engineer [7]. Vypotené hodnoty pr%hybu se odlišovaly málo a byly w = 1,792 mm,
ohybové momenty mx = my = 54,51 kNm a krouticí momenty mxy = ±43,63 kNm. K ilustraci výsledk% jsou
použity prostorové grafy na Obr. 1.
Obr. 1. Výsledky pr%hybu a vnitních sil plošnými grafy pro 20 vnitních bod%
4
SROVNÁNÍ METOD VÝPO(TU SOUSTAV LINEÁRNÍCH ROVNIC
K ešení soustav lineárních rovnic se využívá maticového potu, kdy celou soustavu rovnic lze zapsat zkrácen
v maticovém tvaru:
A⋅ x = b
(4)
kde: A je matice soustavy (levé strany rovnic), b je vektor pravých stran a x je vektor hledaných koen%
soustavy.
~ 124 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Srovnání bylo provedeno pro tyi metody:
• pímé: Gauss-Jordanova metoda a LU rozklad,
• funkce Matlabu: dlení ( x = b A ) a výpoet pomocí inverze ( x = b −1 ⋅ A ).
Do srovnání byla rovnž zahrnuta promnlivost velikost sít, a s tím související poet lineárních rovnic.
Upravený algoritmus postupn mní velikost sít a mí dobu pr%bhu jednotlivých výpot%. K srovnávacím
výpot%m je zvolen ilustraní píklad desky, která je na všech stranách vetknuta a je zatížena rovnomrným
zatížením 25 kNm-2. Rozmry desky jsou l = b = 6 m, tlouška desky h = 0,35 m, modul pružnosti E = 30 GPa
a Poisson%v souinitel je 0,2. K ilustraci výsledk% jsou použity plošné grafy na Obr. 2.
Obr. 2. Výsledky pr%hybu a vnitních sil pro 35 vnitních bod%
Obr. 3. Srovnání délky bhu jednotlivých metod v závislosti na
velikosti ešené matice (árkované spojnice náleží pravé svislé ose)
~ 125 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Obr. 4. Srovnání délky bhu jednotlivých metod v závislosti
na velikosti ešené matice (hustota vnitní sít 50 – 100)
Pro grafické porovnání Obr. 3 bylo provedeno 5 cykl% výpot% s hustotou sít od 5 do 50 vnitních bod%.
Hodnoty z jednotlivých cykl% byly zpr%mr(ovány a vyneseny do grafu. Maximální as byl nastaven na
60 sekund. Pro bližší porovnání funkcí programu Matlab [6], byly tyto funkce porovnány pro hustoty sít od 50
do 100 vnitních bod% na Obr. 4.
5
ZÁV$R
K analýze tenkých desek je možné využít vytvoeného algoritmu v programu Matlab [6], který je založen
na metod sítí. Vyhodnocovanými veliinami mohou být pr%hyb desky nebo vnitní síly. Správnost výpotu byla
ovena porovnáním výsledk% v programu Scia Engineer [7]. Podrobnosti k vytvoenému algoritmu uvádí [4].
Z porovnání namených asových hodnot metod ešící soustavy lineárních rovnic a vyhodnocení graf%
porovnávající tyto hodnoty, lze usoudit, že z pímých metod je výhodnjší metoda LU rozkladu než metoda
Gauss-Jordanova. Pro menší matice je ovšem výhodnjší metoda Gauss-Jordanova. Za nejrychlejší lze oznait
pímé dlení matic v programu Matlab [6]. Pro menší soustavy rovnic, pibližn do matic velikosti 1600, lze
pímé metody použít. Pro ešení vtších matic nejsou tyto metody dostaten optimalizovány a nejsou schopny
v reálném ase podat výsledek. Jelikož je matice soustavy ídká, každý ádek matice obsahuje maximáln 13
hodnot, je vhodné pi optimalizaci výpotu této vlastnosti využít.
POD$KOVÁNÍ
&lánek vznikl za podpory projektu Studentské grantové soutže VŠB-TU Ostrava. Registraní íslo projektu je
SP2013/99.
LITERATURA
[1]
BAREŠ, R. Tabulky pro výpo#et desek a st$n. 3. nezm. vyd. Praha: SNTL, 1989.
[2]
BROŽOVSKÝ, J., MATERNA. A. Základy matematické teorie pružnosti. Ostrava, 2012.
[3]
KREJSA, M. Algoritmizace inženýrských výpo#t% [online]. 2013 [cit. 2013-3-1]. Dostupný z WWW:
<http://fast10.vsb.cz/krejsa/>.
[4]
KUBOŠEK, J. &ešení tenkých desek metodou sítí v programu Matlab, In XIV. Roník fakultního kola
SVO& Sborník studentských prací 2013, Ostrava: VŠB-TU Ostrava, 83 s., 2013.
ISBN 978-80-248-2979-1.
[5]
KORTIŠ, J. Automatization of the computer simulation by using the macro software. Theoretical
foundation of civil engineering. Warsaw and Wroclaw, Poland, 05 - 10 September 2011, XX Polish Russian - Slovak seminar .
[6]
Program Matlab, Informace o programu: <http://www.mathworks.com/products/matlab/>.
[7]
Scia Engineer [online]. 2012 [cit. 2012-01-01]. Dostupný z WWW: < http://www.scia-online.com>.
~ 126 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
Analýza oblouku obecnou deformaní metodou
M. Kubzová 1 a O. Sucharda2
Abstract
The arcs rank among commonly used building structures. This paper describes the analysis of the arcs by means
of the deformation method. Two different methods are used to solve the system of linear equations. The both
methods are compared then. Matlab was used for the algorithmising the computational task.
Klíová slova
Oblouk; obecná deforma#ní metoda; algoritmizace; soustava lineárních rovnic
1
ÚVOD
Hlavním cílem píspvku je vytvoení algoritmu pro výpoet staticky neuritého oblouku obecnou deformaní
metodou v softwaru MATLAB [8] a prezentace ilustraních píklad%. Pro kontrolu správnosti ešení je použit
software Microsoft Office Excel [9]. Souástí píspvku je porovnání asové náronosti pro r%zné metody ešení
soustav lineárních rovnic. Pro porovnání je použita jedna iteraní a jedna pímá metoda.
2
#EŠENÍ OBLOUK"
Vytvoený výpoetní program je urený pro jedenkrát nebo dvakrát staticky neuritý parabolický oblouk s
podporami v koncových uzlech. Pi zpracování programu se vycházelo z [1, 2, 6, 10]. Program je založen na
obecné deformaní metod, kdy skutený tvar oblouku je pro výpoet idealizován stednicí parabolického
oblouku. Pro stednici oblouku platí rovnice kvadratické paraboly (1).
z = k ⋅ x2
(1)
Program umož(uje zvolit mezi dvma variantami zatížení, piemž každá varianta je provedena zvláš
v samostatném programu:
•
•
Zatížení bodovými vodorovnými nebo svislými silami v uzlech
Zatížení rovnomrným spojitým zatížením ve svislém smru na celou délku rozptí oblouku
Rozdlení oblouku na jednotlivé dílky je v programu provedeno pomocí cykl%, kterými se zárove( urují
souadnice jednotlivých uzl%. Jednotlivé ástí oblouku jsou ešeny jako monoliticky pipojené.
1
Monika Kubzová, VŠB – TU Ostrava, Fakulta stavební, Katedra stavební mechaniky, L. Podéšt 1875/17, CZ
708 33 Ostrava Poruba, [email protected]
2
Ing. Oldich Sucharda, Ph.D., VŠB – TU Ostrava, Fakulta stavební, Katedra stavební mechaniky, L. Podéšt
1875/17, CZ 708 33 Ostrava Poruba, tel.: (+420) 597 321 391, [email protected]
~ 127 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Deformacemi v uzlech jsou posunutí ve vodorovném a svislém smru a pootoení styník%. Primární síly na
prutech nevznikají, jelikož je veškeré zatížení pevedeno na zatížení styníkové.
3
METODY PRO #EŠENÍ SOUSTAVY LINEÁRNÍCH ROVNIC
V rámci programu vytvoeného v programu MATLAB [8] je možné použít jednu iteraní a jednu pímou metodu
ešení soustavy n lineárních rovnic. Je také možné využít pímo implantovaných funkcí MATLAB [8]. Pi
tvorb algoritmu se vycházelo z publikací [3, 4, 5].
Pímé metody vedou k pesnému ešení pi koneném potu výpoetních krok%. Základním rysem metod je
eliminace neznámých. K ešení soustavy rovnic je zvolena Gauss-Jordanova metoda. Základním principem je
úprava matice K na matici diagonální. Pro metodu je v programu zvolena tolerance nepesnosti 0.00000001.
Iteraní metody se postupn pibližují k pesnému výsledku. K ešení soustavy rovnic je použita metoda
sdružených gradient%. Metoda je vhodná pro úlohy, kde matice soustavy je tvercová, symetrická a pozitivn
definitní. Princip spoívá ve vhodn zvolené posloupnosti vektor%, které urují smr postupu k výsledku
soustavy rovnic. Pro metodu je ve výpotu zvolena tolerance nepesnosti 0.00000001.
4
OBLOUK ZATÍŽENÝ SILOU UPROST#ED ROZP$TÍ
Vytvoený výpoetní program byl zvolen pro analýzu dvou oblouk%. Vyhodnocovaly se deformace. Jednalo se o
oblouk zatížený jednou silou uprosted rozptí nebo spojitým zatížením. Oblouk zatížený jednou silou je
zobrazen na Obr. 1. Souástí výpotu je také porovnání asové náronosti pi rozdlení oblouku na 6, 50 a 100
ástí pro r%zné metody ešení soustav rovnic. Charakteristiky pr%ezu oblouku jsou E = 20 GPa, A = 0.324 m2, I
= 0.00972 m4. Graf tvaru výpoetního modelu (konstrukce) a deformace oblouku po rozdlení na jednotlivé
dílky jsou zobrazeny na Obr. 2 a 3.
Obr. 1. Oblouk zatížený silou uprosted
6 dílk%
50 dílk%
Obr. 2. Graf tvaru výpoetního modelu (konstrukce) po rozdlení
~ 128 ~
100 dílk%
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Pi výpotu soustavy lineárních rovnic si software MATLAB [6] v prvním pípad výpotu zvolí metodu, která
je nejvhodnjší. Tento výpoet má nejkratší asovou náronost a vyšel z hlediska porovnání metod ešení
nejlépe. Na druhém míst je metoda sdružených gradient%, která i pi 100 neznámých a toleranci nepesnosti
0.00000001 spadá pod asovou náronost 1s. Pi dvojnásobném potu neznámých se asová náronost zvýší asi
18krát.
6 dílk%
50 dílk%
Obr. 3. Graf deformované konstrukce (výpoetního modelu)
100 dílk%
Na tetím míst je nejpomalejší metoda ze tí porovnávaných metod a tou je metoda Gauss-Jordanova. Pi
dvojnásobném potu neznámých parametru a tolerancí pesnosti 0.00000001 se potebný as zvýší cca 7,5krát.
Z porovnání lze pedpokládat, že metodu sdružených gradient% je výhodnjší použít pi velkém potu
neznámých parametr%. &asová náronost pro jednotlivé výpoty je uvedena v Tab. 1.
Poet ástí
6
50
100
5
Metoda MATLABu
Gauss-Jordanova metoda
0.000325 s
0.020778 s
0.001416 s
0.209771 s
0.004846 s
1.553652 s
Tab. 1. Porovnání asové náronosti výpotu
Metoda sdružených
gradient%
0.003318 s
0.051810 s
0.929450 s
OBLOUK ZATÍŽENÝ ROVNOM$RNÝM SPOJITÝM ZATÍŽENÍM
Druhý zvolený píklad je oblouk na Obr. 4 zatížený spojitým rovnomrným zatížením na pr%mt celkového
rozptí. Oblouk je rozdlen na 10 dílk%. Charakteristiky pr%ezu oblouku jsou E = 20 GPa, A = 0.324 m2,
I = 0.00972 m4. Graf tvaru výpoetního modelu (konstrukce) a deformace oblouku po rozdlení na jednotlivé
dílky jsou zobrazeny na Obr. 5.
Obr. 4. Zadání geometrie a zatížení oblouku
~ 129 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Obr.5. Graf tvaru konstrukce a tvaru po rozdlení – 10 dílk%
6
ZÁV$R
Vytvoený program umož(uje ešit statický neuritý oblouk, který je zatížen bodovými silami v uzlech nebo
rovnomrným spojitým zatížením. Další podrobnosti k použití a vytvoenému algoritmu jsou uvedeny v [7].
Správné výsledky programu byly oveny na shodném píkladu zatíženém jednou silou ve vypoteních softwaru
Microsoft Office Excel [9]. Rozdíly byly malé. Z porovnání asové náronosti výpotu ešení soustavy
lineárních rovnic vyplývá, že software MATLAB [8] si sám volí nejrychlejší a nejvhodnjší algoritmus metody.
V pípad dvou algoritmizovaných metod ešících soustavy lineárních rovnic je vhodné pro úlohy s vtším
potem neznámých parametr% použití metody sdružených gradient%.
POD$KOVÁNÍ
Píspvek vznikl za finanní podpory Ministerstva školství, mládeže a tlovýchovy &R z Operaního programu
Vzdlávání pro konkurenceschopnost v rámci projektu . CZ.1.07/2.3.00/20.0013 ,,Tvorba a internacionalizace
špikových vdeckých tým% a zvyšování jejich excelence na Fakult stavební VŠB-TUO". This paper was
supported by the Ministry of Education, Youth and Sports under the Operational Programme: OP for Education
for Competitiveness (ECOP) under VSB-TUO, Project No.CZ .1.07/2.3.00/20.0013.
LITERATURA
[1]
Benda, J. Stavební statika I. VŠB-TUO, Ostrava, 2005.
[2]
Kadlák, J., Kytýr, J. Statika stavebních konstrukcí II. Staticky neur#ité prutové konstrukce. Uebnice.
Brno: VUTIUM, 2004. ISBN 80-214-2631-4.
[3]
Rektorys, K. a kol. P'ehled užité matematiky I, 7. rozší'ené a dopln$né vydání, Praha: Prométheus, 2000.
720 s. ISBN 978-80-7196-180-2.
[4]
Rektorys, K. a kol. P'ehled užité matematiky II, 7. rozší'ené a dopln$né vydání, Praha: Prométheus, 2000.
874 s. ISBN 978-80-7196-181-7.
[5]
Krejsa, M. Algoritmizace inženýrských výpo#t% [online]. 2013 [cit. 2013-3-1]. Dostupný z WWW: <
http://fast10.vsb.cz/krejsa/>.
[6]
Koubová,
L.,
Prezentace
do
cvi#ení
<http://fast10.vsb.cz/randyskova/cv_12_SSKI.pdf/>.
[7]
Kubzová. M. &ešení staticky neur#itého rovinného oblouku v programu MATLAB, In XIV. Roník
fakultního kola SVO& Sborník studenských prací 2013, Ostrava: VŠB-TU Ostrava, 83 s., 2013. ISBN
978-80-248-2979-1.
[8]
Program Matlab, Informace o programu: <http://www.mathworks.com/products/matlab/>.
[9]
Program Microsoft Office Excel, Informace o programu: <http://www.microsoft.cz/>.
[online].
2013
[cit.
2013-3-1].
[10] Janas, P., Prezentace do cvi#ení [online]. 2013 [cit. 2013-3-1]. <http://fast10.vsb.cz/kolos/file/SSKIcv12.pdf/>.
~ 130 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
FREKVENČNÉ CHARAKTERISTIKY NÁKLADNÉHO VOZIDLA
J. Melcer1 a D. Kuchárová2
Abstract
There are characteristics uniquely determined the dynamic individuality of every dynamical system. The
frequency response functions can by considered as such characteristics. There are employed usually within the
solution in frequency domain. These characteristics can be obtained by numerical or experimental way. In the
submitted paper the frequency response functions are analyzed for the lorry Tatra by numerical way. They are
needed within the numerical analysis of moving load effect on pavement in the frequency domain.
Kľúčové slová
Vozidlo; výpočtový model; dynamické charakteristiky; funkcie frekvenčného prenosu; riešenie vo frekvenčnej
oblasti.
1
ÚVOD
Pri riešení dynamických úloh vo frekvenčnej oblasti nás zaujímajú hlavne frekvenčné spektrá a funkcie
frekvenčného prenosu. Funkcie frekvenčného prenosu (FFP) vyjadrujú vzťah medzi odozvou a budením
dynamického systému v závislosti od hodnoty budiacej frekvencie. V prípade dynamického systému tvoreného
vozidlom a vozovkou sú nerovnosti vozovky zdrojom kinematického budenia vozidla. V prípade sledovania
interakcie vozidlo – cesta nás zaujímajú funkcie frekvenčného prenosu vzťahujúce sa k zložkám posunutí
charakteristických bodov vozidla (viažucich sa k stupňom voľnosti výpočtového modelu) a k hodnotám
kontaktných síl vznikajúcich medzi kolesom vozidla a jazdnou dráhou. Je vhodné sledovať a vzájomne
porovnávať takzvané výkonové prenosové faktory (VPF), čo sú druhé mocniny absolútnych hodnôt funkcií
frekvenčného prenosu. Možností, ako takéto údaje získať, je viac. Niektoré sú obsahom predkladaného
príspevku. Využitie získaných výsledkov je rôznorodé [1], [2], [3], [4].
2
VÝPOČTOVÝ MODEL VOZIDLA
Výpočtové modely vozidiel je možné voliť na rôznych úrovniach. Pre účely tohto príspevku je zvolený
priestorový trojdimenzionálny výpočtový model vozidla. Zvolený výpočtový model nákladného vozidla Tatra
815 je zobrazený na obr. 1. Uvedený výpočtový model je diskrétny model. Pohybové rovnice je možné odvodiť
v tvare obyčajných diferenciálnych rovníc. Zložky pohybu zodpovedajúce stupňom voľnosti sú označené ri
(i = 1 až 9).
1
Prof. Ing. J. Melcer, DrSc., Žilinská univerzita, Stavebná fakulta, Univerzitná 1, 010 26 Žilina,
+421-41-513 5612, [email protected]
2
Doc. Ing. D. Kuchárová, PhD., Žilinská univerzita, Stavebná fakulta, Univerzitná 1, 010 26 Žilina,
+421-41-513 5600, [email protected]
~ 131 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
1(m1)
3(Ix1)
T
2(Iy1)
2
4
9(Iy5)
1
3
10
7(Iy4)
5(m3)
8(m5)
4(m2)
9
6(m4)
6
5
8
d
7
e
d
e
c c
s1
s2
Obr. 1. Priestorový model vozidla Tatra 815
Frekvenčný prenos lineárnej sústavy (funkcia frekvenčného prenosu FP(p), kde p = i ⋅ ω je komplexné číslo) sa
zavádza ako pomer ustálenej odozvy k harmonickému budeniu. Ak budenie je harmonické s jednotkovou
amplitúdou, tak platí, že
FP( p) = FP(i ⋅ ω) = rust (t ) /(h ⋅ ei ⋅ω⋅t ) = rust (t ) /(1⋅ ei ⋅ω⋅t ) = rust (t ) ⋅ e − i ⋅ω⋅t .
(1)
Frekvenčný prenos FP(p) ako funkcia komplexne premennej sa dá zobraziť ako
FP( p) = FP( p) ⋅ ei ⋅φ ,
(2)
kde FP( p) je absolútna hodnota, alebo veľkosť frekvenčného prenosu. Z rovnice (1) môžeme vyjadriť rust (t )
FP( p) = rust (t ) /(1⋅ ei ⋅ω⋅t )
→
rust (t ) = FP ( p) ⋅ ei ⋅ω⋅t .
Ak dosadíme (2) do (3) dostaneme
rust (t ) = FP( p) ⋅ ei ⋅φ ⋅ ei ⋅ω⋅t = FP ( p) ⋅ ei ⋅( ω⋅t + φ) .
(3)
(4)
Grafické znázornenie frekvenčného prenosu sa nazýva frekvenčnou charakteristikou. Grafické znázornenie
absolútnej hodnoty (modulu) funkcie frekvenčného prenosu od frekvencie harmonického budenia je amplitúdová
charakteristika. Fázová charakteristika je grafické znázornenie argumentu (fáze) funkcie frekvenčného prenosu
2
od frekvencie harmonického budenia. Funkciu FP( p) nazývame výkonový prenosový faktor (VPF).
3
VÝSLEDKY NUMERICKÉHO RIEŠENIA
Pre prechod z časového do frekvenčného priestoru je možné použiť Laplaceovu integrálnu transformáciu.
Dohodnime sa, že Laplaceov obraz nejakej funkcie r(t) označíme L{r(t)} = R(p) . V tomto prípade p = i ⋅ ω je
komplexné číslo. Funkcia r(t) a jej derivácie podľa času sa budú transformovať nasledovne
{
}
n −1
L r (n ) (t ) = p n ⋅ R( p ) − ∑ p n −1− i ⋅ r (i ) (0 + ) ,
pre n = 1, 2, ......
(5)
i =1
Funkcie času r1 (t ) až r9 (t ) a h5 (t ) až h10 (t ) sa budú transformovať na funkcie R1 ( p) až R9 ( p) a H 5 ( p) až
H10 ( p) . Zavedením nasledovného označenia je možné definovať 9 frekvenčných prenosov
~ 132 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Ri ( p)
, i = 1 až 9.
(6)
H 5 ( p)
Laplaceovou transformáciou pohybových rovníc a zavedením frekvenčných prenosov dostaneme sústavu 9
ri =
rovníc v komplexnom tvare pre výpočet funkcií
ri . Zápis rovníc v maticovom tvare je nasledovný
[a]⋅ {r } = {PS}.
(7)
Vo všeobecnosti platí, že
aik = aik , re + i ⋅ aik , im ,
ri = ri , re + i ⋅ ri , im , PSi = PSi , re + i ⋅ PSi , im .
(8)
Na ďalších obrázkoch sú zobrazené výkonové prenosové faktory (VPF) vybraných funkcií frekvenčného
prenosu (druhé mocniny absolútnych hodnôt jednotlivých frekvenčných funkcií) pri rýchlosti pohybu vozidla 10
m/s. Pre lepšiu orientáciu v obrázkoch uvádzame hodnoty vlastných frekvencií výpočtového modelu vozidla
(bez uvažovania tlmenia): f(1) =1,13 Hz, f(2) =1,28 Hz, f(3) = 1,45 Hz, f(4) = 8,89 Hz, f(5) = 8,89Hz, f(6) =10,91 Hz,
f(7) =10,91 Hz, f(8) =11,71, f(9) =11,71 Hz. Vrcholy vo funkciách frekvenčného prenosu korešpondujú
jednotlivým vlastným frekvenciám výpočtového modelu vozidla.
Výkonový prenosovy faktor |r1/h5|2
Výkonový prenosovy faktor |r2/h5|2
0.4
|r2/h5|2 [rad2/m2]
|r1/h5|2 [m2/m2]
1.5
1
0.5
0
0
5
10
15
20
0.3
0.2
0.1
0
25
0
5
10
f [Hz]
15
20
25
20
25
f [Hz]
2
Výkonový prenosovy faktor |r4/h5|2
Výkonový prenosovy faktor |r3/h5|2
6
|r4/h5|2 [m2/m2]
|r3/h5|2 [rad2/m2]
0.8
0.6
0.4
0.2
0
4
2
0
0
5
10
15
20
25
0
5
10
15
f [Hz]
f [Hz]
2
2
Výkonový prenosovy faktor |r6/h5|2
Výkonový prenosovy faktor |r7/h5|2
2
|r7/h5| [rad /m ]
400
0.5
0
300
2
1
200
2
|r6/h5|2 [m2/m2]
1.5
0
5
10
15
20
25
f [Hz]
100
0
0
5
10
15
20
f [Hz]
2
2
Obr. 2. VPF vybraných zložiek pohybu výpočtového modelu vozidla
~ 133 ~
25
11th International Conference on New Trends in Statics and Dynamics of Buildings
Výkonový prenosovy faktor |Fdyn5/h5|2
6
|Fdyn5/h5|2 [kN2/m2]
10
October 2013, Bratislava
x 10
5
0
0
5
10
15
20
25
20
25
20
25
f [Hz]
2
Výkonový prenosovy faktor |Fdyn7/h5|2
8
|Fdyn7/h5|2 [kN2/m2]
15
x 10
10
5
0
0
5
10
15
f [Hz]
2
Výkonový prenosovy faktor |Fdyn8/h5|2
8
|Fdyn8/h5|2 [kN2/m2]
15
x 10
10
5
0
0
5
10
15
f [Hz]
2
Obr. 3. VPF dynamických zložiek kontaktných síl na pravej strane vozidla
4 ZÁVERY
V predloženou príspevku je ukázaný spôsob riešenie funkcií frekvenčného prenosu numerickou cestou pre
rovinný (polovičný) model vozidla Tatra 815 pri rýchlosti pohybu vozidla 36 km/h. V grafickej podobe sú
prezentované výkonové prenosové faktory jednotlivých sledovaných veličín. Stavebného inžiniera zaujímajú
v prvom rade frekvenčné prenosy týkajúce sa kontaktných síl vznikajúcich medzi kolesom vozidla a vozovkou.
Z uvedených obrázkov je zrejmé, že pokiaľ ide o hodnoty kontaktných síl, tak výkonovo majú najväčší podiel na
ich vzniku tie frekvenčné zložky kinematického budenia, ktoré korešpondujú vlastným frekvenciám a tvarom
vlastného kmitania vťahujúcim sa k dominantným pohybom náprav vozidla [5].
POĎAKOVANIE
Tento príspevok vznikol s podporou GA MŠSR VEGA, grant č. 1/0259/12.
LITERATÚRA
[1]
Panulinová, E. Vplyv rovnosti povrchu vozovky na hladinu hluku z automobilovej dopravy. Silniční obzor.
Praha, 2001, roč. 62, č. 11/12, s. 275 – 279, ISSN 0322-7154.
[2]
Kotrasová, K. a Kormaníková, E. Seismic design of liquid storage tank made from composite material.
World Journal of Engineering. 2008, Vol. 5, No. 3, p. 445-446. ISSN 1708-5284.
[3]
Ivánková, O. Vplyv seizmicity na konštrukčné systémy výškových budov. Medzinárodná konferencia:
Vývoj a aplikace MKP systémů pro analýzu stavebních konstrukcí. VÚT Brno, 2003, s. 17.1 – 17.6.
[4]
Lajčáková, G. Interaction in the system vehicle – Roadway. 2nd International Conference: New Trends in
Statics and Dynamics of Buildings. STU Bratislava, 2003, October 16 – 17, 2003, p.27-30, ISBN 80-2271958-7.
[5]
Martinická, I.: Výpočet vlastných frekvencií a tvarov vlastného kmitania výpočtových modelov vozidiel.
Pozemné komunikácie a dráhy, roč. 6, č.1-2, 2010, ISSN 1336-7501, s.41-51.
~ 134 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
POROVNANIE VÝPOČTOVÝCH MODELOV CESTNÝCH
KOMUNIKÁCIÍ
J. Melcer1 a G. Lajčáková2
Abstract
Within the solution of the vehicle roadway interaction problems the various computing models of the road can
be used. The results of the solution show that under certain conditions also simpler computing models can offer
applicable results. The submitted paper is dedicated to the comparison of the results obtained from simpler road
computing model and from the model created on the finite element method.
Kľúčové slová
Vozovka, vozidlo, výpočtový model, numerické riešenie.
1
ÚVOD
Pre numerické modelovanie účinkov pohybu vozidla na cestné komunikácie je možné pracovať s rôznymi
výpočtovými modelmi cestnej komunikácie. Je možné použiť výpočtové model cesty vytvorené v duchu metódy
konečných prvkov ale aj oveľa jednoduchšie výpočtové modely. Napríklad v prípade cementobetónových
vozoviek je možné pracovať s modelom dosky na pružnom podklade. Vzhľadom na charakter zaťaženia, ktoré sa
pohybuje po ceste, nám stačí poznať stavy napätosti a stavy deformácie len v jednom priečnom reze, v krajnom
prípade len v jednom bode. Z tohto pohľadu sa výpočtový model MKP javí ako neefektívny, vzhľadom k tomu,
že použiteľné sú vlastne len výsledky riešenia z uzlov patriacich jednému rezu uprostred výpočtového modelu.
Výsledky riešenia v iných uzloch výpočtového modelu sú nepoužiteľné, lebo nie sú správne. V prekladanom
príspevku je urobené porovnanie pre cementobetónovú vozovku, akú presnosť riešenia v jednom bode je možné
dosiahnuť pri použití výpočtového modelu dosky na pružnom podklade vo vzťahu k výpočtovému modelu dosky
na pružnom polpriestore vytvorenému v duchu MKP. V obidvoch prípadoch sa pracuje s priestorovým
výpočtovým modelom nákladného vozidla.
2 VÝPOČTOVÝ MODEL VOZIDLA
Pre riešenie sledovanej úlohy je použitý priestorový výpočtový model ťažkého nákladného automobilu typu
Tatra podľa obr. 1. Jedná sa o diskrétny výpočtový model s 9 stupňami voľnosti. Ako neznáme figurujú zložky
posunutí bodov ri(t) zodpovedajúce jednotlivým stupňom voľnosti modelu. Pretože sa jedná o diskrétny
výpočtový model, pohybové rovnice je možné odvodiť v tvare obyčajných diferenciálnych rovníc a riešiť ich
numericky. Ako vedľajší produkt riešenia je možné získať časové priebehy kontaktných síl vznikajúcich medzi
kolesami vozidla a jazdnou dráhou.
1
Prof. Ing. J. Melcer, DrSc., Žilinská univerzita, Stavebná fakulta, Univerzitná 1, 010 26 Žilina,
+421-41-513 5612, [email protected]
2
Doc. Ing. G. Lajčáková, PhD., Žilinská univerzita, Stavebná fakulta, Univerzitná 1, 010 26 Žilina,
+421-41-513 5649, [email protected]
~ 135 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
1(m1)
3(Ix1)
T
2(Iy1)
2
4
9(Iy5)
1
3
10
7(Iy4)
5(m3)
8(m5)
4(m2)
9
6(m4)
6
5
8
d
7
e
d
e
c c
s1
s2
Obr. 1. Výpočtový model vozidla
2
MKP MODEL VOZOVKY
Uvažuje sa s cemento-betónovou vozovkou hrúbky 240 mm, ktorej skladba je zobrazená na obr. 2.
CB/I; 240 mm; E = 37500 MPa; ν = 0,20
OK II; 40 mm; E = 4500 MPa; ν = 0,21
SC I; 200 mm; E = 2000 MPa; ν = 0,23
OV;
POD;
250 mm; E = 120 MPa; ν = 0,35
∞;
E=
30 MPa; ν = 0,35
Obr. 2. Skladba cementobetónovej vozovky
Pre takúto vozovku bol vytvorený výpočtový model MKP ako model dosky na vrstevnatom polpriestore.
Riešená oblasť má pôdorysný rozmer 20,4 x 14,7 m. Je rozdelená na 48 x 30 = 1440 konečných prvkov. Delenie
konštrukcie na konečné prvky a stav pretvorenia v určitom časovom okamihu sú zobrazené na obr. 3.
3
MODEL DOSKY NA PRUŽNOM PODKLADE
V ďalšom kroku bol vytvorený výpočtový model vozovky v duchu doskovej teórie tenkých dosiek na pružnom
podloží. Reálne podložie je modelované Winklerovým modelom. Rovnica dosky na pružnom podloží má tvar
⎛ ∂4w
∂ 4w
∂4w ⎞
∂ 2w
∂w
D⎜⎜ 4 + 2 2 2 + 4 ⎟⎟ + K ⋅ w + μ 2 + 2 μωb
= p ( x, y , t ) .
(1)
∂t
∂x ∂y
∂y ⎠
∂t
⎝ ∂x
~ 136 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Obr. 3. MKP model dosky na vrstevnatom polpriestore
Riešenie rovnice dosky sa realizuje Fourierovou metódou. Vzhľadom na ciele riešenia sa prijíma predpoklad
o tvare ohybovej plochy vyvolanej tlakom nápravy vozidla
1⎛
2πx ⎞⎛⎜
2πy ⎞⎟
⎟⎟ 1 − cos
w( x, y, t ) = wo ( x, y ) ⋅ q(t ) = ⎜⎜1 − cos
⋅ q(t ) .
(2)
⎜
4⎝
l x ⎠⎝
l y ⎟⎠
Skutočné zaťaženie kolesovými silami Fj(t) sa transformuje na spojité zaťaženie p(x,y,t) spôsobom, ktorý
navrhol Dirac [1]
(3)
p(x, y, t ) = ∑ ε j ⋅ F j (t ) ⋅ δ x − x j ⋅ δ y − y j .
(
j
) (
)
Riešenie sa realizuje numericky a výsledkom riešenia sú časové priebehy vertikálnych posunutí v strede dosky
[2]. Výpočtový model riešenej dosky je zobrazený na obr. 4.
h = 240 mm
E = 37500 MPa
K = 171,8 MN/m3
Obr. 4. Výpočtový model dosky na Winklerovom pružnom podklade
~ 137 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
4 VZÁJOMNÉ POROVNANIE VÝPOČTOVÝCH MODELOV
Záverom boli porovnané výsledky riešenia získané z výpočtového modelu vytvoreného v duchu MKP, kde
vozovka je modelovaná ako doska na vrstevnatom podloží s výsledkami získanými z výpočtového modelu
vozovky ako dosky na Winklerovom pružnom podklade. Vzhľadom na skutočnosť, že model dosky na pružnom
podklade dáva iba výsledky v jednom bode, sú porovnávané priehyby uprostred dosky s priehybmi uprostred
oblasti riešenej MKP. Porovnanie výsledkov v grafickej podobe je na obr. 5. Zelená farba predstavuje výsledky
z MKP modelu a modrá farba výsledky z modelu dosky na Winklerovom pružnom podklade (WPP). Sledované
krivky vykazujú 2 lokálne extrémy. V oblasti 1. lokálneho extrému je rozdiel sledovaným hodnôt Δw1 = 0,00623
mm a v oblasti 2. lokálneho extrému je rozdiel sledovaným hodnôt Δw2 = 0,00017 mm.
Vychylky uprostred dosky
0.1
w(t) [mm]
0.05
WPP
0
-0.05
MKP
-0.1
0
0.1
0.2
0.3
0.4
0.5
0.6
0.7
t [s]
Obr. 5. Porovnanie výsledkov z MKP a WPP modelu
5
ZÁVERY
Pre modelovanie problému interakcie vozidlo vozovka je možné používať rôzne výpočtové modely vozovky [3].
Napriek skutočnosti, že v súčasnej dobe je všeobecne najrozšírenejšie modelovanie v duchu metódy konečných
prvkom, má model MKP vzhľadom na charakter zaťaženia v tomto konkrétnom prípade aj svoje nevýhody.
Výsledky numerických štúdií ukazujú, že v určitých prípadoch a za určitých predpokladov je možné použiť aj
jednoduchšie výpočtové modely. Pokiaľ rozmery riešenej dosky sa stotožnia s rozmermi oblasti s prevažujúcim
vertikálnym pretvorením (orámovaná oblasť v strede obr. 3), tak výsledky získané z modelu WPP veľmi dobre
korešpondujú výsledkom získaným z modelu MKP. Pre plne naložené vozidlo Tatra 815 je možné túto oblasť
uvažovať s rozmermi približne 6,8 x 4,9 m s toleranciou ± 0,1 m. Samozrejme, že použitý model WPP, tak ako
tu bol predstavený, má aj svoje nevýhody. Výsledkom riešenia môžu byť len hodnoty sledované uprostred
dosky. Táto nevýhoda je však na druhej strane vyvážená jednoduchosťou riešenia a rýchlosťou výpočtu. Koniec
koncov pri realizácii experimentálnych meraní in situ sa tiež často snímajú pretvorenia len v jednom bode a nie
v celom profile vozovky.
POĎAKOVANIE
Tento príspevok vznikol s podporou GA MŠSR VEGA, grant č. 1/0259/12.
LITERATÚRA
[1]
Frýba, L.: Vibration of Solids and Structures under Moving Loads. ACADEMIA, Praha, Noordhoff
International Publishing, Groningen, 1972.
[2]
Lajčáková, G. - Melcer, J.: Numerické modelovanie účinkov vozidiel na cementobetónové vozovky.
Stavebné a environmentálne inžinierstvo, roč. 7, č. 2, 2011, ISSN 1336-5835, s.150-157.
[3]
Sumec, J. - Minárová, M.: Mechanical and Mathematical Modeling of Viscoelastic Continua – Constitutive
Equations. Medzinárodná konferencia „Modelování v mechanice“, VŠB – Stavební fakulta, 22.- 23.5.2013,
Ostrava. Plné znenie článku CD-ROM, ISBN 978-80-2985-2.
~ 138 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
Analýza detailu kotvení d)ev*né konstrukce rámu
D. Mikolášek1, O. Sucharda2 a J. Brožovský3
Abstract
The paper compares s beam and a shell computational model. The studied problem is a timber structure which is
anchored by means of steel rods into a reinforced concrete foundation structure. The purpose of the presented
works is to evaluate differences in the modelling, analyses and assessment of the computational models. The
finite element method and the Scia Engineer software were used for the analysis.
Klíová slova
D'evo; detail; prut; sko'epina; návrh; kotvení
1
ÚVOD
Analyzovaná konstrukce venkovního rámu je navržena jako architektonický prvek dotváející vjezd
do funkcionalistické vily. Rám je po celou dobu životnosti ve venkovním prostedí. Ocel bude žárov zinkována
s použitím ástí z nerez plech%. Devo bude ponecháno bez chemických úprav a je zvoleno z modínu.
Celá stavba vily je koncipována jako devostavba tvoená kížem lepenými panely s páteí domu tvoenou
ocelovým rámem z HEB válcovaných profil%. Stabilitu a tuhost domu zajišují plnostnné devné panely.
Konstrukce rámu byla poítána s imperfekcí rovnající se deformaci od vtru a stálých zatížení pro geometricky
lineární výpoet. Konstrukce byla deformována rovnobžn s vtrem kolmo na rovinu rámu cca l/220 = 22.7
mm. Imperfekce je složena z montážní nepesnosti a nepesnosti z výroby. S takto imperfektní konstrukcí je pak
proveden výpoet se zohlednním teorie druhého ádu. Pi návrhu konstrukce se vycházelo z [2, 3].
Celá konstrukce se skládá ze tech hlavních ástí spojených šroubovým pedepnutým spojem zobrazených na
Obr. 1 a 2. Dv ásti jsou tvoeny ocelovými svaenci z oceli S235 a vnitní ást která je tvoená lepeným
lamelovým devem GL24h - modín. Devná konstrukce je spojena pomocí vrut% do L profilu a je kotvena
pomocí vlepených ocelových tyí do ocelových svaených tmen% - botek. Ocelové botky jsou pes chemickou
kotvu kotveny do železobetonové konstrukce. Ocelové ásti jsou tvoeny na levé ásti konstrukce celku ze dvou
svaených IPE 180 profil% a výztuh. Na pravé stran tvoí ocelovou botku patní svaenec. Ocelová konstrukce na
levé stran je tvoena ze dvou celk%, které jsou k sob pišroubovány pedpjatými šrouby.
1
Ing. David Mikolášek, Ph.D., VŠB – TU Ostrava, Fakulta stavební, Katedra stavební mechaniky, L. Podéšt
1875/17, CZ 708 33 Ostrava Poruba, tel.: (+420) 597 321 391, [email protected]
2
Ing. Oldich Sucharda, Ph.D., VŠB – TU Ostrava, Fakulta stavební, Katedra stavební mechaniky, L. Podéšt
1875/17, CZ 708 33 Ostrava Poruba, tel.: (+420) 597 321 391, [email protected]
3
Doc. Ing. Jií Brožovský, Ph.D., Katedra stavební mechaniky, Fakulta stavební, VŠB-Technická univerzita
Ostrava, Ludvíka Podéšt 1875/17, 708 33 Ostrava - Poruba, tel.: (+420) 597 321 321, e-mail:
[email protected]
~ 139 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
2
October 2013, Bratislava
VÝPO(ETNÍ MODELY
Numerickou analýzu konstrukce tvoí dva základní numerické modely, které byly vytvoeny ve výpoetním
programu Scia Engineer [7]. První výpoetní model na Obr. 4 je složen pouze z prutových konených prvk%,
jedná se o model TYP A_21. Model byl poítán geometricky nelineárn s pihlédnutím ke konstrukní
nelinearit. Nebyla zde uvažována fyzikální nelinearita. Ve výpoetním modelu jsou zohlednny prokluzy podle
EC5 [1] a postupovalo se dle doporuení [4, 5, 6].
Druhý model TYP B_22 na Obr. 3 byl vytvoen pomocí skoepinových konených prvk% v kombinaci s
prutovými prvky (tuhé prvky sloužící pro vnjší a vnitní vazby). Také tento model byl poítán geometricky a
konstrukn nelineárn, ale fyzikáln linearn. Devná ást skoepiny byla uvažována jako isotropní (devo je
obecn anisotropní, nebylo zde ešeno detailní naptí v kotvení mezi zalepenými závitovými tyemi a devní
hmotou – tah kolmo na vlákna + blokový smyk). V tomto modelu byly spoje a jejich tuhosti (prokluzy)
nastaveny podle EC5 [1]. Oba modely byly zatíženy stejným vnjším zatížením a okrajovými podmínkami.
Pouze model TYP B_22 byl uložen na podloží, tak aby se reáln simulovala tuhost kotvení pomocí závitových
tyí.
3
Obr. 1. Geometrie celé konstrukce
Obr. 2. Geometrie ocelových ástí konstrukce
Obr. 3. Skoepinový výpoetní model
Obr. 4. Prutový výpoetní model
NUMERICKÁ ANALÝZA
U numerické analýzy bylo provádno srovnávací mení mezi modelem TYP A_21 a TYP B_22, kde se jednalo
pedevším o výslednou sumu sil a reakcích v podporách a horizontální deformace. Srovnání horizontální
deformace rámu pro oba modely je patrné z Obr. 5 a 6. V pípad, že z výpotu vyplívají shodné reakce a
deformace obou model%, lze pedpokládat také shodné perozdlení vnitních sil mezi spoji. Tento pedpoklad
pak umož(uje v praktickém navrhování použití reakcí vnitních sil ze zjednodušených model% pro návrh detail%
a kotvení.
~ 140 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Model TYP A_21 a TYP B_22 jsou podobné jak ve velikosti reakcí, tak také deformacích.
Obr. 6. Píná deformace prutového modelu
Obr. 5. Píná deformace skoepinového modelu
Podpory modelované skoepinovými prvky jsou zobrazeny na Obr. 7 a 8. U tchto detail% jsou dále vykresleny
svislé reakce. Svislé deformace jsou zobrazeny na Obr. 9 a 10.
Svislá kotevní reakce [kN]
Sí konených prvk%
Obr. 7. Levá podpora
Svislá kotevní reakce [kN]
Sí konených prvk%
Obr. 8. Pravá podpora
~ 141 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Obr. 9. Levá podpora - svislá deformace [mm]
Obr. 10. Pravá podpora - svislá deformace [mm]
4
ZÁV$R
Z provedené analýzy konstrukce a vybraného detailu vyplývá, že u prutových výpoetních model% je výhodou
pehledný a jednodušší výpoet. Tvorba skoepinového modelu a správné zadání okrajových podmínek a
zatížení je však obvykle obtížnjší než u prutového modelu. Nároná bývá i interpretace získaných výsledk% na
skoepinách, pedevším proto, že tyto výsledky není možné porovnat s normovými postupy návrhu.
Výhodou skoepinových model% je jejich bližší chování k reálné odezv konstrukce. V popisovaném pípad jde
o vystižení chování kotvení mezi devnou ástí konstrukce a ocelovou botkou a betonem. Zde závisí
perozdlení kotevních sil na vnjším zatížení na tuhosti ocelové botky a jejího kotvení do železobetonové
konstrukce.
Skoepinové výpoetní modely se uplatní zejména u konstrukcí atypického tvaru. Dále je vhodné skoepinové
výpoetní modely použít u návrhu kotvení, kdy pomocí komplexnjších numerických model% je možné
dosáhnout úspor materiálu a projektant má jasnjší pehled o perozdlení sil a deformací a chování konstrukce
(stabilita, kmitání, perozdlení tuhostí).
Pokud není možné namodelování celé konstrukce pomoci skoepinového výpoetního modelu nebo se jedná o
typickou konstrukci, tak lze vytvoit pouze prutový model a z nj pak použít síly do kotevních prvk%, které pak
jsou vymodelovány jako skoepinové nebo objemové prvky s uvážením reálnjších okrajových podmínek. Tento
postup vede také k cíli, jen je teba zohlednit vzájemný vztah tuhostí prutový model a skoepinový model.
POD$KOVÁNÍ
Práce byly podporovány z prostedk% koncepního rozvoje vdy, výzkumu a inovací pro rok 2013, pidlených
VŠB-TU Ostrava Ministerstvem školství, mládeže a tlovýchovy &eské republiky.
LITERATURA
[1]
&SN EN 1995-1-1 73 1701 Eurokód 5: Navrhování d'ev$ných konstrukcí – 2ást 1-1: Obecná pravidla –
Spole#ná pravidla a pravidla pro pozemní stavby. Praha: &NI. 2006. 114 s.
[2]
&SN EN 1991-1-1 73 0035 Eurokód 1: Zatížení konstrukcí – 2ást 1-1: Obecná zatížení - Objemové tíhy,
vlastní tíha a užitná zatížení pozemních staveb. Praha: &NI. 2004. 44s.
[3]
&SN EN 1990 73 0002 Eurokód: Zásady narhování konstrukcí. Praha: &NI. 2004. 76s.
[4]
KOŽELOUH, B. Navrhování, výpo#et a posuzování d'ev$ných stavebních konstrukcí, Obecná pravidla pro
pozemní stavby, Komentá k &SN 73 1702:2007, Praha: &KAIT, 228 s, 2008, ISBN 978-80-87093-73-3.
[5]
KOŽELOUH, B. D'ev$né konstrukce podle EUROKÓDU 5, STEP 1, Navrhování a konstruk#ní materiály.
Zlín: KODR, 1998, ISBN 80-238-2620-4.
[6]
KOŽELOUH, B. D'ev$né konstrukce podle EUROKÓDU 5, STEP 2, Navrhování detail% a nosných
systém%. Zlín: KODR, 2004, ISBN 80-86 769-13-5.
[7]
Scia Engineer [online]. 2012 [cit. 2012-01-01]. Dostupný z WWW: < http://www.scia-online.com>.
~ 142 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
INFLUENCE OF UNILATERAL FOUNDATION
ON DEFLECTION OF THE EXCENTRICALLY LOADED BEAM
Z. Mistríková1
Abstract
Subject of offered contribution is analysis of the elastic beam on the unilateral elastic foundation under bending
and torsion loading. The analysis of the problem was performed by consecutive distribution of the residual
tension stresses between analysed beam and elastic foundation. The derived algorithm was verified in numerical
examples.
Key Words
elastic subsoil, beam, unilateral bond ,excentric load
1
INTRODUCTION
In this contribution numerical analysis of the deformation of the beam on a Winkler's unilateral subsoil is
presented. The beam was loaded by single force or distributed load which acted off centre toward its axis. The
unilateral binding between beam and subsoil was considered in the interaction.
2
ASSUMPTIONS AND SOLUTIONS OF THE BASIC EQUATIONS
The beam on an elastic Winkler's subsoil was analyzed which is characterized by the coefficient (c) [MNm-3].
Beam has a length ln [m], rigid cross-section b x h and it is loaded by vertical single force F, or distributed load
q(x) which acts off centre toward its axis. Deflection curve w ( x ) and the torsion angle ψ ( x ) of the beam's
cross-section are defined by differential equations of equilibrium
EI
GI
where EI is bending resistance and
k
d 4 w (x )
+ cbw ( x ) = q ( x )
dx 4
(1)
d 2 ψ ( x ) cb
+
ψ (x ) = − m ( x )
12
dx 2
(2)
GI k is torsion rigidity of the beam's cross-section.
Contact stress under the beam having the width (b), which is loaded by bending and torsion is:
p ( x , y ) = c (w ( x ) + ψ ( x ) y )
1
for
⎛ −b b ⎞
y ∈⎜
, ⎟
⎝ 2 2 ⎠
(3)
Zora Mistríková, Assoc. Prof.,PhD., C. Eng, Slovak University of Technology in Bratislava, Faculty of Civil
Engineering, Slovakia, e-mail: [email protected]
~ 143 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
2.1 Conditions of unilateral bond
Contact occurs if in points ∀ ⎛⎜ x , y , z = h ⎞⎟ , x ∈ (0 , l ), y ∈ ⎛⎜ − b , b ⎞⎟ the following condition is satisfied:
⎝
2 ⎠
⎝
2 2 ⎠
p (x , y ) ≥ 0
(4)
Necessary condition of solvability of beam with unilateral binding which is loaded by bending and torsion is,
that the resultant R = ∫ q ( x )dx of external load q ( x ) and m ( x ) = q(x).e is in the domain Ω at which
Ω
h ⎞
⎛
⎛ b b ⎞
Ω ⎜ x, y,z =
, ⎟
⎟ , x ∈ (0 , l ), y ∈ ⎜ −
2
⎝
⎠
⎝ 2 2 ⎠
(5)
The problem was solved by iteration - stepwise distribution of unbalanced contact tensile stresses
q ∗j ( x ) and m ∗j ( x ) in the foundation gap. In each iteration step differential equations (1) and (2) were
solved, (interrelated by the equation (3)) with various right sides. In the jth iteration step the right sides of the
differential equations (1) and (2) were as follows
q j ( x ) = q( x ) + q ∗j ( x )
m j ( x ) = m( x ) + m ∗j ( x )
q ∗j ( x ) a nd m ∗j ( x ) compensate tensile contact stress p j −1
(− )
(6)
(x , y ) in the domain. A detailed description for
the solution is in [2].
3
NUMERICAL SOLUTION
In the numerical analysis the effects of unilateral bond on the deflection of the beam were investigated. Beam
(Fig.1) has a length ln = 8 m, rigid cross-section b x h (0,60 x 0,30)m, E=21GNm-2. 15 states of loading were
considered: 1) the force F=1MN, 2) linear load on the sections 1 m, 2 m, 4 m, 6 m. We consider the mean and
extreme values of coefficient c (c = 5 MNm-3, 50MNm-3, 500MNm-3). The force F=1MN as well as the
continuous load for which it is valid
∫ q ( x ) dx
= F , act in the middle of the beam directly on the axis (e=0)
and in two different values of eccentricity e=1/3b and e=2/3b (b is width of beam).
∫ q (x )dx = F
A
e
lq
h
B
b
l
In
Fig. 1
Next, we compare the maximum displacement of the edge of the beam (point A) and displacement the center of
the beam (point B) under the condition of a unilateral or bilateral bond between the beam and the subsoil.
Displacenments of points A, B for subsoil c = 5 MNm-3, and c= 50 MNm-3 are graphically evaluated in Figs. 2,
3, 4, 5. For subsoil c = 500 MNm-3 are evaluated displacement of points A, B in Tab.1
~ 144 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
w - the edge of the beam (m)
0,010
0, 1/3b, 2/3b
0, 1/3b, 2/3b 0, 1/3b, 2/3b
q=0,16MN/m
(l=6m)
q=0,25MN/m
(l=4m)
q=0,5MN/m
(l=2m)
q=1MN/m
(l=1m)
F=1MN
c=50 MN/m3
October 2013, Bratislava
0, 1/3b, 2/3b
load
0, 1/3b, 2/3b
0,000
-0,010
-0,020
-0,030
-0,040
-0,050
bilateral bond
unilateral bond
-0,060
Fig. 2 Displacement of the edge of the beam (c=50MN/m3) – point A
0,030
0,020
0,010
0, 1/3b, 2/3b
q=0,5MN/m
q=0,25MN/m
q=0,16MN/m
(l=6m)
0, 1/3b, 2/3b
(l=4m)
0, 1/3b, 2/3b
(l=2m)
0, 1/3b, 2/3b
(l=1m)
0,v 1/3b, 2/3b
q=1MN/m
0,000
F=1MN
w -the center of the beam(m)
bilateral bond
unilateral bond
c=50MN/m3
0,040
load
Fig. 3 Displacement of the center of the beam (c=50MN/m3) – point B
F=1MN
c=500
MN/m3
w(mm)
point
B
w(mm)
point
A
Exc.
0
1/3b
2/3b
0
1/3b
2/3b
bil.
uni.
q=1MN/m
l=1m
bil.
uni
q=0,5MN/m
l=2m
bil.
uni
q=0,25MN/m
l=4m
bil.
uni
q=0,166MN/m
l=6m
bil.
uni
2,14
2,98
3,89
2,22
3,75
6,28
1,9
2,7
3,5
2,0
3,4
5,7
1,5
2,2
2,9
1,58
2,59
4,85
0,90
1,46
2,03
0,91
1,62
3,07
0,57
1,05
1,53
0,57
1,09
2,0
0,03
-0,81
-1,72
-2,61
-5,01
-13,7
0,03
-0,7
-1,5
-2,3
-5,4
-12,5
0,01
-0,7
-1,3
-1,51
-3,73
-10,36
-0,07
-0,39
-1,21
-0,59
-1,78
-5,58
-0,08
-0,56
-1,04
-0,14
-0,84
-3,15
Tab.1 Displacement of the center of the beam (point B) and
of the edge of the beam (point A) (c=500 MN/m3)
~ 145 ~
(l=6m)
(l=4m)
q=0,16MN/m
October 2013, Bratislava
q=0,25MN/m
(l=2m)
(l=1m)
F=1MN
q=1MN/m
c=5 MN/m3
q=0,5MN/m
11th International Conference on New Trends in Statics and Dynamics of Buildings
load
w - the edge of the beam (m)
0,050
0, 1/3b, 2/3b
0, 1/3b, 2/3b
0, 1/3b, 2/3b
0, 1/3b, 2/3b
0, 1/3b, 2/3b
0,000
-0,050
-0,100
-0,150
-0,200
-0,250
bilateral bond
unilateral bond
Fig. 4 Displacement of the edge of the beam (c=5MN/m3) – point A
c=5MN/m3
bilateral bond
unilateral bond
w-the center of the beam(m)
0,25
0,2
0,15
0,1
0,05
0
(l=6m)
q=0,16MN/m
(l=4m)
0, 1/3b, 2/3b 0, 1/3b, 2/3b
q=0,25MN/m
(l=2m)
0, 1/3b, 2/3b
q=0,5MN/m
(l=1m)
q=1MN/m
0, 1/3b, 2/3b
F=1MN
0, 1/3b, 2/3b
load
Fig. 5 Displacement of the edge of the beam (c=5MN/m3) – point A
4
CONCLUSION
From the obtained results the effect of unilateral bond on change of deflection compared to bilateral bond is
evident. Displacement of the center of the beam (point A) shows the biggest changes in the eccentricity e = 2/3b.
Depending on the coefficient c (5-500 MN/m3) by load force F and the excentricity e = 2/3b the change is from
1,29 to 1,64 multiple When the load q-16MN/m3 act on the length 6 m the change is from 1,27 to 1,36 multiple.
Displacement of the edge of the beam (point B) by load force F and eccentricity e = 2/3b, c (5-500 MN/m3) the
change is from 2,5 to 7,8 multiple. When the load q-16MN/m3 act on the length 6 m the change is from 1,6 to
3,01 multiple.
ACKNOWLEDGEMENT
This paper has been supported by Grant Agency VEGA, project No. 1/0629/12
REFERENCES
[1] J. Nečas, I. Hlaváček: Úvod do matematické teorie pružných a pružněplastických těles. SNTL, Praha 1983
[2] Z. Mistríková: Excentrically Loaded Beam On An Elastic Subsoil With Unilateral Coupling, Proceedings
13 th International Scientific Conference VSU 2013, Sofia, Bulgaria, Vol. I, pp I 223-I 226.
~ 146 ~
Proceedings of the 11th International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
MEASUREMENT OF NON-UNIFORM TORSION OF CLOSED
THIN-WALLED CROSS-SECTION BEAM
J. Murín1, T. Sedlár, V. Goga, J. Paulech, V. Kutiš, M. Aminbaghai, H. Mang
Abstract
This article presents results from measurements of hollow thin-walled cross-section beam under the nonuniform torsion conditions where the warping effect is evaluated and compared with the numerical analysis
results. Outputs of the measurements show the significant effect of the warping on the normal bimoment stress
also by the closed thin walled cross-section.
Key Words
Non-uniform torsion; Warping; Thin-walled beam; Hollow cross-section; Experimental measurement.
1
INTRODUCTION
Non-uniform torsion effect develops from torsion of beams with non-circular cross-section with warping
restrictions. Several theories for analytical solution of straight prismatic beams subjected to non-uniform torsion
have been developed (e.g. Vlasov theory [1] and the technique based on the analogy between the 2nd order beam
theory and non-uniform torsion [2, 3]). This paper confirms significant warping effects in hollow rectangular
section (HRS) beams which, in contradiction with the engineering practice and the Eurocode 3 [4] guideline,
have to be considered in the stress and deformation analyzes.
2
EXPERIMENTAL DEVICE AND MEASUREMENT
Two types of original experimental devices for the measurement of warping effects in thin-walled beams were
designed (Fig. 1). Type I, made in 2011, is characterized by vertical position of the beam specimen. The device
was applied in both hollow- and open-section beam measurements giving accurate results published in [5].
However, its prime disadvantage is the given distance between the torque and fixed support. The Type II with a
horizontal specimen position, built in 2013, allows an arbitrary torque position plus a variety of boundary
conditions at various beam position (e.g. at beam's ends). Using both devices the twist angle, the free-end crosssection warping and the normal stress caused by bimoment can be measured.
Experimental results published in this paper were obtained using the Type II experimental device. The RHS
beam was loaded by torsion moment at one end and fixed at another. Normal stresses were measured using the
strain gages. Measured and numerical results for the normal stress are presented in Fig. 2. A good agreement of
both the results was obtained. The geometry and material properties of the beam are described in the full paper in
detail.
1
prof. Ing. Justín Murín, DrSc., Department of Applied Mechanics and Mechatronics, IAMT FEI STU in
Bratislava, Ilkoviþova 3, 812 19 Bratislava, Slovakia, +421 (2) 60 291 611, [email protected]
~ 147 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
No rma l stress ıȦ [M Pa]
Fig. 1. Type I (on the left) and Type II (at the right) original experimental devices.
16
14
12
10
8
6
4
2
0
calculated
measured
0
10
20
30
40
50
Gauge position x [mm]
Fig. 2. Comparison of analytical and measured normal bimoment stresses at gauges' positions (at the clamped
beam end), (torque MT = 60 Nm) (at the free beam end).
3
CONCLUSION
The article presents results from measurements of an HRS beam loaded by non-uniform torsion. Experimental
results of normal stresses close to the beam’s fixed end obtained by the newly designed device were compared
with the numerical calculation similar to [5]. These measured results confirm the significance of warping effects
consideration also in the hollow-section beams.
ACKNOWLEDGEMENT
The research on which this paper is based was supported by the APVV (project No.: SK-AT-0001-12), and the
Grant Agency VEGA (grant No.: 1/0534/12).
REFERENCES
[1] V.Z. Vlasov, "TenkostČnné pružné prúty", Praha, SNTL, 1962.
[2] K. Roik, G. Sedlacek, " Theorie der Wölbkrrafttorsion unter Berücksichtigung der sekundären
Schubverformungen -Analogiebetrachtung zur Berechnung des querbelasteten Zustabes", Stahlbau, 35,43,
1966.
[3] H. Rubin, "Wölbkrafttorsion von Durchlaufträgern mit konstantem Querschnitt unter Berücksichtigung
sekundärer Schubverformung", Stahlbau, 74 Helf 11, 826, 2005.
[4] EC-3 Eurocode 3. Desing of steel structures.
[5] J. Murín, T. Sedlar, V. Kralovic, V. Goga, A. Kalas, M. Aminbaghai, "Numerical Analysis and
Measurement of Non-uniform Torssion" In Proceedings of the Eleventh International Structures
Technology, Dubrovnik, B.H.V. Topping (Editor), Civil-Comp Press, 20012.
~ 148 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
SPACIAL GEOMETRICAL IMPERFECTIONS
IN CALCULATIONS OF STEEL PLATE GIRDERS
L. Niewiadomski1
Abstract
Actual building structures and their elements are encumbered with initial imperfections and faults. These faults
are introduced into the global analysis of the structure in the form of supplementary global imperfections (initial
tilts) and local imperfections (initial bows). Local imperfections can in the calculations be treated in two
different ways, viz. introducing the initial bows of the elements into the static analysis of the structure (full
analysis) or only in the course of dimensioning as coefficients of buckling and lateral torsional buckling
(simplified analysis). When these imperfections exceed the values predicted concerning supplementary standard
imperfections, they ought to be always applied in the static analysis of the structure as actual tilts and actual
initial bows of the elements. This paper presents a way of assessing the influence of geometrical imperfections,
such as bows and torsions of the elements on the effort of steel plate girders. In order to apply computer
programmes for the purpose of calculating bar structures, a truss model of a plate girder is used, permetting to
model in a simple way a steel plate girder with spatial bows and torsions, alternatively distributed along the
element.
Key Words
Geometrical imperfections, steel plate girder, truss model.
1
WSTĘP
Rzeczywiste konstrukcje budowlane oraz ich elementy są obarczone niedoskonałościami i wadami
początkowymi nazywanymi imperfekcjami. Przepisy (normy projektowania, np. [7], [8]) określają dopuszczalne
wartości tolerancji (odchyłek długości, prostoliniowości, wstępnego wygięcia) w stosunku zarówno do
poszczególnych elementów konstrukcyjnych jak i całej zmontowanej konstrukcji. Zdarzają się jednak przypadki
wystąpienia w zmontowanej konstrukcji imperfekcji geometrycznych takich jak wygięcia i skręcenia elementów
o wartościach przekraczających, niekiedy znacznie, wartości normowe (rys. 1 i 2, zamieszczone w pełnej wersji
referatu). Jeżeli imperfekcje przekraczają wartości przewidziane dla normowych imperfekcji zastępczych, to
należy zawsze wprowadzać je do analizy statycznej konstrukcji, w postaci rzeczywistych przechyłów, skręceń i
wygięć elementów. Dokładna analiza wpływu takich imperfekcji wymaga, w przypadku belek pełnościennych,
użycia zaawansowanych programów komputerowych, pozwalających na przestrzenne ich zamodelowanie i
nadanie im zadanych przemieszczeń wstępnych.
W celu umożliwienia wykorzystania, do oceny wpływu imperfekcji geometrycznych, programów
komputerowych do obliczania konstrukcji prętowych, wprowadzono kratownicowy model pełnościennego
dźwigara blachownicowego. Pozwala on w prosty sposób zamodelować belkę pełnościenną z przestrzennymi
wygięciami i skręceniami, zmiennie rozłożonymi na długości elementu.
1
Lesław Niewiadomski Ph.D, Silesian University of Technology in Gliwice, Faculty of Civil Engineering,
Poland, 44-100 Gliwice, ul. Akademicka 5, e-mail: [email protected]
~ 149 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
2
October 2013, Bratislava
MODEL KRATOWNICOWY DŹWIGARA PEŁNOŚCIENNEGO
2.1 Założenia
Przy tworzeniu modelu przyjęto następujące założenia:
− przekroje pasów dobrano tak, aby moment bezwładności przekroju kratownicy był taki sam jak dźwigara
blachownicowego,
− przekroje krzyżulców dobrano z warunku równości odkształceń postaciowych środnika blachownicy i
skratowania dźwigara kratowego,
− w celu uwzględnienia wpływu zginania i skręcania pasów na skręcanie dźwigara kratowego jako całości,
wprowadzono słupki w postaci cienkich żeber poprzecznych, zapewniające nieodkształcalność przekrojów
poprzecznych w ich płaszczyznach zgodnie z I hipotezą teorii Własowa [4] skręcania prętów
cienkościennych o przekroju otwartym.
2.2
Przyjęcie przekroju kratownicy
2.2.1 Wysokość kratownicy
Odległość osiową między górnym i dolnym pasem kratownicy przyjęto równą osiowemu rozstawowi pasów
pełnościennej belki blachownicowej.
2.2.2 Przekroje pasów
Wymiary elementu pionowego pasa kratownicy tx x hx (rys. 3) dobrano z warunków równości momentów
bezwładności przy zginaniu ( I xB , I xK ) i skręcaniu ( I TB , I TK ) blachownicy i kratownicy (1).
I xK = I xB ,
I TK = I TB ,
(1)
przy czym wprowadzono następujące uproszczenia:
− pominięto moment bezwładności elementu tx x hx względem własnej osi,
− nie odjęto fragmentu tf x tx na skrzyżowaniu elementu poziomego i pionowego pasa kratownicy,
− przyjęto hp=hw.
Rys. 3. Przyjęcie wymiarów pasów modelu kratownicowego
Otrzymano [2] następujące wzory na tx i hx:
tx =
b
a
,
hx = a
a
b
,
gdzie:
a=
1
t w hw
6
i
b=
1
hw t w3
2
(2)
Pasy przyjęto jako ciągłe na całej długości kratownicy zarówno w płaszczyźnie kratownicy jaki i w płaszczyźnie
do niej prostopadłej. Uciąglenie pasów w płaszczyźnie kratownicy prowadzi do powstania w nich niewielkich
lokalnych momentów zginających Mx. Momenty te można wyeliminować wprowadzając przeguby cylindryczne
w węzłach pasów. Ponieważ przyjęcie pasów ciągłych w obu płaszczyznach nie wpływa praktycznie na wartości
sił osiowych i momentów My w pasach oraz przemieszczeń węzłów (dla obciążeń testowych wpływ ten nie
przekroczył 1%), zastosowano je w modelu kratownicowym w celu jego uproszczenia. W obliczeniach
wytrzymałościowych lokalne momenty Mx należy pominąć.
~ 150 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
2.2.3
October 2013, Bratislava
Słupki
Słupki, których zadaniem jest zapewnienie nieodkształcalności konturu przekroju poprzecznego belki, przyjęto o
przekroju poprzecznym bf x 1 mm. Połączenie słupków z pasami w kierunku prostopadłym do płaszczyzny
kratownicy przyjęto jako sztywne.
2.2.4 Skratowanie
Przekrój skratowania przyjęto z warunku równości sztywności środnika blachownicowego i skratowania na
ścinanie.
Z porównania wyrażeń na odkształcenie postaciowe środnika blachownicy vbl (rys. 4, zamieszczony w pełnej
wersji referatu) i skratowania v pr (rys. 5, zamieszczony w pełnej wersji referatu) otrzymano [2] wyrażenie na
potrzebny przekrój skratowania:.
vbl = v pr ,
stąd
Ak =
G
ht
,
2
E sin α cos α
(3)
1
Ak .
2
Połączenie krzyżulców z pasami kratownicy przyjęto jako przegubowe w płaszczyźnie kratownicy i w
płaszczyźnie do niej prostopadłej.
Dla dwóch krzyżujących się prętów, przekrój poprzeczny pojedynczego pręta wyniesie
3
OBLICZENIA TESTOWE
Testy modelu kratownicowego były przeprowadzone przy założeniach upraszczających dotyczących modelu
obliczeniowego belki pełnościennej z przestrzennymi imperfekcjami geometrycznymi, rodzaju obciążenia i
kształtu imperfekcji. Tylko w przypadku belki swobodnie podpartej o przekroju bisymetrycznym obciążonej na
końcach jednakowymi momentami zginającymi Mx, równania różniczkowe równowagi całkują się w funkcjach
trygonometrycznych. Pozwoliło to na dokładne określenie sił wewnętrznych i przemieszczeń w belce
pełnościennej i porównanie ich z wynikami otrzymanymi dla modelu kratownicowego. Pełne obliczenia testowe
przedstawiono w [2]. Do obliczeń testowych przyjęto belkę bez i ze stężeniem pasa górnego, o rozpiętości i
przekroju spotykanych w praktyce. Obliczenia testowe wykonano dla pełnościennego dźwigara dachowego o
schemacie belki wolnopodpartej, rozpiętości l = 15,0m i przekroju poprzecznym wg rys. 6 (zamieszczony w
pełnej wersji referatu). Oznaczenia osi przyjęto wg polskiej normy krajowej [6]. Pasy o przekroju krzyżowym
modelu kratownicowego, których wymiary wyznaczono wg wzorów (2), przedstawiono na rys. 7 (zamieszczony
w pełnej wersji referatu).
Przyjęto obciążenie stałymi momentami na końcach belki ( M x = M = const ) oraz imperfekcje geometryczne w
postaci wygięcia poziomego u i skręcenia ϕ przekroju poprzecznego. Imperfekcje przyjęto w postaci funkcji
π ⋅z
, ϕ = ϕ 0 ⋅ sin
.
l
l
W pracy [2] wyznaczono wzory na przemieszczenia sprężyste w połowie rozpiętości belki wg teorii I i II rzędu.
Znając przemieszczenia sprężyste u~ i ϕ~ , obliczono siły wewnętrzne, odpowiednio wg teorii I i II rzędu, oraz
maksymalne poziome momenty zginające w pasie górnym Myg i dolnym Myd belki blachownicowej.
Obliczenia testowe wykonano dla kilku wartości momentów zginających oraz czterech przypadków imperfekcji
geometrycznych o różnych amplitudach przemieszczenia poziomego u 0 i kąta skręcenia przekroju ϕ 0 (rys.9,
zamieszczony w pełnej wersji referatu).
Przyjęto po 3 różne modele kratownicowe dla belki bez stężenia pasa górnego (rys. 10) i ze stężonym pasem
górnym (rys. 11), różniące się liczbą przedziałów n (n=10, 20, 40).
Przekroje poprzeczne pasów przedstawiono na rys. 7 (zamieszczony w pełnej wersji referatu). Słupki przyjęto z
płaskowników o przekroju 200x1 mm, a skratowanie krzyżowe (por. rys. 10 i 11) z rur okrągłych o przekroju
zależnym od liczby przedziałów n, obliczonym wg wzoru (3). Stężenie pasa górnego zrealizowano poprzez
wprowadzenie niepodatnych podpór uniemożliwiających poziome, prostopadłe do płaszczyzny kraty,
przemieszczenia węzłów pasa górnego kratownicy. Obliczenia statyczne modeli kratownicowych wykonano
programem Robot wg teorii I rzędu (L) oraz II rzędu (NL). Wyniki obliczeń statycznych modeli
kratownicowych porównano z wynikami obliczeń odpowiednich belek pełnościennych.
trygonometrycznych: u = u0 ⋅ sin
π ⋅z
~ 151 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
Rys. 10. Kratownicowy model belki
pełnościennej bez stężenia pasa górnego
4
October 2013, Bratislava
Rys. 11. Kratownicowy model belki
pełnościennej ze stężonym pasem górnym
WNIOSKI
Na podstawie porównania wyników obliczeń statycznych belek pełnościennych i ich modeli kratownicowych
można wyciągnąć następujące wnioski.
1) Przyjęty model kratownicowy dźwigara pełnościennego o przekroju dwuteowym pozwala na
bezpośrednie uwzględnienie wpływu skrępowanego skręcania na wartości sił przekrojowych w pasach
dźwigara, tzn. wpływu bimomentu Bω i momentu giętno-skrętnego Mω [2]. Można przy tym w
stosunkowo prosty sposób – przy użyciu programów komputerowych dla konstrukcji prętowych –
ocenić wpływy ponadnormatywnych przestrzennych imperfekcji geometrycznych w zrealizowanych
konstrukcjach, jak i stosować w projektowaniu sprężystym tzw. model zaawansowany, w którym
imperfekcje są uwzględniane na poziomie analizy statycznej.
2) Oceniając wpływ geometrycznych imperfekcji przestrzennych na wielkość sił wewnętrznych i
przemieszczeń, obliczenia należy prowadzić wg teorii II rzędu (NL). Wyniki obliczeń wg teorii I rzędu
(L) są niewiarygodne i mogą prowadzić do istotnego (dochodzącego do kilkuset %) zaniżenia lub
zawyżenia wartości sił wewnętrznych i przemieszczeń.
3) W zakresie nieliniowym (NL) – tzn. wg teorii II rzędu – dla belki bez stężenia pasa górnego i gęstości
podziału modelu kratownicowego n=20 modele kratownicowe dają wartości mniejsze od dokładnych
wartości obliczonych dla belki pełnościennej. Dla obciążeń rzędu 0,9 obc. krytycznego można przyjąć,
że przy zastosowaniu modelu kratownicowego obliczone wartości poziomych momentów zginających
w pasach My i przemieszczeń poziomych ux są o ok. 10%, a wartości ugięć uy o ok. 15% mniejsze od
wartości dokładnych. Dla mniejszych obciążeń różnice te będą jeszcze mniejsze.
4) W przypadku belek z niepodatnym stężeniem pasa górnego obliczonych wg teorii II rzędu (NL) można
dla rzeczywistych konstrukcji przyjąć wyniki uzyskane dla modelu kratownicowego jako miarodajne.
5) Gęstość podziału modelu kratownicowego n należy dobrać w zależności od konstrukcji dachu oraz
rzeczywistego przebiegu imperfekcji. Wystarczającym i optymalnym wydaje się podział na 20
przedziałów.
LITERATURA
[1]
Niewiadomski L.: Wpływ nadmiernych imperfekcji geometrycznych na nośność stalowych dźwigarów
dachowych budowanej hali, Inżynieria i budownictwo, 5/2006.
[2]
Niewiadomski L.: Wpływ imperfekcji geometrycznych stalowych dźwigarów dachowych na stan naprężeń
i przemieszczeń konstrukcji dachowej. Praca doktorska, Pol. Śląska, Gliwice 2007.
[3]
Niewiadomski L.: Wady stalowej konstrukcji dachu zmodernizowanej hali przemysłowej, XXV
Konferencja Naukowo–Techniczna „Awarie budowlane”, Szczecin – Międzyzdroje, 24-27 maja 2011.
[4]
Własow W. Z., „Tonkostiennyje uprugije stieržni”, Moskwa, GIFML 1959r.
[5]
PN-EN 1993-1-1:2006/AC 2009: Eurokod 3: Projektowanie konstrukcji stalowych. Część 1-1: Reguły
ogólne i reguły dla budynków.
[6]
PN-B-03200: 1990: Konstrukcje stalowe. Obliczenia statyczne i projektowanie.
[7]
PN-B-06200:2002 Konstrukcje stalowe budowlane. Warunki wykonania i odbioru. Wymagania
podstawowe.
[8]
PN-EN 1090-2:2009: Wykonanie konstrukcji stalowych i aluminiowych. Część 2: Wymagania techniczne
dotyczące konstrukcji stalowych.
~ 152 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
THE INFLUENCE OF GEOMETRICAL IMPERFECTIONS OF
ROOF TRUSSES ON THE INTERNAL FORCES IN THE
ELEMENTS IN THE STRUCTURE OF THE ROOF
OF AN ASSEMBLY HALL
L. Niewiadomski1 and J. Zamorowski2
Abstract
Building structures and their elements are geometrically and materially not ideal, but encumbered with
imperfections. Due to the difficulty of taking fully into account in the design the effect of imperfections on the
behaviour of such a structure, the standards provide simplifications, concerning mainly the application of flat
models of calculations, neglecting local imperfections in the analysis of the structure. In so-called advanced
models both kinds of imperfections (global and local ones) are introduced already while analyzing the structure,
both in the case of elastic and plastic designing. Making use of the spatial model of calculations, the paper
presents the mechanism of arising of the forces of lateral reactions of the compressed flanges of the roof trusses
as well as their influence on the values of the internal forces in the bars of the trusses, the purlins and the
bracings. The values of calculations carried out in compliance with the standard have been compared, and it has
been found that, for instance, in the standard procedure the initial torsion of the truss affecting the forces in the
bottom flange, cannot be taken into consideration.
Key Words
Geometrical imperfections, roof trusses.
1
WSTĘP
Rzeczywiste konstrukcje budowlane i ich elementy nie są idealne pod względem geometrycznym
i materiałowym, ale są obarczone imperfekcjami. Pełne uwzględnienie w projektowaniu wpływu imperfekcji na
zachowanie się konstrukcji jest zadaniem trudnym i złożonym. W przepisach normowych wprowadzono
uproszczenia polegające głównie na stosowaniu płaskich modeli obliczeniowych i pomijaniu imperfekcji
lokalnych na etapie analizy konstrukcji. W tzw. modelach zaawansowanych oba rodzaje imperfekcji (globalne
i lokalne) wprowadza się jednak już na etapie analizy konstrukcji, zarówno w projektowaniu sprężystym jak
i plastycznym.
W normach [3] i [4] uwzględnienie wpływu imperfekcji konstrukcji dachowych sprowadza się do wyznaczenia
poprzecznych (bocznych) oddziaływań wstępnie wygiętych ściskanych pasów dźwigarów i obciążenia nimi
poprzecznych tężników połaciowych. Wg Eurokodu 3 [3] imperfekcje można również uwzględnić bezpośrednio,
nadając ściskanym pasom dźwigarów wstępne wygięcia lub załamania.
1
2
Lesław Niewiadomski Ph.D, Silesian University of Technology in Gliwice, Faculty of Civil Engineering,
Poland, 44-100 Gliwice, ul. Akademicka 5, e-mail: [email protected]
Jan Zamorowski Ph.D, Silesian University of Technology in Gliwice, Faculty of Civil Engineering, Poland,
44-100 Gliwice, ul. Akademicka 5, e-mail: [email protected]
~ 153 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
2
October 2013, Bratislava
MODELE OBLICZENIOWE W ANALIZIE ŚCISKANYCH PASÓW WIĄZARÓW
2.1 Płaski model obliczeniowy
W normach projektowania [3], [4] wpływ sił bocznego oddziaływania ściskanych pasów wiązarów dachowych
potraktowany jest jako zagadnienie płaskie, występujące w płaszczyźnie połaci dachu. Początkowe wygięcia
pasa wg [3] traktowane są jako wygięcia zastępcze, ujmujące wpływ wszystkich imperfekcji ściskanego pasa
wiązara. W normie [4] podaje się natomiast wzory na wartości sił w płatwiach wewnętrznych od oddziaływania
bocznego wygiętych początkowo ściskanych pasów wiązarów. Siły oddziaływania każdego pasa wiązara na
płatwie wewnętrzne są w równowadze z jego oddziaływaniami na płatwie skrajne, co pozwala określić wartości
sił w płatwiach skrajnych oraz prowadzi do wniosku, że poprzeczne tężniki połaciowe pozostają w równowadze
pod obciążeniem siłami oddziaływania płatwi wewnętrznych i skrajnych. Potwierdzają to wyniki uzyskane dla
pięciopolowego symetrycznego układu płaskiego z antysymetrycznie załamanymi prętami – rys. 1
(zamieszczony w pełnej wersji referatu). Zwraca uwagę antysymetryczny przebieg siły osiowej w płatwiach
skrajnych i związane z tym przebiegiem zerowe wartości sił oddziaływania podłużnych prętów podporowych
(R) założonych w narożach układu. Nie ma więc statycznego uzasadnienia dla – stwierdzonego w niektórych
krajowych publikacjach jak i w praktyce projektowej – przyjęcia, że siły oddziaływania płatwi na poprzeczne
tężniki połaciowe wynikłe z wygięcia ściskanych pasów wiązarów są przekazywane na pionowe tężniki ścienne.
2.2 Przestrzenny model obliczeniowy
Siły oddziaływania bocznego są w rzeczywistości wynikiem działania obciążenia pionowego na przestrzenną
konstrukcję dachową z wiązarami o pasach wstępnie poziomo wygiętych lub załamanych. Powoduje to
powstanie dodatkowych sił wewnętrznych również w prętach wiązarów i pionowych tężnikach dachowych,
które mogą być wyznaczone tylko za pomocą przestrzennego modelu obliczeniowego. Poniżej przedstawiono,
na prostym przykładzie (rys. 2), mechanizm powstawania sił oddziaływania bocznego ściskanego pasa wiązara
dachowego i ich wpływ na wartości sił wewnętrznych w prętach układu. Ograniczono się przy tym do załamania
pasa ściskanego. W miejscu załamania wiązar obciążono pionową siłą węzłową P. Dodatkowe obciążenia
węzłów wiązara siłami poziomymi H1 (od załamania pasa górnego) i H2 (od przechyłu słupka środkowego)
zrównoważone są siłami H1 + H2 oddziaływania pręta kalenicowego na węzeł górny i siłą H2 poprzecznego
oddziaływania pasa dolnego na węzeł dolny. Przepisy norm [3] i [4] (w przypadku zastąpienia imperfekcji
łukowych równoważnym obciążeniem stabilizującym qd) uwzględniają wpływ siły H1, pomijają natomiast
zginanie pasa dolnego w płaszczyźnie poziomej siłą H2 oraz dodatkowe siły w stężeniach okapowych.
Rys. 2. Analizowany segment konstrukcji dachowej (zwroty pokazują oddziaływanie sił na węzły)
3
ANALIZA WYBRANYCH POJEDYNCZYCH WIĄZARÓW DACHOWYCH
W analizie pojedynczych dźwigarów dachowych z imperfekcjami geometrycznymi zastosowano przestrzenny
model obliczeniowy. Analizę wpływu wygięcia i załamania pasów dźwigarów kratownicowych na wielkości
sił w prętach dźwigarów przeprowadzono na przykładzie pojedynczych, dwutrapezowych wiązarów
kratowych o rozpiętości 24,0 m, wysokości w środku przęsła 3,0 m i nachyleniu pasa górnego 10% (rys. 3). Pasy
górny i dolny przyjęto jako ciągłe, a połączenia prętów z pasami jako przegubowe. Podpory prostopadłe do
~ 154 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
płaszczyzny wiązara w węzłach pasa górnego stanowią płatwie dachowe, a podpora w węźle środkowym pasa
dolnego pionowe stężenie kalenicowe.
Rys. 3. Schematy (sch.) konstrukcyjne wiązarów
Wzięto pod uwagę 5 schematów konstrukcyjnych wiązarów (por. rys. 3) różniących się między sobą wielkością i
kształtem wygięć pasów dźwigarów oraz sposobem podparcia w środkowym węźle pasa dolnego i na podporach.
Dokładny opis przyjętych schematów zawarto w pełnej wersji referatu.
Jednowiązarowe konstrukcje odpowiadające schematom 1 ÷ 5 potraktowano w obliczeniach jako przestrzenne
układy prętowe, z uwzględnieniem wpływu efektu P-Δ (wpływ przemieszczeń prostopadłych do osi prętów na
warunki równowagi węzłów).
Wyniki obliczeń wiązarów, z wygięciami i obciążeniami przyjętymi wg Eurokodu 3 [3], o schematach
konstrukcyjnych 1 ÷ 5 , wykonanych programem Robot wg teorii I rzędu (liniowej - L) i II rzędu (nieliniowej –
NL, tzn. z uwzględnieniem efektu P-Δ), zestawiono w tablicach 1, 2 i 3 (zamieszczone w pełnej wersji referatu).
Pełną analizę jakościową i ilościowa otrzymanych wyników przedstawiono w pełnej wersji referatu.
4
ANALIZA SEGMENTU HALI
W celu porównania otrzymanych wyników obliczeń dla układów jednowiązarowych z wynikami dla
przestrzennego układu halowego obliczono, z użyciem programu Robot, segment hali o rozpiętości 24,0 m,
długości 42,0 m i wysokości do poziomu oparcia wiązarów 8,0 m. Przyjęto dwuścienne wiązary dwutrapezowe
wg schematu 1a (por. rys. 3), podparte na poziomie pasa dolnego, z wygięciem początkowym pasa górnego
w jedną stronę równym 1/500 ich rozpiętości (rys. 4, zamieszczony w pełnej wersji referatu). W celu uzyskania
porównywalnych wyników pominięto w schemacie konstrukcyjnym hali podłużne stężenia połaciowe, a stężenia
poprzeczne przyjęto typu X z prętami pracującymi na rozciąganie i ściskanie. Przyjęto takie same obciążenia
pionowe jak dla układów jednowiązarowych. W tablicy 4 (zamieszczona w pełnej wersji referatu) zestawiono
obliczone wartości sił osiowych Ni (siła w płatwi w polu i), różnic sił ∆Ni-i+1 oraz średniej siły w płatwiach ΔNśr
dla segmentu hali. Wykresy poziomych momentów zginających w pasach dolnych przedstawiono na rys. 5
(zamieszczony w pełnej wersji referatu).
Wyniki obliczeń wg teorii II rzędu (NL) uzyskane dla segmentu hali (tab. 4) porównano z wynikami dla układu
jednowiązarowego 1a(NL). Analizę uzyskanych wyników zawarto w pełnej wersji referatu.
5
WNIOSKI
Na podstawie przeprowadzonych analiz obliczeniowych pojedynczych wiązarów dachowych oraz segmentu hali
z imperfekcjami geometrycznymi można sformułować następujące wnioski:
1) Podawane w normach projektowania [3] i [4] płaskie modele obliczeniowe z określonymi a priori siłami
oddziaływania bocznego ściskanych, początkowo wygiętych pasów wiązarów pozwalają tylko
~ 155 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
2)
3)
4)
5)
6)
7)
8)
9)
October 2013, Bratislava
w przybliżeniu ocenić dodatkowe siły w prętach podpierających (płatwiach) i poprzecznych tężnikach
połaciowych; nie jest np. możliwe określenie wpływu oddziaływania tężnika kalenicowego na wartości
dodatkowych sił w prętach tężnika połaciowego.
Poza kontrolą pozostają dodatkowe siły w pozostałych prętach konstrukcji dachu, np. dodatkowe siły
w skrajnych płatwiach, a w szczególności dodatkowe siły przekrojowe (siły poprzeczne i momenty
zginające) w prętach pasa dolnego, które niekiedy mogą współdecydować (jak w przypadku wiązara z pasem
dolnym niedochodzącym do podpór – schemat 3a, czy z pasem z ½ I – schemat 1b) o jego nośności.
Siły bocznego oddziaływania ściskanych pasów wiązarów, jako siły wewnętrzne będące wynikiem
pionowego obciążenia odkształconej początkowo konstrukcji dachu, nie wywołują w prętach statycznie
wyznaczalnych stężeń ściennych (np. typu X pracujących tylko na rozciąganie) żadnych sił wewnętrznych.
Siły te równoważą się w obrębie konstrukcji dachu. Dodatkowe siły powstaną jedynie w prętach tężników
statycznie niewyznaczalnych (np. typu X pracujących na rozciąganie i ściskanie), na skutek ograniczenia
przez stężenie swobody odkształceń poziomych elementów konstrukcji dachu, stanowiących część
konstrukcji stężenia.
Miarodajnymi parametrami do określenia dodatkowych sił od odkształceń początkowych wiązarów
dachowych są wygięcia początkowe lub załamania górnego pasa wiązarów. Równoczesne wygięcie lub
załamanie obu pasów powoduje na ogół zmniejszenie dodatkowych sił w konstrukcji dachu.
Z uwagi na istotny wpływ efektu P-Δ na momenty zginające i przemieszczenia w dolnym pasie wiązarów
(w płaszczyźnie prostopadłej do płaszczyzny wiązarów) oraz wymienione niedoskonałości modelu płaskiego,
najwłaściwszym do analizy statycznej jest przestrzenny nieliniowy imperfekcyjny model obliczeniowy całej
konstrukcji (NL). Dodatkowe siły w konstrukcji należałoby wyznaczać dla zredukowanych w zależności od
liczby wiązarów, zgodnie z [3] lub [4]), wartości odkształceń początkowych. Jedynie dodatkowe siły
przekrojowe w dolnym pasie wiązarów, jako niezależne od ich liczby, należałoby obliczać dla wartości
niezredukowanych.
W przypadku stosowania w obliczeniach równoważnych obciążeń stabilizujących zamiast wstępnych wygięć
[3], dodatkowe siły przekrojowe w dolnym pasie wiązarów można wyznaczać stosując jednowiązarowy
model przestrzenny z wygiętym wstępnie pasem górnym.
Dolny pas wiązarów podpartych na poziomie pasa górnego – zwłaszcza jednościennych (typ b) – powinno
się konstrukcyjnie doprowadzać do podpór (słupów).
W przypadku stosowania wiązarów opartych na poziomie pasa górnego z pasem dolnym nie
doprowadzonym do podpór należy rozważyć – w celu zmniejszenia momentów zginających i przemieszczeń
poziomych pasa dolnego – dodatkowe jego podparcie w kierunku poprzecznym lub zwiększenie jego
sztywności w kierunku poziomym, np. poprzez zastosowanie dźwigarów dwuściennych (typ a).
Wymagane przepisami normowymi [4] pionowe stężenia wiązarów (w rozstawie l ≤ 15 m) zmniejszają
w istotny sposób wartości poziomych przemieszczeń i momentów zginających w pasach dolnych wiązarów.
Powinny więc być one stosowane zawsze na całej długości dachu, przy czym poza polami poprzecznych
stężeń połaciowych mogą je stanowić oprócz płatwi np. pręty łączące dolne pasy dźwigarów.
LITERATURA
[1]
L. Niewiadomski: Wpływ początkowych wygięć pasów wiązarów na stan naprężeń w konstrukcji dachu.
XLVIII Konferencja Naukowa „Krynica 2002”, Opole-Krynica 15-20 września 2002.
[2]
Niewiadomski L.: Wpływ imperfekcji geometrycznych stalowych dźwigarów dachowych na stan naprężeń
i przemieszczeń konstrukcji dachowej. Praca doktorska, Pol. Śląska, Gliwice 2007.
[3]
PN-EN 1993-1-1:2006/AC 2009: Eurokod 3: Projektowanie konstrukcji stalowych. Część 1-1: Reguły
ogólne i reguły dla budynków.
[4]
PN-B-03200: 1990: Konstrukcje stalowe. Obliczenia statyczne i projektowanie.
[5]
PN-B-06200:2002 Konstrukcje stalowe budowlane. Warunki wykonania i odbioru. Wymagania
podstawowe.
[6]
PN-EN 1090-2:2009: Wykonanie konstrukcji stalowych i aluminiowych. Część 2: Wymagania techniczne
dotyczące konstrukcji stalowych.
~ 156 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
MODELING OF 2D CIRCULAR CYLINDER IN ANSYS BY USING
TURBULENCE MODELS. THE EXPERIMENT PREPARATION
Ivana Oleksakova1 and Marek Magat2
Abstract
The task of this article describes basic equations used in the mathematical modeling of fluid flow and
application in simple problem of the flow around the cylinder, which is solved by software ANSYS/FLOTRAN.
The application section describes the flow of compressible Newtonian fluid as a system of partial differential
equations (the Navier-Stokes equation) and solves these equations. Simplifying a 3D task to a plane problem and
ignoring vorticity we are able to find the velocity and pressure distribution around the cylinder. This article is
the most concentrated on the mathematical modeling of the easy problem with fluid flowing around the cylinder.
At the end is described the experiment which is planed for next few months for verify the results from simulation.
In this part is introduced the method for measurement of pressure around the model and the initial velocity.
Keywords:
turbulence models; RANS-based models; fluid flowing; measure of pressure and velocity;
1
INTRODUCTION
In the aerodynamics of structures it is necessary to determine the wind load, which is represented by a simplified
set of pressures or forces for the whole structure, or for the structural parts.
The structures, which are sensitive to the wind and wind is dominant design factor such as slender and long
structures are sensitive to the wind effects. The recent years were accompanied by the rise of the wind storms
and height of wind velocity. Circular cylinders for example light masts, chimneys, towers, cables, open frames
and structural elements or open lattice structures with circular cross section are frequently used in civil
engineering structures.
2
FLUID FLOWS
The instantaneous state of the flow at each point of the space is uniquely determined by the particle
velocity vector at any given location in a given time. The conditions for the fluid flow can be formulated by:
• The balance of the mass,
1
Ing.Ivana Oleksakova, Radlinskeho 11, 81368 Bratislava, Departement of Structural mechanics, 0911 965 195,
[email protected]
2
Ing.Marek Magat, Radlinskeho 11, 81368 Bratislava, Departement of Building structures, 0903 767 535,
[email protected]
~ 157 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
• The balance of the momentum,
• The balance of the energy.
3
USING OF TURBULENCE MODELS – MATHEMATICAL DIFFERENCES
Turbulence modeling is a key issue in most CFD simulations. Virtually all engineering applications are turbulent
and hence require a turbulence model. Here is the classification of turbulence models:
Fig.1. Classes of turbulence models
RANS-models- Reynolds averaged equations model is to compute the Reynolds averaged equations. Those
equations are time-averaged equations of motion for fluid flow. The idea behind the equations is Reynolds
decomposition, whereby an instantaneous quantity is decomposed into its time-averaged and fluctuating
quantities, an idea first proposed by Osborne Reynolds. The RANS equations are primarily used to describe
turbulent flows. These equations can be used with approximations based on knowledge of the properties of flow
turbulence to give approximate time-averaged solutions to the Navier-Stokes equations.
4
RESULTS OF CFD MODELLING
Problem can be completed using finite element method (FEM). Solving such problems in fluid flow is often time
consuming and computationally demanding. Therefore, if it is allowed, it is very good to create 2D model with
appropriate boundary conditions instead of difficult 3D model. In our case boundary conditions have been
specified following:
RESULTS OF CFD MODELLING
4.1 Evaluation of turbulence models
In general, the problem of mathematical modeling of flow (turbulent flow) is still not completely solved and new
models for better depiction of the problem are generated. Software we are working in, Ansys, has incorporated
certain types of turbulent models.
In Ansys/Flotran it is possible to choose from all of those turbulent models:
• Standard k-epsilon model
• Zero-equation turbulence model
• Re-Normalized Group Turbulence Model (RNG)
• k-epsilon Model due to Shih(NKE)
~ 158 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
•
•
•
•
October 2013, Bratislava
Nonlinear Model of Girimaji (GIR)
Shih, Zhu, Lumley Model (SZL)
k-omega Turbulence Model
Shear Stress Transport Model (SST)
4.2 Comparison of turbulence models
In this section are results from analysis of different turbulence models tested in Ansys/Flotran.
Tab.1. Comparison of all tested turbulence models
5
PLANNED EXPERIMENT IN BLWT TUNNEL IN BRATISLAVA
Boundary layer wind tunnel in Bratislava is designed as a vacuum tunnel (open-circuit also called openreturn wind tunnel). It means that the pressure in the non-operational tunnel is identical to the ambient
barometric pressure. Unless the tunnel is in operation, the static pressure is reduced at the detriment of the
dynamic pressure.
The static pressure is measured by using static tubes and probes (wall tap). These devices are placed
perpendicular to the air flowing. Static probes in the walls of the tunnel to check the load of wind tunnel walls
must not interfere with the flow and are also sufficient for detecting the load of the ceiling of the tunnel. The
pressure probes were placed in opposite walls in about two thirds of the total clearance of the tunnel and always
two devices were joined into a single pressure sensor located on the outside of the tunnel roof, where it had to be
ensure the same length of tubing from probes to the sensor. For the pressure monitoring in our tunnel, we used
16 pressure sensors with a range of + / - 5'' WC (water column) [4]. The use of a wall taps is allowable because
the flow is presumed and essentially parallel. Under parallel-flow conditions eq .(5), which is Euler´s equation,
written along coordinate axis that is normal to the streamline, indicates that the curvature of the local streamlines
is extremely large, which causes the pressure gradient in the direction perpendicular to the streamlines to be zero,
making the pressure constant in the direction normal to the streamline.
Fig. 2. Pitot static pressure probe
~ 159 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
The pressure sensors convert pressure into electrical quantity and according to all that we are able to store and
process data on a computer, eventually sharing measurement with controls systems of the tunnel. That means for
instance to control of the velocity of airstream in the tunnel etc.
6
CONCLUSION
Graphs of the pressure and velocity show that the differences are not significant and for engineering practice in
this case would not be so important. However, this issue should be more examined both for 3D models and for
other types of shapes; and structures or additional all groups of buildings (we have to know how they influence
each other). Thus we find out that the selection of turbulent model does not significantly affect the pressure
values or to what extent the results are influenced by turbulent model and which from those models is the most
suitable for our application in civil engineering.
At this stage of research we can say that the choice of the turbulence model for 2D tasks for pressure
distribution around the shape has no big importance because the values of pressure for different turbulence
models are almost the same and comparative. For the next months we want to do experiment with this velocity in
BLWT in Bratislava and do more simulations and experiments with different shapes and velocities with the way
described in this article, possibly with new devices.
ACKNOWLEDGEMENT
The presented results were achieved under sponsorship of the Grand Agency VEGA of the Slovak Republic
(grant.reg. No.1/0480/13).
REFERENCES
[1]
ANSYS, Fluids analysis Guide, November 2010, www.ansys.com, 232 pages
[2]
BIELEK M., ČERNÍK P., TAJMÍR M.,: Aerodynamic of buildings, ALFA, 1990, 192 pages (in Slovak
language)
[3]
MASAMI SATO, TAKAYA KOBAYASHI: A fundamental study of the flow past a circular cylinder
using Abaqus/CFD, SIMULIA Community Conference, 2012
[4]
GENICK Bar-Meir: Basic of Fluid Mechanics, Chicago, 2011, 452 pages
[5]
FERZIGER J.H. , PERIC M.: Computational Methods for Fluid Dynamics, Springer Verlag, 1999, second
edition, ISBN: 354065732, 400 pages
[6]
ANDERSON J.D.: Computational Fluid Dynamics: The Basics with Applications, McGraw Hill publisher,
1995, 6th edition, 545 pages
[7]
CHUNG T.J: Computational Fluid Dinamycs: Cambridge University Press, 2002, 1012 pages
[8]
LIU Henry: Wind Engineering: A Handbook For Structural Engineering, Pearson Education, 1990, 224
pages
[9]
HUBOVA Olga: Wind loads, common European standards for design of supporting structures, training
Standards EU 0-1, Bratislava, November 2004, ISBN 80-227-2141-7 (in Slovak language)
[10] Hubová, - Olekšáková: Wind Effects on circular cylinders, 13th international scientic conference VSU
2013, 6 pages
[11] Bakker Andre: Lecture 10 – Turbulence Models, Applied Computational Fluid Dynamics, Fluent Inc.,
2002
~ 160 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
VLIV PODMÍNEK OKOLÍ NA PROVOZUSCHOPNOST LETIŠTNÍ
DRÁHY
P. Padevt1, Z. Bittnar2 a P. Bittnar3
Abstract
The paper is focused on the investigation the failures, which were observe on the airport Modlin's and concrete
runways. The concrete structure was put to micromechanical investigation of the properties. The focus of
investigation was pointed on the influence of the aggressive matter to the rate of concrete carbonization and
optimal concrete composition.
Klíová slova
Beton, letištní dráha, mikrostruktura betonu, karbonatace, mikroskopie betonu.
1
ÚVOD
Význam letištní dopravy je v souasnosti stále na vzestupu. Množství dopravovaných pasažér% je provázeno
potebou používání vhodných typ% dopravních letadel, jejich provozní zatížitelností v etnosti využívání.
Množství realizovaných let% pináší tlak na maximální využívání kapacit letiš. Jsou-li dopravní kapacity letiš
tém využity vyvstává otázka vybudování nových letiš, respektive rozšíení stávajících možností v jejich
využívání.
Jedním z píklad% je msto Varšava, v jehož okolí je budováno letišt, které m%že svou kapacitou doplnit
množství pepravovaných pasažér% do a z msta. Letišt Modlin se nachází severozápadn od msta Varšava. S
potebou vybudování letišt souvisela i poteba postavit rozjezdovou dráhu pro letadla.
Rozjezdové dráhy letadel se budují ve dvou variantách. První možností je vybudovat asfaltovou dráhu a druhou
možností je vytvoení dráhy z betonu. V pípad popisovaného letišt se jednalo o 24 cm silnou betonovou desku
z betonu ureného pro betonování tlustých desek. Betonáž dráhy probíhala ve dvou fázích První fáze spoívala
ve vybetonování 12 cm vrstvy betonu. Pozdji, ješt do nezatuhlé betonové desky byla pokládána druhá 12 cm
vrstva betonu, jejíž povrch byl fináln upravován do konené podoby k pojezdu letadel. V obou pípadech byla
použita technologie kladení betonu pomocí finišeru s jeho okamžitým zhutnním.
Problematická ást letištní dráhy se týkala dvou etap provádní dráhy, kdy v první etap bylo do betonové vrstvy
pidáváno kamenivo výrobce Lafarge. Druhá etapa se lišila od první použitím kameniva výrobce Cemex.
1
Ing. P. Padevt, Ph.D., Thákurova 7, Praha 6, &eská republika, &VUT v Praze, Fakulta stavební, +420 224 354
484, [email protected]
2
Prof. Ing. Z. Bittnar, Thákurova 7, Praha 6, &eská republika, &VUT v Praze, Fakulta stavební, +420 224 354
484, [email protected]
3
Ing. P. Bittnar, Thákurova 7, Praha 6, &eská republika, &VUT v Praze, Fakulta stavební, +420 224 354 484,
[email protected]
~ 161 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
2
October 2013, Bratislava
KAMENIVO, BETON
Oba druhy kameniva se navzájem odlišují druhem kameniva zastoupeným v požadovaném vymezení frakcí.
Kivka zrnitosti kameniva byla shodná pro oba druhy kameniva. Kamenivo se skládalo ze 4 frakcí: 0 - 2 mm; 2 8 mm; 8 - 16 mm a 16 - 32 mm. V obou pípadech se kivky zrnitosti nacházely mezi limity danými normovými
požadavky pro plynulou kivku zrnitosti kameniva vhodného do betonu.
Pro budování letištní dráhy byly použity dva druhy betonu. První beton byl zaazen do kategorie C 20/25 XC2
[1]. Navrhovaný vodní souinitel byl 0,5. Druhý beton byl kategorie C 35/45 XF4 [2]. V tomto pípad ml
vodní souinitel hodnotu 0,37. Složení betonové smsi je popsáno v tabulce .1.
Složka
Kamenivo 16-32
Kamenivo 8-16
Kamenivo 2-8
Písek 0-2
Cement
Voda
Plastifikátor
C 20/25
413
619
619
413
280
140
-
C35/45
538
359
538
359
400
148
2
Tab.1. Složení betonových smsí.
Rozdílnost obou smsí spoívala v použitém kamenivu dvou výrobc% ve tech frakcích 2-8, 8-19 a 16-32. Písek
v obou návrzích byl použit stejný.
3
POPIS PROBLEMATIKY
Po provedení betonové konstrukce rozjezdové dráhy letišt zaalo docházet k rozpadu povrchové vrstvy betonu.
Na poátku tomuto problému nebyla kladena pozornost, ale s pibývajícím množstvím odlouplých vrstev betonu
vznikla pochybnost, zda množství betonových odštpk% není nebezpené pro provoz letadel a jejich možného
poškození. K nejvyššímu množství vzniklých "odprysk%" docházelo v zimním období, kdy teplota okolního
vzduchu klesala pod bod mrazu k -4°C. Odlupování vrstvy betonu bylo však trvalé. Po odklizení odlupk% na
vymezené ploše dráhy docházelo bhem nkolika dní k dalšímu vznik% odlupk% viz obr.1.
Vysoký nár%st množství odlupk% v zimním období smoval úvahy o píinách vzniku poruch k druhu
používaného rozmrazovacího prostedku odstra(ujícího led a námrazu z letištní dráhy. Píina vzniku poruchy
vlivem rozmrazovacího prostedku byla pozdji vylouena, protože k odlupování docházelo i po skonení
zimního období.
Obr. 1. Odprýsknuté ásti povrchové vrstvy betonu (spodní pohled).
~ 162 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
4
October 2013, Bratislava
ANALÝZA PORUCHY
Pro stanovení píiny vzniku poruchy byl odebrán vývrt v celé tloušce betonové desky o pr%mru 100 mm. Ten
byl následn rozdlen na krajní 5 cm silné váleky. Zbylá stední ást byla rozdlena na zhruba 2,5 cm silné
koláky viz obr. 2.
K dispozici byly také poskytnuty odlupky z povrchu dráhy jak z první, tak z druhé etapy viz. obr. 1. Z obou typu
vzork% byly pipraveny vzorky pro mikroskopickou analýzu materiálu.
Obr. 2. Betonový vývrt rozdlený na zkoumané ásti.
Oblast analýzy byla rozdlena na dv skupiny test%. První skupina zkoušek byla vnována makroskopickému
zkoušení betonu. Do této skupiny patily testy nasákavosti kameniva a betonu a zkouška mrazuvzdornosti
betonu. Druhou skupinu tvoila optické polarizaní mikroskopie a analýzy SEM a EDS.
Zkouška nasákavosti kameniva byla provedena na vybraném kamenivu. Z geologického hlediska skladby betonu
bylo provedeno urení rizikového kameniva, které se vyskytovalo na ezech mezi koláky betonu. Kamenivo
bylo z betonových kolák% vyezáno z d%vodu nedostupnosti vlastního kameniva, které bylo v betonu použito.
Obr. 3. Betonový vývrt rozdlený na zkoumané ásti.
Zárove( s testem nasákavosti kameniva byl proveden test nasákavosti betonu na odebraných vzorcích. V obou
pípadech bylo po ustálení dosaženo srovnatelné nasákavosti mezi 3,5 až 4 % hmotnosti. Výjimka z této oblasti
byla zaznamenána na vzorku . 1, kdy se konená nasákavost ustálila na 4,5 %.
Následující zkouškou bylo stanovení odolnosti na zmrazovací cykly. Tomuto testu bylo podrobeno tleso .7 z
vývrtu. Tleso bylo nejprve zaháno na 80 °C, pak vysušeno v exikátoru pi podtlaku 400 mBarr po dobu 2
hodin. Následn bylo saturováno v 10 % roztoku NaCl. Po dosažení nasycení tlesa roztokem bylo tleso
vloženo do mrazícího boxu s teplotou -25 °C po dobu 24 hodin. Po této dob tleso nevykazovalo žádné
povrchové poruchy, které by mly vliv na kvalitu betonu. Po provedení makroskopických zkoušek bylo
konstatováno, že kvalita betonu je odpovídající receptue.
~ 163 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Další pozornost byla soustedna na mikroskopickou analýzu pipravených vzork% odlupk% a výez% z povrchu
tlesa, viz vzorek .1. Spojovacím initelem pro mikroskopické pozorování byl obsah jednoho typu kameniva
ve všech odlupcích, bez rozdílu výrobce kameniva. Toto kamenivo se také vyskytovalo ve vzorku .7, který byl
podroben zmrazovací zkoušce.
Obr. 4. Odlupky betonu pro mikroskopickou polarizaní analýzu.
Výsledky polarizaní mikroskopie prokázaly jak v odlupcích, tak ve vzorcích z tlesa . 1 pítomnost
mikrotrhlin, které byly doprovázeny zkarbonatovaným okolím viz obr. 5, které bylo pr%vodním jevem poruchy.
K porušování betonu a vzniku trhlin docházelo objemovými zmnami v použitém kamenivo, které se omezilo na
prachovce a slínovce. Použití tohoto kameniva je pro exponované betonové konstrukce naprosto nevhodné.
Obr. 5. Mikroskopická analýza karbonatované vrstvy betonu.
5
ZÁV$R
Problematika kvality povrchu rozjezdové dráhy Modlinského letišt byla v použití nevhodného kameniva s
obsahem prachovc% citlivých na zmny vlhkosti a náchylných k objemovým zmnám, které svými vlastnostmi
zp%sobovalo zrychlení karbonatace a odlupování povrchových vrstev. Postupem doby, po uskutenní všech
objemových zmn v prachovcích by byl tento proces porušování ukonen a k dalšímu odlupování by
nedocházelo.
POD$KOVÁNÍ
Výsledky práce byly dosaženy za pispní grantu SGS12/117/OHK1/2T/11.
LITERATURA
[1]
Recepta dla betonu cementowego LBOIT/BC/03/11, Laboratorium Badawcze Oblektów Infrasturkury
Transportowej ul. Wybrzeze Wyspiaskiego 41, 50-370 Wroclaw.
[2]
Recepta dla betonu cementowego LBOIT/BC/05/11, Laboratorium Badawcze Oblektów Infrasturkury
Transportowej ul. Wybrzeze Wyspiaskiego 41, 50-370 Wroclaw.
~ 164 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
MECHANICKÉ VLASTNOSTI CEMENTOVÉ PASTY S
OBSAHEM POLÉTAVÉHO POPÍLKU
P. Padevt1 a T. Otcovská2
Abstract
The properties of cement pastes are influenced by admixtures which can is possible add to the fresh paste. The
material properties of classical fly ash are relatively good known. The fluidized fly ash is a second type of the fly
ash from coal combustion. The fluidized fly ash added to cement paste change properties of the final product.
The material properties of cement paste mixed with fluidized fly ash. The properties in saturated and dried
condition are compared.
Klíová slova
Cementová pasta; polétavý popílek; pevnost v tlaku; pevnost v tahu za ohybu; saturované t$leso.
1
ÚVOD
Použití elektrárenských popílk% ve stavebnictví je významným initelem pro zp%sob zpracování této odpadní
suroviny. V ad pípad% byl prokázán významný pínos popílku na výsledné vlastnosti betonu [1]. Beton je dnes
jedním z nejpoužívanjších stavebních materiál% a proto zpracování popílku v nm má velký význam a je na toto
téma kladen d%raz. Elektrárenský popílek, který je vytvoený spalováním zejména hndého uhlí, je možné podle
zp%sobu získávání - odsiování rozdlit do dvou základních skupin. První skupinu tvoí ložový popílek, který má
velmi píznivé vlastnosti pro beton. Pidáním ložového popílku do betonu lze dosáhnout píznivých vhodných
vlastností jak pro betonáž, tak i pro výslednou betonovou konstrukci.
Druhým typem popílku je polétavý popílek. Popílek je získáván pi spalování uhlí v pecích pi teplotách mezi
1200 - 1400 °C. Pi zachycování jsou používány filtry s aktivním vápencem.Tento zp%sob získávání je initelem
zmny v chemickém složení polétavého popílku. Popílek má sice vhodnou granulometrii, ale tvar a struktura zrn
je jiná, než u ložového popílku. Podstatnou vlastností je vyšší obsah SO3 a CaO. Vyšší koncentrace síry a vápna
mají nepíznivý úinek na výsledné vlastnosti betonu.
Zjištní materiálových vlastností a jejich dlouhodobé ovování m%že pinést zmnu pohledu na tento odpadní
materiál a nalézt možnost jeho zpracování. Pozornost je vnována zejména na vlastnosti, které ovliv(ují
únosnost materiálu.
2
CEMENOVÁ PASTA S POLÉTAVÝM POPÍLKEM A JEJÍ P#ÍPRAVA
Píprava cementové pasty s polétavým popílkem se odlišuje od pípravy cementové pasty s popílkem ložovým.
Zrna polétavého popílku jsou více porézní, což zp%sobuje vyšší potebu zámsové vody pi píprav cementové
1
Ing. P. Padevt, Ph.D., Thákurova 7, Praha 6, &eská republika, &VUT v Praze, Fakulta stavební, +420 224 354
484, [email protected]
2
Bc. T. Otcovská, Thákurova 7, Praha 6, &eská republika, &VUT v Praze, Fakulta stavební, +420 224 354 484,
[email protected]
~ 165 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
pasty. Pro experiment byly použity ti hmotnostní pomry mezi cementem a polétavým popílkem. První pomr
byl 70:30, druhý 60:40 a tetí 50:50. V prvním pípad bylo tedy nahrazováno 30 % cementu popílkem a v
posledním pípad inila náhrada 50 % hmotnosti popílku. Vodní souinitel, který byl vztažen k 100 % množství
cementu byl ponechán 0,4. Konzistence cementové pasty se zvyšujícím se množstvím popílku v cementové past
byla výrazn tužší oproti cementové past s 30 % náhradou popílkem.
Tlesa byla rozdlena pro všechny ti typy smsí na dv skupiny: zcela nasycená vodou vysušená. Píprava
nasycených tles probhla tak, že po vyrobení tles byla 3 den tlesa umístna do vodní lázn a tam ponechána
až do doby testování. Vysušená tlesa byla ponechána také ve vodní lázni po jejich výrob, ale 2 dny ped jejich
testováním byla z vody vyjmuta ponechána 2 hodiny v laboratorním prostedí a následn do doby testování
sušena v sušárn pi teplot 105 °C.
Cementové pasty byly vyrobeny pro zkoušení v tlaku v tahu za ohybu a pro zkoušku lomové energie cementové
pasty. Pro všechny tí typy zkoušek byl použit tvar tles hranol o pr%ezové ploše 20 x 20 mm a výšce 100 mm.
Tlesa urená pro zkoušku pevnosti v tlaku byla vyrobena z p%vodních tles jejich rozp%lením. Tak vznikla
tlesa o délce 50 mm. Pro zkoušky v tlaku bylo použito 6 tles délky 50 mm, pro zkoušky pevnosti v tahu za
ohybu bylo použito 5 tles o délce 100 mm a tvarov stejná tlesa byla použita pro zkoušky pevnosti v tahu za
ohybu s vrubem v potu 4 ks v jedné sad. Velikost vrubu pro testování byla volena mezi 1/3 až 1/2 výšky
tlesa. Vrub byl vytvoen v polovin délky tlesa. Vzdálenost podpor pro ohybové zkoušky byla 80 mm.
Ohybové zkoušky byly provedeny zp%sobem tíbodového ohybu.
3
VÝSLEDKY ZKOUŠEK CEMENTOVÝCH PAST
Tlesa byla zkoušena ve stáí 1 msíce od výroby. Cementová pasta s ložovým popílkem vykazuje vysoký
stupe( dozrávání v období mezi 1 a 3 msícem stáí. V našem pípad byla kladena pozornost na standardní fázi
porovnání, jako v pípad beton% v období prvního msíce.
Pom*r složek
cement/popílek
70/30
70/30
60/40
60/40
50/50
50/50
Stav
Vysušené
Nasycené
Vysušené
Nasycené
Vysušené
Nasycené
Pevnost v tlaku
(MPa)
Pevnost v tahu
ohybem (MPa)
41,84
30,08
29,17
33,00
26,13
26,94
1,40
3,95
2,63
3,50
1,45
5,09
Pevnost v tahu
ohybem - vrub
(MPa)
2,79
1,76
4,55
4,25
Tab.1. Materiálové vlastnosti cementových past s polétavým popílkem.
Tabulku je možné rozdlit na dv oblasti, oblast tles nasycených vodou a oblast vysušených tles. V obou dvou
pípadech se pevnost v tlaku se zvyšujícím se obsahem popílku snižuje. V pípad malého zastoupení popílku
jsou pevnosti v tlaku znan vysoké a blíží se hodnotám pevnosti cementové pasty bez popílku. Rozdíl mezi
pevnostmi nasycených a vysušených tles z%stává i pro pevnost v tahu za ohybu. Pevnost v tahu za ohybu
nasycených tles je vyšší než pevnost tles vysušených. Tento trend je opaný než v pípad pevnosti v tlaku.
Tlesa s vrubem vykazují pro pomr složek 50/50 zvýšení pevnosti v tahu za ohybu proti 40 % zastoupení
popílku.
4
ZÁV$R
Zmna množství polétavého popílku v cementové past zp%sobuje výraznou zmnu jejích materiálových
vlastností. Vliv nasycenosti materiálu se taktéž výrazn projevuje. Efekt zvýšení pevnosti v tahu za ohybu se
zvýšením obsahu popílku v past je opaný než v pípad pevnosti v tlaku.
POD$KOVÁNÍ
Výsledky práce byly dosaženy za pispní grantu SGS12/117/OHK1/2T/11.
LITERATURA
[1]
Padevt, P. - Lovichová, R.: The Material Properties of Cement Paste with Fly Ash Exposed to High
Temperatures, Proceedings of 8th International Conference on Continuum Mechanics, Rohdes, July 2013.
~ 166 ~
Proceedings of the 11th International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
COMPARISON BETWEEN EUROCODE 2, ACI 209 – R2 AND
GARDNER&LOCKMAN MODELS IN CREEP ANALYSIS OF
COMPOSITE STEEL-CONCRETE SECTIONS
D. N. Partov1 and V. K. Kantchev2
Abstract
The paper presents analysis of the stress-strain behavior and deflections changes due to creep in statically
determinate composite steel-concrete beam according to EUROCODE 2, ACI209-R2 and Gardner & Lockman
models. The mathematical model involves the equation of equilibrium, compatibility and constitutive
relationship, i.e. an elastic law for the steel part and an integral-type creep law of Boltzmann – Volterra for the
concrete part considering the above mentioned models. On the basis of the theory of the viscoelastic body of
Arutyunian–Trost-Bažant for determining the redistribution of stresses in beam section between concrete plate
and steel beam with respect to time “t”, two independent Volterra integral equations of the second kind have
been derived. Numerical method based on linear approximation of the singular kernel function in the integral
equation is presented. Example with the model proposed is investigated. The elastic modulus of concrete Ec(t) is
assumed to be constant in time ‘t’.
Key Words
steel-concrete section, integral equations, rheology, EUROCODE 2, ACI209-R2, Gardner&Lockman model.
1
INTRODUCTION
The time-varying behavior of composite steel-concrete members under sustained service loads drawn the
attention of engineers who were dealing with the problems of their design more than 60 years [3,4,5]. In general,
time-dependent deformation of concrete may severely affect the serviceability, durability and stability of
structures. In this paper we try to make the comparison in results, obtained from Eurocode 2, ACI209-R2 [1] and
G&L [2] models in creep analysis of composite steel concrete beams.
2
BASIC EQUATION OF EQUILIBRIUM
Let us denote both the normal forces and the bending moments in the cross-section of the plate and the girder
after the loading in the time t = 0 with N c ,0 , M c ,0 , N a , 0 , M a , 0 and with N c ,r (t ) , M c , r (t ) , N a ,r (t ) ,
M a ,r (t ) a new group of normal forces and bending moments, arising due to creep and shrinkage of concrete. For
1
Prof. Dr. Civ. Eng. Doncho Partov,. Higher School of Civil Engineering”, Sofia, Republic of Bulgaria,
[email protected]
2
Assoc. Prof. Vesselin Kantchev, Higher School of Civil Engineering”, Sofia, Republic of Bulgaria,
[email protected]
~ 167 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
a composite bridge girder with J
c
Ac (nI c )n
d 0.2
As I s
October 2013, Bratislava
according to the suggestion of Sonntag [3] we can write the
equilibrium conditions in time t as follows: N (t )
0; N c , r (t ) N a ,r (t ) ; ¦ M (t ) 0; M c,r (t ) N c,r (t )r M a ,r (t ), (1)
Due to the fact that the problem is a twice internally statically indeterminate system, the equilibrium equations
(1) are not sufficient to solve it.It is necessary to produce two additional equations in the sense of compatibility
of deformations of both steel girder and concrete slab in time t (Fig. 1).
Nc ( t0 )
I t t0 Ec ( t0 ) Ac
H sh tf E c t t0 W t
³
W t0
dN (W ) 1 I t W ³ dcW Ec (W ) Ac dW
W t0
W t
dMa (W ) r
dW
dW Ea I a
W t
³
W t0
dN a ( W ) 1
dW
dW
E a Aa
N c ,r ( t )
N c ( t0 )
M
M c ( t0 )
c ,r
(t )
N c ( tf )
M c ( tf )
Nc t0 I t t0 Ec t0 I c
N a (t 0 )
M a ,r ( t )
M a (t 0 )
W t
W t
³
W t0
dM c W 1 I t W dW
dW
Ec W I c
³
W t0
N c ,o
M c ,o
M0
1237,00kNm
M0
N a ,r ( t )
Nc,r ( t )
Mc,r t N a ( tf )
M a ( tf )
Ns,r (t )
N s ,o
Ms ,r ( t )
M s ,0
dM a (W ) 1
dW
dW Ea I a
Fig. 1. Model for deformations, regarding creep
Fig. 2. Composite beam with cross-section characteristic
3. DERIVING OF THE GENERALIZED MODEL ACCORDING EUROCODE 2
3.1 Strain compatibility on the contact surfaces between the concrete and steel members of composite
girder:
For constant elasticity module of concrete strain compatibility on the contact surfaces between the concrete and
steel members of composite girder is
t
N c ,0
dN c ,r W 1
ª¬1 IRH E f cm E t0 E c t t0 º¼ ª¬1 IRH E f cm E W E c t W º¼ dW H sh t0 f t t0 ³
Ec t0 Ac
Ec t0 Ac t0 dW
N a ,0
Ea Aa
1
Ea Aa
t
³
t0
dN a ,r W dW
dW
M a ,0
Ea I a
rr
1
Ea I a
t
³
t0
dM a ,r W dW
dW
Compatibility of Curvatures when W t
t
M c ,0
dM c ,r W 1
ª¬1 IRH E f cm E t0 E c t t0 º¼ ª¬1 IRH E f cm E W E c t W º¼ dW
³
E c t0 I c
Ec t0 I c t0
dW
M a ,0
Ea I a
1
Ea I a
t
³
dM a ,r W t0
dW
dW
After integrating the two equations by parts and using the (1) for assessment of normal forces N c ,r (t ) and
bending moment M c , r (t ) two linear integral Volterra equations of the second kind are derived.
t
N c ,r t ON ³ N c ,r W t0
d
ª1 MIRH E f cm E W E t W º¼ dW ON N c ,0IRH E f cm E t0 E c t t0 ON N sh E c t t0 ,
dW ¬
t
M c ,r t OM ³ M c ,r W t0
(2)
EI
d
ª1 IRH E f cm E W E c t W º¼ dW OM M c ,0IRH E f cm E t0 E c t t0 OM c c N c ,r t r ;(3)
dW ¬
Ea I a
1
1
ª Ec I c º ,
(4)
«1 »
N
¬ Ea I a ¼
4. DERIVING OF THE MECHANO-MATHEMATICAL MODEL ACCORDING ACI 209R-92
Analogically using strain compatibility on the contact surfaces between the concrete and steel members of
composite girder and compatibility of curvatures when W t , for constant elasticity module of concrete strain,
two linear integral Volterra equations of the second kind for assessment of normal forces N c ,r (t ) and bending
which O
ª Ec Ac §
A r 2 ·º
¨¨1 a ¸¸» , OM
«1 I a ¹¼
¬ Ea Aa ©
moment M c , r (t ) are derived.
t
N c ,r t ON ³ N c ,r W t0
t
M c ,r t OM ³ M c , r W t0
d
ª1 2,35J c 5 E W E c t W º¼ dW ON N c ,0 2,35J c 5 E t0 E c t t0 ;
dW ¬
(5)
EI
d
ª¬1 2,35J c 5 E W E c t W º¼ dW OM M c ,0 2,35J c E t0 E c t t0 OM c c N c ,r t r , (6)
dW
Ea I a
~ 168 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
5.
October 2013, Bratislava
DERIVING OF THE GENERALISED MECHANIC –MATHEMATICAL MODEL ACCORDING
GARDNER & LOCKMANN MODEL
Analogically using strain compatibility on the contact surfaces between the concrete and steel members of
composite girder and compatibility of curvatures when W t , for constant elasticity module of concrete strain,
two linear integral Volterra equations of the second kind for assessment of normal forces N c ,r (t ) and bending
moment M c , r (t ) are derived.
t
N c , r t ON ³ N c ,r W t0
t
M c ,r t OM ³ M c ,r W t0
d
ª1 ) (tc ) E c t W º¼ dW ON N c ,0 ) (tc ) E c t t0 ,
dW ¬
(7)
EI
d
ª¬1 ) (tc ) E c t W º¼ dW OM M c ,0) (tc ) E c t t0 OM c c N c ,r t r ,
dW
Ea I a
(8)
Here is the place to explain the meaning of the second term of the integral relations. This type of integral, known
as a hereditary integral of Stieltjes expresses time history of loading. Since in our case the stress history V c, r (W ) ,
which represents the distribution of stress between concrete plate and steel beam, is continuous summing the
strain histories due to all small stress increments before time t yields to perfect satisfying the strain
compatibilities.
6. NUMERICAL EXAMPLE
The method presented in the previous paragraph is now applied to a simply supported beam, subjected to a
uniform load, whose cross section is shown in fig. 2. On the base of numerous solved examples the optimal step
of one day for solving the integral equations is found. The elapsed time for solving the problem for the period of
twenty years (7300 days) is about up to ten minutes. For the period of forty years (12001 days) the elapsed time
increases up to forty minutes.
The following parameters are according EUROCODE 2 model
6.1
Ec
3, 2 .10 4 MPa , E a
Ic
661500 cm 4 , I a
1217963 ,7 cm 4 , rc
2
Ai
2 ,1 . 10 5 MPa , Ac
2453 ,05 cm , I i
8820 cm 2 , Aa
23 ,039 cm , ra
4
4536360 ,758 cm .M 0
383 , 25 cm 2 , n
80 ,829 cm , r
1237 kNm , N c ,o
Ea
Ec
103 ,868 cm ,
846 ,60 kN , M c ,o
1
M a ,o
h0
E fcm ª
ª
E c Ac §
A r 2 ·º
E I º
¨¨ 1 a ¸¸ »
0 , 060545358 , O M «1 c c »
«1 E a Aa ©
I a ¹¼
Ea I a ¼
¬
¬
18
300 mm ; E H 150 ª1 1.2*80 /100 º h0 /100 250 915,82 1500
¬
¼
330 ,13 kNm , O N
2 AC / u
5.3
fcm /10 3.06
0.5
;
E (t0 )
fcm 30
1
0.1 (t0 )0.2
0, 4223
I0 IRH E ( f cm ) E (t0 ) =1,6817 Ec (36500 60) 0,9925811 ; It
6.2
36500
1
27 ,56 kNm
1
0 ,922950026
1 RH /100
0.46
3
h0 /100 RH
1,3014
;
80, h0 300
I0 E c (36500 60) 1, 669242
The following parameters are according ACE 209R-92 model
Ec
2,8178.104 MPa, Ea
Ic
661500 cm 4 , I a
Ai
1566,8248 cm2 , I i
M a ,o
IRH
t0 60
6 ,56
338, 05kNm, ON
2,1.105 MPa, Ac
1207963, 7 cm 4 , rc
4420140, 76 cm4 .M 0
ª Ec Ac
«1 «¬ Ea Aa
Mean 28-day strength: f cm 28
elastic modulus Ecm 28
§ Aa r 2 · º
¨1 ¸»
I a ¹ »¼
©
8820 cm 2 , Aa
25, 407 cm, ra
1237 kNm, N c ,o
28178MPa ;( Ecm 28
Ea
Ec
7, 452
78, 463 cm, r 103,870 cm,
837, 286 kN , M c,o
1
0, 068220902, OM
33,3MPa ; ( f cm 28
383, 25 cm 2 , n
ª Ec I c º
«1 »
¬ Ea I a ¼
24, 716 kNm
0.93155
33, 0 MPa ,according to CEB MC90-99). Mean 28-day
32009 MPa , according to CEB MC90-99). U c =2345 kg/m3;
~ 169 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
Ec W 2
(1 1.13e[ 0.0213(V / S )] )
3
J c ,vs
6.3
0, 043.23451,5 33,30
=0,6975,
where
2 , J c ,D
28178( MPa) ,
according
V/S=150;
J c ,s
40 ; J c ,D
to
ACI
209R-92.
1.27 0.67 h for h 0,80 =0,734;
0.82 0.00624 s =1,018;
where
0.46 0.09D t 1 ;is air content factor,
1 ; E c 36500 60 0,982004 .
The following parameters are according Gardner&Lockman model
2,8014.104 MPa(4,060,590 psi), Ea
Ec
Ea
Ec
Ai
N c ,o
ON
Emct 0
0.88 0.0024\ =0,976; where \
75 mm ; J c ,\
where D
n
Econst
1.25t 00.118 corresponds to E (t0 ) = 0,61684 for t=60 days; J c , RH
J c ,t 0
s
Ec t0 October 2013, Bratislava
7,496, Ic
2,1.105 MPa(30,450,000 psi), Ac 8820 cm2 (1411 in2 ), Aa 383,25 cm2 (61in2 ),
661500 cm4 (16934,4 in4 ), I a 1207963,7 cm4 (30924 in4 ), rc
1560,82 cm2 (250 in 2 ), I i
78,37 cm (31in), r 103,870 cm (41in),
4415813,859 cm4 (113045 in 4 ), M 0 1237 kNm (10957677 lbf .in),
840,50kN (189112 lbf ), M c ,o
0, 068593645, OM
25,50 cm (10 in), ra
24, 7206 kNm (218982 lbf .in) ; M a ,o
338,386kNm(2997514lbf .in),
0,931921295
Fig. 3. Normal forces N c , r t N a ,r (t ) in t 12060 days
Fig. 4. Bending moments M a ,r (t ) in t 12060 days
7. CONCLUSION
In fig. 3 and 4 it is shown the values of normal forces and bending moments in time t. A numerical method for
time-dependent analysis of composite steel-concrete sections according EUROCODE-2, ACI 209R-92 and G&L
models are presented. Using MATLAB code a numerical algorithm was developed and subsequently applied to a
simple supported beam. These numerical procedures, suited to a PC, are employed to better understand the
influence of the creep of the concrete in time-dependent behavior of composite section
REFERENCES
[1] ACI, (2004), Guide for Modeling and Calculating Shrinkage and Creep in Harden Concrete, May 2008,
ACI 209.2R-08 (under revision by ACI Committee 209)
[2] Bažant Z. P., Baweja, S., Creep and Shrinkage Prediction Model for Analysis and Design of Concrete
structures:Model B3, Adam Nevile Simposium : Creep and Shrinkage –Structural design Efects,ACI SP194,A.Al-manasereer,ed.ACI,Michigan 2000.
[3] Partov, D., Kantchev, V., „Time-dependent analysis of composite steel-concrete beams using integral
equation of volterra, according EUROCODE-4“, Engineering MECHANICS, Vol. 16, 2009, No 5, pp 367392.
[4] Partov, D., Kantchev, V., „Level of creep sensitivity in composite s steel-concrete beams, according to ACI
209R-92 model, comparison with EUROCODE-4(CEB MC90-99)“, Engineering MECHANICS, Vol. 18,
2011, No 2, pp 91-116.
[5] Partov, D., Kantchev, V., „Gardner&Lockman Prediction model (2000) for time dependent deformations of
concrete and its application in numerical analysis of composite beams“, Proceedings of the 9th International
Conference on New Trends in Statics and Dynamics of Buildings October 20-21, 2011 Bratislava, Slovakia,
pp 235-238.
~ 170 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
STATIC ANALYSIS AND DESIGN OF THE BACK ANCHOR OF
THE TBM, EXCAVATED THE TUNNELS OF SOFIA METRO
UNDER BUL. MARIA LUIZA
D. N. Partov1 and M .St. Petkov2
Abstract
The tunnels of Sofia metro in the city central area, under bul. Maria Luiza are excavated by tunnel boring
machines (TBM) with diameter Ф=9,70m. A TBM requires a temporary support called a “back anchor” to
initiate the drilling and get inside the tunnel. The paper provides a review of the static analysis and design issues
that were encountered during this interesting for Bulgarian practice design project. The paper starts with the
choice of structural configuration and elaborates on the statically analysis and design decisions made. Finally,
the construction process, the materials used, and the monitoring of the structure during the TBM start are
described.
Key Words
tunnel boring machine (TBM), back anchor
1
INTRODUCTION
The tunnels of Sofia metro in the city central area under the bul. Maria Luisa are excavated by tunnel boring
machines (TBM). A TBM requires a temporary support called a back anchor to initiate the drilling and get inside
the tunnel; once inside it pushes its way ahead by a system of levers and hydraulic jacks. As conditions at each
metro station where typically boring starts vary, as do TMBs themselves, the design of each back anchor is done
individually and locally. The design brief submitted by warrant “Doġuş Co” included two principle requirements
to be met by the structure, namely, the design values of the forces acting on the back anchor and their application
points, the type of steel member section to be used and an outline of the geometry of the structure commensurate
with the dimensions of the TMB and the available space on site. A structural configuration consistent with the
requirements, which produces as direct transfer of the applied forces to the foundations as possible was
proposed. It consists of one vertical frames perpendicular to the TMB axis which transfer the forces by mainly
truss action. The overall 3-D stability of the structure is achieved by designing all member-to-member
connections as rigid. Bracing is avoided as much as possible to facilitate construction of the back anchor and
operation of the TBM.
1
Prof. Dr. Civ. Eng. Doncho Partov,. Higher School of Civil Engineering”, Sofia, Republic of Bulgaria, tel.
+359028029131, [email protected]
2
Assist. Prof. Civ. Eng. Milen Petkov,. Higher School of Civil Engineering”, Sofia, Republic of Bulgaria, , tel.
+359028029131, [email protected]
~ 171 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
2
October 2013, Bratislava
DESCRIPTION OF THE STRUCTURE
The structure of the back anchor can be described as a one of 1-D frame. The 1-D frame is supported by slanted
members at two levels. The front vertical frame, perpendicular to the TBM axis, and 9,70 m wide takes the loads
from the TBM at four levels. There are two forces, 1000 kN each at the top level, pairs of forces of 1000 kN
each at the special point of the height of the column and two forces 550 kN levels below. The resultant of the
horizontal loading is 8100 kN(710 tons). Between the points of application of the TMB forces, the vertical front
frame is stiffened by diagonal braces made of I- section segments. A view of the back anchor together with the
TBM is shown in Fig. 1, and a close-up view of the back anchor only, in Fig. 2.
Fig. 1. View of the back anchor and the TBM
Fig. 2. Close-up view of the back anchor
The front (9,70 m) frame, serves as an intermediary in transferring the TBM jack forces to the foundation slab by
means of a total of four slanted members (braces), two in each vertical plane. The braces are welded to a
60/1000/1000 mm steel plate, Fig. 3. The steel plate itself is anchored to the foundation slab by 1400 mm long
anchor bolts M32. The number of bolts are 8 and each of them are at 300 mm centres along the steel plate. The
reaction forces in the feet of the front frame are not so large, so the columns step directly on the foundation slab
on level 520,889 m. This necessitated a high precision in the connecting detail there. The columns are welded to
2700/1500/60 mm appropriately stiffened (by 30 mm steel) plates(Fig. 4).
Fig. 3. Connection of the diagonal braces to the
Fig. 4. Connection of the front frame columns to the
foundation slab
foundation slab
One of the major challenges in the design was the connection of the end columns of the front frame to the
foundation slab, which was complicated by the large tensile force arising in them (2938kN). An anchor
substructure was designed to transfer these force made of an welded I- cros section welded to an embedded
60/1500/2700 mm plate anchored to the foundation by 1200 mm long 42M52 anchor bolts(Fig.4). The
connection detail as a whole was analyzed by a precise shell FE model to assure that significant stress
concentrations do not occur. The design of all members made sure that the strength and stability requirements of
~ 172 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
the Bulgarian standard for design of steel structures, and the respective Eurocode, [1] are adequately met.
Theoretical solutions for buckling [2] were also used for extra verification.
3
STRUCTURAL ANALYSIS
A preliminary analysis by a simple 1-D truss model was done by hand. The hand analysis was followed by a 3-D
frame FE analysis, by the programs SAP2000, and Tower 5.5. This section describes the SAP2000 analysis,
which was the most detailed one, and the one from which the forces for design calculations of the members were
taken. The structure serves only in the initial stages of the boring process, and can therefore be qualified as a
temporary structure. Due to its temporary nature, the structure is analyzed only for a load combination
(DEADLIVE) consisting of the self weight (SW) of the structure and the above mentioned TBM support forces
(FORCE). Both loading states enter the combination with a coefficient of participation 1. Two versions of the
model differing by their overall stiffness were investigated. All input data for the two models is identical except
for the features given below: Version 1. All member to member connections are assumed rigid - a model with
maximum stiffness. Version 2. Only the connections between the members of the vertical front frame,
perpendicular to the longitudinal axis of the TBM are rigid. The whole spatial construction must remain rigid to
ensure the overall stability of the structure. This is a model with minimal stiffness, and yet assuring global
stability.
All supports of the analysis model were assumed to be ball joints. For both versions of the model the following
was reported: • description of the model/input data – nodes, elements, loadings, cross sections; Results –
displacements, internal forces, support reactions. The design values of the forces used in the member design
were obtained assuming linear elastic material behavior, absence of geometrical imperfections and lack of
geometrical nonlinearities. In addition both versions were solved assuming second order effects such as P-Δ
effect, misalignment of the TMB axis and the back anchor axis by 10 mm in plan, modeling of rigid offsets at
the member intersection. None of these effects produced difference in the forces in the most heavily loaded
members of more than 2%, and were therefore considered negligible. The principle features of the SAP2000 and
Tower 5.5 computational model are shown in Fig.6 and Fig.7. An automated design check to Eurocode 3 was
also carried out, and results in terms of capacity ratios obtained. These results served as a preliminary orientation
as to which members of the structure may need strengthening or special care in the connection details (capacity
ratios greater than unity).
Изометрия
Fig. 5. The model - cross section orientation
4
Fig. 6. The model – cross section orientation
CONSTRUCTION, MATERIALS AND MONITORING
The connection details were realized either as bolted flange connections or welded gusset plate
connections(fig.7). Typical member-to-member connection details are shown in Fig. 8 and Fig.9. During the
assembly, only typical assembly equipment was used. The structure was split into relatively small assembly units
to facilitate construction. The quality of construction was assured by strictly following the Bulgarian Code for
Execution and Delivery of Construction works; section “Steel Structures”.
~ 173 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
The following materials were used:
•
Steel grade ВСт3sp4 to БДС259271 or St275 JR to EN10025 for
plate steel
•
Steel grade St275JR to BS EN
10025 for standard hot rolled
sections
•
Welding electrodes E42 and E46 to
BDS 5517-77
•
Bolts grade 10.9 to BDS 4190
•
Concrete
grade
foundations.
B25
for
Fig. 7.Front view of the structure
Fig. 8. Member-to-member connection details
5
Fig.9 Member to member connection details
CONCLUSION
To the delight of the authors and indeed the clients – “Doġuş Co”, the TBM started without complications
meaning the back anchor successfully served its mission. Although the structure was designed to withstand the
specified forces, they maybe were not reached during the TBM start, this meant a larger overall safety factor. In
our particular case it was not necessary to apply the full forces in order to bore through the RC wall, with which
the boring started.
REFERENCES
[1]
EN 1993-1-1, Design of steel structures. General rules and rules for buildings..
[2]
Bažant, P. Z. and Cedolin, L., “Stability of structures”, Oxford University Press, New York, 2010
~ 174 ~
Proceedings of the 11th International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
ROBUSTNESS OF MODIFIED SPECIAL HYBRID RC FRAMES
M. I. Pastrav1
Abstract
Modified special hybrid moment resistant reinforced concrete frames detailing are different from the usual
frames detailing as the precast beams are post-tensioned assembled and the joints have a specific detailing. The
unbounded post-tensioning tendons are placed in centroid of the beams and are designed to remain elastic under
all external loadings, while the horizontal joints are provided with special ductile connection reinforcement that
is designed to yield. The specimen has been tested previousely at lateral seismic type loading. This paper is
focused on another type of accidental loading, neglected in common design, namely explosion. In this cases it is
analyzed the capability of the structure to avoid the progressive collapse in case of a column failure. The
detailing of the beam-column joints is considered to be favorable to develop the catenary effect when
overloading occurs. The test was made on the same specimen initially tested under seismic type loading, so the
results have to be taken into account only from the qualitative point of view.
Key Words
Modified special hybrid joints; robustness; catenary.
1
INTRODUCTION
A main goal of the strategy of the European Construction Technology Platform [2] is the sustainability of
construction sector. An important part of any construction is its structure. As for the finishing materials and
equipment the innovative materials and technologies has been faster developed, for structural materials, concepts
and technologies, the conservative solutions are widely used yet.
A study focused on a new concept of reinforced concrete precast frame structures has been carried out since
2009, in our institute in Cluj-Napoca. This study approaches the problem based on another design concept [6]
and on a new kind of detailing of the frame joints. The idea derives from the special hybrid moment frame joint
which respects the provision of ACI T1.2-03 standard [8]. The new detailing of the hybrid joints, called modified
special hybrid joints important difference from the special hybrid moment frame joint consists of the special
reinforcement connection detailing of the precast members. The “classical” hybrid joint has the special
reinforcement debonded on two limited at the interface of column-beam joint, where yield is expected to occur,
during seismic loadings. The special reinforcements of the modified hybrid joints are bondless with respect to
both column and beams, and fixed only at the ends on the beams, acting as tension rods [3, 4].
The new detailing of the hybrid joints has the same structural behavior as classical hybrid joints, as most of their
deformations are developing at the interface between the precast beams and the columns, due to the opening and
closing of the column-beam joints. The hybrid joints structures are self-returning to their initial configurations
after the removing of the external loadings, due to the post-tensioned strands. The modified hybrid joints
detailing permits the replacement of the damaged special ductile reinforcement [5].
1
Dr. M. I. Pastrav, National Institute for Research and Development in Construction, Urban Planning and
Sustainable Spatial Development “URBAN-INCERC”, Cluj-Napoca Branch, Romania, +40264425462,
+40720026642, e-mail [email protected]
~ 175 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
2
October 2013, Bratislava
TEST PROGRAM
2.1 Experimental specimen
The specimen represents an inner joint of a real structure of a dwelling 6 story building, cut from the mid span of
beams and columns, made at full scale [4]. A sketch of the specimen detailing is presented in Fig. 1 [3].
INTERFACE FIBER GROUT
UNGROUTED DUCT
SPECIAL REBAR Ø16 - S355
500
10
500
10
500
THREADED END M14-100
425
500
L60x80x7...350
100
4 STRANDS Y1860S7-12.5
100
PVC SLEEVE Ø50
WASHER+NUT M14
PROCESSED REBAR Ø12
500
Fig. 1. Modified hybrid joint detail
2.2 Previous load history
The test has been performed after 3 tests at lateral seismic type loadings, on new (N2) and twice repaired
specimen (N2c and N2d). The whole load history and the static scheme are shown in Fig. 2. The specimen was
much more strongly loaded, up to a storey drift larger than 0.06, than the standard recommendations of both of
Romanian seismic code [7] which consider a maximum storey drift of 0.025, or the American code [1] which
consider as a storey drift of 0.035 for the structure behavior analysis.
Load History
STOREY DRIFT
0.070
N2
N2d
N2c
0.060
-F
F
0.050
0.040
0.030
0.020
0.010
0.000
0
50
100
150
200
250
300
-0.010
-0.020
-0.030
Fig.2. Load history and static sketch
2.3 Test ongoing
In order to assess the robustness of the modified hybrid joint another static scheme is used, simulating the failure
of a structural column. The scheme and the test set up are presented and the actual test set up in Fig. 3.
F
Fig. 3. Static sketch and actual test set up
~ 176 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
3
October 2013, Bratislava
TEST RESULTS
As the specimen has been already strongly loaded and damaged not only the special ductile bars but also the
concrete in column as can be seen in Fig. 4, the test results have to be considered as relevant for the mechanism
developed to support the accidental load.
Fig. 4. Damaged concrete in column after 3 seismic type tests
The results expressed by the load-displacement respectively load-rotation diagram, are shown in Fig. 5.
Vertical Force [kN]
45
40
35
30
25
20
15
10
5
0
-15
-10
-5
0
5
10
15
20
25
30
35
Beam rotation [Degree]
40
45
Vertical Displacement [mm]
Fig. 5. Force-generalised displacement diagram
The actual behavior of the joint at different levels of vertical loading is presented in Fig.6, illustrating the stages
of the force transfer mechanism.
Initially the interface in bended, the bottom special bars and the tendons are in tension while top layers of the
concrete of the beam and the correspondent ones in the column are in compression (6a). Then the bottom
reinforcements fail in tension and only tendons take the tension developed due to the bending, while the top
layers of the concrete of the girder and the correspondent ones in the column take the compression (6b, the
former special bar failure; 6c the latter special bar failure; 6d, only tendons take the tension). As can be seen in
Fig. 5, the fracture of the bottom special reinforcement leads to a force decrease. Finally, the top special
reinforcements begin to take tension as well as the tendon, meaning that the force transfer mechanism changes
from bending to catenary (6e).
a
b
c
d
Fig. 6. Force transfer mechanism at thebeam column interface
~ 177 ~
e
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
The recorded angle, where form this change begins, is less then 100, as can be deducted from the the apparent
strain measured at the strip coresponding to the top special bars, versus the beam rotation angle diagram (Fig.7).
12
Beam Rotation
[degree]
10
8
6
4
2
Apparent strain at top special reinforcement strip [mm/mm]
-1.20
-1.00
-0.80
-0.60
-0.40
-0.20
0
0.00
Fig. 7. Apparent strain at top special reinfoecement strip
4
DISCUSSION AND FINAL REMARKS
The goal of the test is considered to be reached as the supposed phenomenon is confirmed. The quantitative
results are affected by the weakness of the concrete in the column, so, the results are to be seen only as a
qualitative assessment. The study is developing on a new specimen, so the results to be valid also for quantitative
evaluation of the robustness of such structures under accidental loadings.
ACKNOWLEDGEMENT
Author acknowledges the Romanian Ministry of National Education for the financial support of the study and
„D&D” Drótáru Zrt. Miskolc, Hungary, and NAPKO, spol. s.r.o. Olomouc-Nedvězí, Czech Republic, for posttensioning tendons and respectively anchorages supply.
REFERENCES
1. Acceptance Criteria for Moment Frames Based on Structural Testing, ACI T1.1-01
2. European Construction Technology Platform (ECTP), Strategic Research Agenda for the European
Construction Sector Achieving a Sustainable and Competitive Construction Sector by 2030, Belgium, 2005.
3. Faur A., Mircea C., Păstrav M., A Modeling Technique for Precast Concrete Frames with Hybrid
Connections, Acta Technica Napocensis: Civil Engineering & Architecture Vol. 55, No. 3, 2012
4. Păstrav M. I., Enyedi C., Hybrid Moment Frame Joints Subjected to Seismic Type Loading, Proceedings of
15th World Conference on Earthquake Engineering, paper 1343, Lisbon, Portugal, 2012
5. Păstrav M., Sustainable Structures. Seismic Type Loading Behavior of Repaired Reinforced Concrete Hybrid
Joint, Proceedings of 13th International Multidisciplinary Scientific GeoConference, SGEM, pp 465-472, Albena,
Bulgaria, 2013
6. Priestley, M. J. N., Calvi, G.M., Kowalsky, M. J., Displacement-Based Seismic Design of Structures, IUSS
Press, Pavia, Italy, 2007
7. Romanian Seismic Design Code P 100-1/2006 (in Romanian)
8. Special Hybrid Moment Frames Composed of Discretely Jointed Precast and Post-Tensioned Concrete
Members, ACI T.1.2-03, and Commentary
~ 178 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
NUMERICAL MODELING OF SANDWICH BEAMS WITH
SHORT FIBER REINFORCED COMPOSITE FACES
S. Piovár1 and E. Kormaníková2
Abstract
The paper deals with numerical modeling of sandwich beams with polyurethane foam core and two types of face
layers – short fiber reinforced composite faces and hot zinc dipped steel sheet, coated by plastic. The
experimental results of four-point bending test are used as benchmark in the commercial ANSYS program
simulations. The input material properties of sandwich constituents were obtained from comprehensive material
testing program. An advantage of the plane stress condition of the sandwich beam is applied. It is observed very
good agreement between experiment and simulations in elastic region.
Key Words
Face layer; short fiber; composite; sandwich beam; four-point bending.
1
INTRODUCTION
The sandwich concept provides and efficient structural system suitable for a variety of applications, including
roof and wall panels for buildings in civil engineering industry. A typical sandwich structure consists of two
faces, made of metallic or composite laminated material, separated by a core that is usually made of low-weight
and low strength non-metallic foam [5].
The Finite Element Method (FEM) is a common and most effective tool for structural analysis of sandwich
structure [4]. A number of modeling techniques of sandwich panels have been developed, including analytical
models [1] and numerical approaches [6, 10].
2
EXPERIMENTAL PROCEDURE
The experimentally examined sandwich beams were assembled from hot zinc dipped steel sheet face layers,
coated by plastic (CSS) and low-density rigid polyurethane (PUR) foam core. It was also considered with short
fiber reinforced composite faces, which are currently used by some producers of sandwich panels. The behavior
of this type of sandwich under four-point bending test was examined only numerically. Static-mechanical tests
were preliminary conducted on constituents to acquire important parameter for the mechanical characterization
of the sandwich structure and to implement the numerical simulations. A brief summary of composites tension
tests and four-point bending tests are provided. Further details of the described tests and rest mechanical tests on
the constituents can be found in [12].
1
Ing. S. Piovár, TU of Košice, Civil Engineering Faculty, Vysokoškolská 4, 042 00 Košice, +421 55 602 4323,
[email protected]
2
doc. Ing. E. Kormaníková, PhD., TU of Košice, Civil Engineering Faculty, Vysokoškolská 4, 042 00 Košice,
+421 55 602 4168 , [email protected]
~ 179 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
2.1 Tensile properties of short fiber reinforced composites
The short fiber reinforced composites were made of chopped glass fibers in polyester resin. There were used
composites termed as G 600, commonly manufactured in Vetroresina SpA company [9] in Italia. The tension
tests were done according to standard EN ISO 527-4 [3].
Tension tests were performed using a Zwick-Extensometer testing machine with wedge-type mechanical grips.
Outputs from strain gages were recorded using a catmanEasy software via a Spider8 device [8]. The stress-strain
curves and failure modes of tested specimens in longitudinal direction are illustrated in Fig. 1 [11, 13].
Fig. 1. Stress-strain curves of G 600 composite and failure modes in longitudinal direction under tension test
2.2 Four-point bending tests
For determining the shear strength and shear modulus of the sandwich core material the four-point bending test
(FPBT) is typically used according to standard EN 14509 [2]. There were used four tested specimens, 80 mm
thick and 100 mm wide. The face layers were made from coated steel sheets. Span L = 1000 mm was chosen so
that a shear failure was obtained. Deflections of the tested specimens were measured at midpoint of the span with
the help of inductive transducers (IT) WA100 from HBM company [8]. Schematic illustration of the four-point
bending test and one of the tested specimens are illustrated in Fig. 2 [13].
F/2
IT
F/2
r
p
IT
IT
L
L/3
L/3
L
=
L/3
1000
L1 = 1200 mm
Fig. 2. Schematic illustration of the four-point bending test and stress-strain curves
F – applied load; r – rollers, radius 15 mm; p – steel load spreading plate; IT – inductive transducer
3
NUMERICAL MODELING
The simulations of the four-point bending tests have been carried out by using the ANSYS program [7]. It was
considered linear and nonlinear finite element analysis. The large displacement approach (LARGE) was
included. The composite face layers G 600 were also used in computations.
3.1 Element types
An approach, taking advantage of the plane stress condition of the sandwich beam in one-way bending was
applied. There was used a combination of beam and plane elements. The face layers and spreading plates were
~ 180 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
modeled using beam element BEAM189. The polyurethane foam core was modeled using eight-node
quadrilateral plane stress elements PLANE183 with capability of thickness effect.
It was used a half symmetry of the models (Fig. 3, 2419 elements, 6530 nodes).
symmetry
F/2
BEAM189
PLANE183
mesh 5 mm
supporting plate
Fig. 3. 2-D model, combination of BEAM189 and PLANE183 elements
There were created contacts (CON) using contact pairs between the loading steel plates and the top face layer
and also between the bottom face layer and the supporting plates.
3.2 Material models
The constituent materials have a nonlinear behavior, especially the polyurethane foam [12]. The non-linearity of
coated steel sheet (CSS) was accounted in the finite element model by specifying a multilinear inelastic material
model. The behavior of G 600 composite was described by bilinear isotropic hardening model. For the
polyurethane foam material, a hyperelastic material polynomial curve fitting was used to fit the material tension,
compression and shear stress-strain responses. It was carried out by the ANSYS program [7]. The used
polynomial was of a fifth order.
The beam load-deflection diagrams obtained from the finite element models are plotted along with the
experimental result in Fig. 4.
Max. force 1313 N
Fig. 4. Load-deflection diagrams of sandwich beams, CSS face layers
The comparison of sandwich face layer type on its flexural behaviour using an ORTHO material model of the
core is illustrated in Fig. 5.
Force 1313 N
Fig. 5. Comparison of sandwich beam load-deflections diagrams, CSS and G 600 face layers
~ 181 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
The differences between experimental and computed value of deflections at the midpoint of the beams,
respectively, are up to 40.02% by model PLANE183 ORTHO CON and 22.71% by model PLANE183 HYPER
CON CSS at their maximum load 1313 N.
By increasing the thickness of the core, it can be expected the same resistance of the sandwich beam with G 600
face layers due to its coated steel sheet counterparts.
4
CONCLUSIONS
The four-point bending test results of sandwich beam with steel sheet face layers and soft core made of rigid
polyurethane foam were used as a benchmark in numerical simulations using commercial finite element program
– ANSYS. An advantage of plane stress condition was applied in numerical models. The static-mechanical
behavior of the simulated sandwich beam was in a very good agreement with experiment in its elastic domain at
both material models of the core. The better prediction was obtained using hyperelastic material model of the
core at higher load.
ACKNOWLEDGEMENT
This paper has been supported by the project VEGA 1/0201/11 Progressive methods for the solution of structural
elements made of composite and other new-age materials.
REFERENCES
[1]
Chong, K. P. – Hartsock, J. A.: Structural analysis and design of sandwich panels with cold-formed steel
facings. Thin-Walled Structures Journal 16 (1993) 199-218.
[2]
EN 14509: Self-supporting double skin metal faced insulating panels: Factory made products:
Specifications. SÚTN, Bratislava, 2006.
[3]
EN ISO 527-4. Plastics: Determination of tensile properties: Part 4: Test conditions for isotropic and
orthotropic fibre-reinforced plastic composites (ISO 527-4: 1997). SÚTN, Bratislava, 2001.
[4]
Feldhusen, J. et al.: Numerical Modeling and Experimental Investigation of the Failure Modes of the
Cellular Foam Sandwich Structures. Journal of Metals, Materials and Minerals 18 (2008) 111-115.
[5]
Frostig, Y. – Thomsen, O. T. – Sheinman, I.: On the non-linear high-order theory of unidirectional
sandwich panels with a transversely flexible core. Int. Journal of Solids and Structures 42 (2005) 14431463.
[6]
Ha, H. K.: Finite element analysis of sandwich plates: an overview. International Journal of Computers and
Structures 37 (1990) 397-403.
[7]
http://www.ansys.com/
[8]
http://www.hbm.com/
[9]
http://www.vetroresina.com/en/product-list.php?i=1
[10] Noor, A. K. – Burton, W. S. – Bert, C. W.: Computational models for sandwich panels and shells. Applied
Mechanics Reviews 49 (1996) 155-199.
[11] Piovár, S. - Kormaníková, E.: Tensile Properties of Short Fiber Composites: Analytical Models and
Experimental Results. Young Scientist (2013) 1-8.
[12] Piovár, S. Stress-strain analysis of multilayered composite panels (in Slovak), PhD. Thesis. Košice, 2013,
231 pp.
[13] Száva, I.: Selected Chapters of Mechanics of Composite Materials III. Derc Publishing House, 2013,
Košice.
[14] Sumec, J. - Minárová, M.: Mechanical and Mathematical Modeling of Viscoelastic Continua – Constitutive
Equations (Enlarged Abstract). In: „Modelování v mechanice“, VŠB – Stavební fakulta, Ostrava 2013.
~ 182 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
VODOROVNE ZAŤAŽENÉ PONORENÉ PILOTY
Ľ. Prekop1
Abstract
The subject of this paper is the analysis and modeling of the buried piles. Analytical solution has been briefly
described and the created model of the buried pile using the software ANSYS has been presented. The obtained
results of displacements and stresses have been compared with the results of an analytical solution.
Kľúčové slová
ANSYS; FEM; Nonlinear Analysis; Pile Foundations
1
ÚVOD
Príspevok sa zaoberá výlučne účinkami vodorovne zaťažených pilot. Riešenie je závislé od zvoleného modelu
piloty, od modelu podložia a vzájomnej interakcie piloty a podložia. Najčastejšie sa ohybom namáhané piloty
vyšetrujú ako pružné prúty, spolupôsobiace s pružným a homogénnym podložím alebo po dĺžke pilot
premenným podložím Winklerovho typu pri obojstrannej väzbe piloty a podložia. Winklerov model pomerne
dobre popisuje prácu nesúdržných podloží. Neumožňuje však roznos zaťaženia v pôdnom masíve a vyšetrovanie
tej istej piloty od iných účinkov. Iné účinky sú reprezentované najmä pôsobením zvislého zaťaženia, centricky
pôsobiacimi silami alebo priťažením povrchu podložia v okolí piloty.
2
PONORENÉ PILOTY
Často používaným kotevným systémom pri zakladaní stavieb sú ponorené piloty. Tieto pomáhajú prenášať
zemný tlak pôsobiaci na paženie do základovej pôdy. Uplatňujú sa hlavne pri kotvení štetovnicových, pilotových
a podzemných stien do okolitého zemného masívu. Kotevný systém tvorí ťahadlo, ktoré je jedným koncom
pripevnené o paženie a druhým koncom o kotviacu pilotu. Kotviaca pilota ponorená do podložia je
v ľubovoľnom bode drieku namáhaná sústredenou silou (Obr.1.).
Úlohou je nájsť veľkosť a spôsob rozdelenia napätí na dotyku piloty a podložia tak, aby boli pod kontrolou
dodatočné pretvorenia a vnútorné sily v pilote. Hlava ponorených pilot je zvyčajne voľná a päta môže byť podľa
spôsobu uloženia voľná, kĺbovo podopretá alebo dokonale votknutá. Príspevok sa pridržiava upraveného
Žemočkinovho postupu. Pritom sa predpokladá, že podložie predstavuje prostredie, ktoré opisujú rovnice pre
Boussinesquov polpriestor.
3
VÝPOČTOVÝ MODEL
Vo výpočte boli použité tri rôzne druhy podložia s nasledujúcimi deformačnými modulmi Ez = 1000 kPa (model
A), Ez = 5000 kPa (model B) a Ez = 50 000 kPa (model C). Bol vytvorený priestorový model ponorenej piloty.
1
Ing.Ľubomír Prekop, PhD., Katedra stavebnej mechaniky, Stavebná fakulta STU, Radlinského 11,
813 68 Bratislava, [email protected]
~ 183 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Na modelovanie piloty bol použitý prvok SOLID65, okolitý zemný masív bol vytvorený pomocou prvkov
SOLID45 a kontakt typu plocha–plocha pomocou kontaktných prvkov TARGE170 a CONTA173.
Obr. 1. Kotevný systém nábrežného paženia a ponorenej piloty a rozmery výpočtového modelu
10
10
9
9
8
8
Pilota po výške [m]
Pilota po výške [m]
Na ilustráciu dosiahnutých výsledkov sú na Obr.2. uvedené priebehy priehybov a kontaktných napätí pre všetky
modely.
7
6
5
7
6
5
Model A
Model B
Model C
4
Model A
Model B
Model C
4
-0.01
0
0.01
0.02
0.03
0.04
0
Priehyb [m]
40
80
120
160
Napätie [kPa]
Obr.2. Priebehy priehybov a kontaktných napätí po výške piloty
4
ZÁVER
Z výsledkov porovnania pre všetky modely konštrukcie je zrejmé, že vlastnosti podložia v podstatnej miere
ovplyvňujú rozdelenie napätí a hodnoty priehybov po výške piloty a v podstatne menšej miere ovplyvňujú
vnútorné sily (ohybové momenty a priečne sily). Na záver je možné konštatovať, že použitý spôsob modelovania
kontaktu ponorenej piloty s okolitým zemným masívom veľmi dobre popisuje správanie sa konštrukcie od
zaťaženia a je možné ho použiť pri ďalších výpočtoch tohto typu konštrukcie.
POĎAKOVANIE
Tento príspevok bol vypracovaný v rámci grantového projektu VEGA č.1/0629/12.
LITERATÚRA
[1]
KOLLÁR P., MISTRÍKOVÁ Z.: Spolupôsobenie ohybom namáhaných pilot s pružným polpriestorom –
polity v hlave voľné. Inženýrske stavby, 1985, číslo 1, stránky 29–39.
[2]
KOLLÁR, P., MISTRÍKOVÁ Z.: Ponorené piloty ako korene zemných kotiev namáhané ohybom.
Inženýrske stavby, 1987, číslo 5, stránky 232–242.
[3]
PREKOP, Ľ.: Analýza ponorených pilot. 21th SVSFEM ANSYS Users' Group Meeting and Conference
2013, 13.–14.jún 2013, Luhačovice, Česká republika.
~ 184 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
POKRITICKÉ PÔSOBENIE ŠTÍHLEJ STENY
M. Psotný1
Abstract
The stability analysis of the slender web loaded in compression was presented. The nonlinear finite element
method equations were derived from the variational principle of minimum of potential energy [1]. To obtain the
nonlinear equilibrium paths, the Newton-Raphson iteration algorithm was used. Corresponding levels of the
total potential energy were defined. The peculiarities of the effects of the initial imperfections [4] were
investigated. Special attention was focused on the influence of imperfections on the post-critical buckling mode.
The stable and unstable paths of the nonlinear solution were separated.
Kúové slová
Stability; post-buckling; geometric nonlinear theory; initial
Newton-Raphson method; arc-length method.
1
imperfection;
finite
element
method;
ÚVOD
Jedným zo závažných problémov v mechanike pôsobenia tenkostenných konštrukcií je jav preskoku štíhlej
steny. I ke* preskok nemusí znamena kolaps tenkostennej konštrukcie, predsa len je to nežiadúci fenomén.
V príspevku je opísaný mechanizmus takéhoto preskoku na príklade tlakom namáhanej štíhlej steny. Pre opis
javu je nutné akceptova geometricky nelineárnu teóriu, ktorá umož(uje získa celý priebeh závislosti zaaženie
– premiestnenie. Pre príslušné vetvy riešenia je zárove( vyhodnotená zodpovedajúca celková potenciálna energia
sústavy, priom nulová hladina zodpovedá nezaaženej stene.
V základných výpotových modeloch sa zvyajne volí tvar zaiatonej geometrickej imperfekcie totožný
s tvarom vyboenia zodpovedajúcim minimálnej hodnote kritického zaaženia. Pri takejto vobe zaiatonej
imperfekcie ažko možno oakáva preskoky vo vyboujúcej ploche. Preto je v prezentovanom lánku
rozpracovaný výpotový model vychádzajúci z princípov metódy konených prvkov a prehodnocované sú rôzne
tvary zaiatonej geometrickej imperfekcie a ich vplyv na pokritické štádium pôsobenia steny. Pre jednoduchos
budeme popisova tvar vyboujúcej plochy v tvare m-n o predstavuje poet polvn v smere x (smer pôsobenia
zaaženia) a v smere y (smer kolmý na zaaženie, pozri obr. 1).
2
NELINEÁRNA ANALÝZA
Bol pripravený poítaový program, ktorý na analýzu používa konené prvky so 48 stup(ami vonosti [3].
Konenoprvkový model pozostáva z 8x8 elementov. Klasická Newtonova – Raphsonova iteraná metóda, kedy
v každom iteranom kroku modifikujeme prírastkovú tuhostnú maticu, je aplikovaná na riešenie systému
nelineárnych rovníc. Základná zaažovacia dráha vychádza z nulovej hladiny zaaženia a zaiatonej hodnoty
premiestnenia, t. j. parameter zaiatoného uzlového premiestnenia a malá hodnota parametra zaaženia sú
1
Doc. Ing. Martin Psotný, PhD., Katedra stavebnej mechaniky, Stavebná fakulta, Slovenská technická
univerzita, Radlinského 11, 813 68 Bratislava, Slovensko, telefón: (+421) 259 274 652, e-mail:
martin.psotny@stuba.sk.
~ 185 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
uvažované ako 1. aproximácia v iteranom procese. Pre získanie *alších dráh používame náhodné kombinácie
týchto parametrov ako 1. aproximáciu. Interaktívna zmena pivotného lena poas výpotu je nevyhnutná
na stanovenie potrebného potu zaažovacích dráh, následne môžeme pristúpi k vyhodnoteniu kvality riešenia,
definova kritické body a oddeli stabilné a nestabilné asti riešenia.
p
C
B
A
p
b
a = b = 120 mm
t = 1 mm
E = 210000 MPa
ν = 0,3
a
Tvar zaiatonej imperfekcie:
Obr. 1. Štíhla tlaená stena: a) popis veliín, b) MKP model
Takto získané výsledky sú v príspevku porovnávané s výsledkami analýzy pomocou programového balíka
ANSYS. V tomto prípade bol výpotový model vytvorený zo 16x16 elementov (Obr. 1b). Použitý bol element
typu SHELL143 (4 uzly, 6 DOF v každom uzle). Na riešenie systému rovníc bola zvolená arc-length metóda,
polomer džky oblúka bol poítaný z prírastku zaaženia. Stanovená bola len primárna zaažovacia dráha, veda
dráhy je vykreslený tvar vyboovania v pokritickej fáze pôsobenia.
3
ILUSTRA(NÝ PRÍKLAD
Analyzujme tlaenú stenu, po obvode kbovo podopretú, vstupné parametre poda obr. 1. Riešenia v podobe
zaažovacích dráh pre konkrétne tvary zaiatonej tvarovej imperfekcie sú znázornené na obr. 2 a 3. Tu môžeme
vidie, že dve vemi podobné imperfekcie na zaiatku zaažovania ponúkajú v pokritickom štádiu pôsobenia
odlišné výsledky.
Prezentované riešenia sú rozdelené na dve asti. V avej asti vidíme zaažovacie dráhy, v pravej
zodpovedajúce hladiny celkovej potenciálnej energie (nulovú hodnotu reprezentuje nezaažená stena).
V spodnej asti obrázku je pre porovnanie výsledok tohto problému získaný pomocou systému ANSYS.
Vzhadom na tvar zaiatonej imperfekcie sú ako referenné uvažované doskové premiestnenia uzlov
oznaených A, C (pozri obr. 1a). Hrubá iara reprezentuje stabilnú as dráhy, tenká iara nestabilnú.
V obrázkoch sú vyznaené kritické body. Detailnejší rozbor získaných výsledkov sa itate dozvie v [5].
V tomto príspevku sa pokúsime preskúma možnos vyboovania steny v tvare vyboujúcej plochy 2-1.
Na obr. 2 je riešenie steny pri parametroch zaiatonej imperfekcie 601 = 0,01; 602 = 0,15. Primárna dráha je
v pokritickom štádiu v tvare 1-1 (v1 – hrubá iara). Najnižšej hladine celkovej potenciálnej energie zodpovedá
dráha v3 (tvar 2-1). Energetická bariéra bráni preskoku z v1 na v3. Ak ale zvýšime efekt tvaru 2-1 v zaiatonej
imperfekcii (602 = 0,2), stena bude v pokritickom štádiu vyboova v tvare 2-1 (obr. 3).
Nájdime teraz súvis medzi zaažovacou dráhou a zodpovedajúcou hladinou celkovej potenciálnej energie.
Výsledky na obr. 2 a 3 poukazujú na fakt, že vzájomná poloha limitných bodov v zaažovacích dráhach definuje
vekos bariéry. Nárast parametra 602 zodpovedá poklesu parametra pL3, ktorý predstavuje hodnotu zaaženia
v limitnom bode na zaažovacej dráhe s najnižšou hodnotou celkovej potenciálnej energie. Ak pL3 zodpovedá
najnižšie položenému limitnému bodu v diagrame, energetická bariéra je odstránená a riešenie bude pokraova
v pokritickom štádiu na energeticky najvýhodnejšej dráhe.
Tvar vyboujúcej plochy je zhodný s tvarom zaiatonej imperfekcie. Prínos opísaného je, že sme schopní
opísa pokritické pôsobenie steny len na základe diagramu celková potenciálna energia – zaaženie.
4
ZÁVER
Vplyv tvaru a vekosti zaiatonej imperfekcie na pokritické pôsobenie štíhlej steny je nápl(ou tohoto
príspevku. Za dôležitý výsledok pokladáme skutonos, že hladina celkovej potenciálnej energie na primárnej
~ 186 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
vetve riešenia môže by vyššia, ako hladina celkovej potenciálnej energie na niektorej sekundárnej stabilnej
vetve. Toto je predpoklad pre zmenu tvaru vyboujúcej plochy v procese zaažovania. Opis tohoto javu je
v príspevku aj ilustrovaný na konkrétnom príklade.
Vyhodnocovanie hladiny celkovej potenciálnej energie pre všetky vetvy nelineárneho riešenia je drobným
príspevkom ku skúmaniu pokritického pôsobenia, jeho rozbor na základe závislosti energia – zaaženie je
pokusom o nový prístup ku problému.
250
v3
load p [N/mm]
200
150
v1
v2
pL3
50
v3 p = 150
v1 p = 150
6
4
2
0
100
pL3 – pL2 > 0
4
2
0
-2
-4
v1
2
1
0
-1
-2
pL2
A
v1 p = 50
v2 , v3
other
paths
C
displacement w [mm]
total potential energy U *10-3 [J]
0
-7
-5
-3
-1
1
3
5
7
-8000
-4000
ZAġAŽENIE
PREMIESTNENIE
Obr. 2. Zaiatoná imperfekcia v tvare w0 = 0,01 ∗ Sx1 ∗ Sy1 + 0,15 ∗ Sx 2 ∗ Sy1
POAKOVANIE
Tento príspevok bol vypracovaný s podporou grantového projektu VEGA . 1/0629/12.
~ 187 ~
0
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
load p [N/mm]
250
200
150
v3
4
2
0
-2
-4
v1 p = 150
v2
v3 p = 150
6
4
2
0
100
pL3 – pL2 < 0
pL2
2
1
0
-1
-2
A
50
v1
pL3
v1 p = 50
v2 , v3
other
paths
v1
C
displacement w [mm]
total potential energy U *10-3 [J]
0
-7
-5
-3
-1
1
3
5
7
-8000
-4000
0
ZAġAŽENIE
Obr. 3. Zaiatoná imperfekcia v tvare
w0 = 0,01 ∗ Sx1 ∗ Sy1 + 0,2 ∗ Sx 2 ∗ Sy1
PREMIESTNENIE
LITERATÚRA
[1]
Washizu, K.: Variational Methods in Elasticity and Plasticity. Pergamonn Press, NY, 1982, 630 s.
[2]
Bloom, F. – Coffin, D.: Handbook of Thin Plate Buckling and Postbuckling, Chapman&Hall/CRC, Boca
Raton, 2001, 770 s.
Saigal, S. – Yang, I.: Nonlinear Dynamic Analysis with 48 DOF Curved Thin Shell Element. Int. J. Numer.
Methods in Engng., 22, 1985, s. 1115-1128.
Kala, Z. – Kala, J. – Škaloud, M. – Teplý, B.: Sensitivity Analysis of the Effect of Initial Imperfections on
the Stress State in the Crack-Prone Areas of Breathing Webs, In Proc. of the Fourth Int. Conf. on Thinwalled Structures, Loughborough (England, UK), 2004, s. 499-506.
Psotný, M. – Ravinger, J.: Post-Buckling Behaviour of Imperfect Slender Web. Engineering Mechanics,
Vol. 14, 2007, No. 6, s. 423-429.
[3]
[4]
[5]
~ 188 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
DYNAMICKÁ ANALÝZA VÝŠKOVEJ BUDOVY
NEPRAVIDELNÉHO PÔDORYSU
Martin Psotný a Jozef Havran1
Abstract
The aim of this paper was the proposal of structure high-rise office building that would meet the serviceability
limit state. The effects of wind and seismicity were evaluated and then compared on two alternatives. In first
alternative we fixed the model into ground. In second variant we counted with interaction between building and
sub-soil using stiffness springs. We started with the characteristics of the building, sub-soil and threedimensional model. We made determination of vertical and horizontal loads. Then we launched calculation and
got the results. After that we made assessments and presentation of results. The solution of this work is optimal
design and deployment structural elements of high-rise building.
Kúové slová
Výšková budova; statické za"aženie; dynamické za"aženie; medzný stav použite!nosti
1
ÚVOD
Príspevok je venovaný statickej a dynamickej analýze výškového objektu. Prechádzalo sa od predbežného
návrhu nosných prvkov až po záverené posúdenia. Ako podklad k návrhu a výpotom sme použili výkresovú
dokumentáciu k danému objektu, dostupnú odbornú literatúru a európske normy (EN) s národnými prílohami.
Konštrukcia bola modelovaná v poítaovom programe ako priestorový model. Riešila sa v dvoch
variantoch. V prvom sme votkli objekt do podložia, v druhom bola zohadnená interakcia konštrukcie
s podložím za pomoci pružín. Priestorový model bol namáhaný zvislým návrhovým zaažením, horizontálnym
zaažením vetra a seizmickým zaažením. Sledovali sme vodorovné výchylky, porovnávali výsledky
v jednotlivých variantoch a kontrolovali, i nie je presiahnutá maximálna povolená deformácia.
Našim cieom bolo navrhnú optimálny a hlavne funkný nosný systém, ktorý by bezpene odolával
úinkom zaaženia (vertikálneho i horizontálneho).
2
CHARAKTERISTIKA
Budova tvaru nepravidelného šesuholníka je urená na administratívne úely. Objekt má 25 nadzemných
a 3 podzemné podlažia, ktoré slúžia ako skladové priestory.
Výpotový model bol realizovaný prostredníctvom programu Scia Engineer 2011. Výpoet vnútorných síl
a deformácií sa realizoval metódou konených prvkov (MKP), použitý bol Mindlinov konený prvok.
1
Doc. Ing. Martin Psotný, PhD., Ing. Jozef Havran, Katedra stavebnej mechaniky, Stavebná fakulta, Slovenská
technická univerzita, Radlinského 11, 813 68 Bratislava, Slovensko, e-mail: martin.psotny@stuba.sk,
jozef.havran@stuba.sk.
~ 189 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
2.1 Opis nosného systému
Nosný systém tvorí železobetónová skeletová konštrukcia so stužujúcim jadrom a stpmi. Bezprievlaková
stropná doska s doskovými hlavicami je po celom obvode vykonzolovaná. Hrúbka dosky je 220 mm
(v podzemných podlažiach 300 mm). Jadro je situované v strede objektu. Steny stužujúceho jadra majú hrúbky
300 mm až 400 mm. V podzemných podlažiach sa stužujúce steny hrúbky 300 mm nachádzajú aj po obvode
objektu. Stropy a steny sú zhotovené z betónu triedy C30/37. Obvodový pláš je tvorený dvojitou transparentnou
fasádou. Rozmer stpov sa mení po výške objektu. Sú zhotovené z betónu triedy C35/45. Maximálny pôdorysný
rozmer objektu v smere osi X je 41,91 m a v smere osi Y 55,20 m (pozri obr. 2). Maximálna výška objektu nad
terénom je 100,20 m (+99,410).
Objekt je založený na pilótovom základe, ktorý pozostáva zo 138 pilót a zo základovej dosky. Takéto
riešenie založenia je nutné kvôli zložitým základovým pomerom a z dôvodu dodržania maximálneho sadania
a maximálneho nerovnomerného sadnutia základu. Pilóty sú sústredené pod stužujúcim jadrom a stpmi. Majú
kruhový pôdorysný tvar s priemerom 1000 mm a 1200 mm. Základová doska má hrúbku 1700 mm. Je zhotovená
z betónu triedy C20/25.
Obr. 1. Priestorový model (nosná konštrukcia)
2.2 Opis podložia
Riešený objekt je situovaný na Mýtnej ulici v Bratislave. Poda inžiniersko-geologického prieskumu
z danej lokality je zrejmé, že základové pomery sú hodnotené ako zložité.
Geologický profil obsahuje striedavé prekladanie vrstiev súdržných a nesúdržných zemín. Hladina
podzemnej vody bola narazená a ustálená 11,4 metra pod povrchom terénu (-12,150). Spodná hrana základovej
dosky je 12,4 metra pod povrchom terénu (-13,150). Pod základovou škárou sa nachádza vrstva pieskov triedy
S4-SM a vrstva štrkov G3-GF. Spodná hrana pilótového základu leží v hbke 21,9 metra pod povrchom
(-22,650). Pilóty sú opreté v piesku triedy S4-SM.
2.3 Opis pružného podoprenia priestorového modelu
Na zohadnenie pružného podložia bol použitý jednoparametrický model podložia, tzv. Winklerov model.
Tento model vychádza z predpokladu, že v každom bode podložia je zaaženie p priamo úmerné priehybu w
v tomto bode a je nezávislé od priehybov v ostatných bodoch. Model nepoíta so spolupôsobením celého okolia
konštrukcie [1]. Koeficient ložnosti k pre základovú dosku sa urí poda vzahu (1).
1,13 ⋅ E 1
(1)
k=
⋅
1−υ 2
A
- modul pružnosti materiálu podložia,
E
[kN ⋅ m −2 ]
- Poissonovo íslo,
υ
[−]
- plocha základovej konštrukcie.
A
[m 2 ]
~ 190 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
N
s
October 2013, Bratislava
Tuhos pružiny vo zvislom smere Kz, ktorá sa použije ako pružná podpera pilóty, sa urí poda (2).
N
Kz =
s
- návrhová osová sila,
[kN ]
- zvislá deformácia (sadnutie pilóty).
[m]
(2)
Na zohadnenie pružného podložia pri dynamickom zaažení modelu bol použitý takisto
jednoparametrický model podložia. Poítali sme s odporúanou hodnotou koeficientu ložnosti k=35MN/m3.
Vodorovné posunutie a pootoenie päty pilóty sme zohadnili pomocou tuhostí poda (3).
0 , 35
0,8
Ep Ep (3)
=
0
,
14
⋅
K HH = 0,6 ⋅ K
MM
E Es s
- modul pružnosti materiálu pilóty,
MN / m 2
Ep
ES
3
[
]
[MN / m ]
2
- modul pružnosti zeminy v okolí pilóty.
ZAAŽENIE
Výpotový model bol zaažený stálym (vlastná tiaž, ostatné stále zaaženie), premenným (úžitkové, sneh,
vietor) a seizmickým návrhovým zaažením [3]. Vnútorné sily, napätia a deformácie boli vypoítané od
návrhových kombinácií zaažení. V tomto príspevku sa budeme *alej venova zaaženiu vetrom a seizmicitou.
3.1 Za,aženie vetrom
Zaaženie vetrom sme posudzovali v dvoch smeroch. Návrhové hodnoty boli stanovené poda [3].
Obr. 2. Rozdelenie oblastí s rôznym vonkajším tlakom pre 4 smery prúdenia vetra
3.2 Seizmické za,aženie
Na urenie seizmického zaaženia sme použili návrhové spektrum odozvy. Horizontálne spektrum odozvy
(typ 1) a vertikálne spektrum odozvy. Návrhové spektrá boli stanovené poda [2], [3].
1,72
1,35
Obr. 3. Horizontálne a vertikálne návrhové spektrum odozvy (perióda)
~ 191 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
4
October 2013, Bratislava
VÝSLEDKY
V tomto odseku sa budeme venova posúdeniam nosnej konštrukcie (vodorovné výchylky od zaaženia
vetrom a seizmicitou). Maximálne horizontálne posunutie v prvom variante pri zaažení vetrom je s1 = 26,2 mm.
Limitná hodnota posunutia má hodnotu slim = 50 mm. Platí: s1 Š slim, 26,2 mm < 50 mm. Maximálne posunutie
v druhom variante je s2 = 44,9 mm. Platí: s2 Š slim, 44,9 mm < 50 mm.
Maximálna horizontálna výchylka v prvom variante pri zaažení seizmicitou je s1 = 87,6 mm. Limitná
hodnota je slim = 200 mm. Platí: s1 Š slim, 87,6 mm < 200 mm. Maximálne horizontálne posunutie v druhom
variante je s2 = 91,2 mm. Platí: s1 Š slim, 91,2 mm < 200 mm. Z výsledkov vidíme, že objekt založený na
pružnom podloží sa správa poddajnejšie ako objekt votknutý do základu.
Horizontálna výchylka (mm)
Horizontálna výchylka (mm)
Obr. 4. Porovnanie horizontálnych výchyliek pri zaažení konštrukcie vetrom a seizmicitou
5
ZÁVER
Cieom predloženého príspevku bol návrh nosnej konštrukcie výškovej administratívnej budovy, ktorý by
vyhovoval medznému stavu použitenosti pri zaažení vetrom a seizmicitou. Z výsledkov sme zistili, že
dominantné zaaženie je seizmické a že horizontálna tuhos konštrukcie v smere osi X je menšia ako v smere
osi Y. Z podmienky posúdenia limitného priehybu vyplýva, že objekt je odolný voi úinkom horizontálnych
zaažení.
POAKOVANIE
Tento príspevok bol vypracovaný s podporou grantového projektu VEGA . 1/0629/12.
LITERATÚRA
[1]
[2]
[3]
JENDŽELOVSKÝ, N.: Modelovanie základových konštrukcií v MKP. Bratislava : Nakladatestvo STU,
2009. 94 s. ISBN 978-80-227-3025-9.
SOKOL, M.: Navrhovanie nosných konštrukcií stavieb: Seizmická odolnos". Bratislava : Nakladatestvo
STU, 2009. 108 s. ISBN 978-80-227-3075-4.
STN EN 1991-1-1, STN EN 1991-1-3, STN EN 1991-1-4, STN EN 1998-1.
~ 192 ~
Proceedings of the 11th International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
STAGE FOR ECOC 2013 IN KOŠICE
J. Ravinger 1
Abstract
Opening ceremony for the European Capital of Culture in Kosice – Slovakia had been performed on special
stage in the centre of the city. The stage was arranged from 6 m and 12 m long transport containers. Special
swing structure had to be arranged. Author of the offered article was responsible for the static design of this
unusual structure.
Key Words
Steel structure, static behaviour, stiffness of the structure, dynamic behaviour, vibration.
1
INTRODUCTION
The city of Košice, as the first in Slovakia, was awarded the prestige title of European Capital of Culture –
ECOC 2013. The Grand Opening Show was situated in the Main Square and it was held on 20-th of January
2013. For this occasion the group of young architects “JaOnMi CreatureS“ (www.jaonmi.com) had prepared
an unusual scene composed from the 12 m and 6 m long containers. The author of the offered article was
responsible for the static design of this unusual structure.
2
CONTAINER SWING STRUCTURE
Fig. 1 shows the general view of the stage. The 6 m containers situated in the right part of the stage were stable.
The left side of the stage had been arranged as the “lifting” 12 m container. During the opening ceremony the
actors were situated in different parts of the stage. The situation with the down position of the moving container
is shown in Fig. 2. The special swing structure had been prepared (Fig. 3). To arrange the scale balance inside
the rear 6 m container the barrels with water had been used. To keep the stage container in vertical position the
supporting point was situated with eccentricity 0.15 m.
3
STATIC BEHAVIOUR
The lifting arm represents the overhanging end of the beam and the stresses we can get from the simple
equations
V
M
z
I
F .l
z
I
where F is the vertical force composed from the weight of the container and 15 people who had been supposed
as the maximum number of the people in the scene. Finally (assuming the load factor =1.4) we got F=74200 N.
l=6000 mm - the span of the overhanging end,
1
Dr.h.c. prof. Ing. J. Ravinger, DrSc. Faculty of Civil Engineering SUT, 813 68 Bratislava, Radlinského 11,
Slovakia., e-mail: jan.ravinger@stuba.sk
~ 193 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
I - the moment of inertia, z - cross section coordinate.
The cross section was different along the length
2*120*10
2*U 350
2*U 220
2*U 350
The vertical displacement had been evaluated by the computer. We have assumed the maximum vertical
displacement as G
l
250
24 mm . The maximum stresses were rather small (about 120 MPa).
Fig. 1. The general view of the stage – the container stage up
Fig. 2. The general view of the stage – the container stage down
~ 194 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Fig. 3. The scheme of the container swing
0.75 m
0
1
2m
Scale
6.0 m
3
0.15 m
7
4
6
7
2.45/
1
2
6
Legend of structure details:
1 container arranged as a stage
2 container arranged as a support
3 container arranged as a scales
balance
4 lifting arm
5 cable reel
6 position stabilizing cable
7 additional floor
5
7
4
6
6
5
1
2
12.0 m
6
3
6.0 m
5
6
4
Fig. 4. The structure of the container swing
~ 195 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
4
October 2013, Bratislava
DYNAMIC BEHAVIOR
The stage serves as the place for singers and dancers. In such a case it was necessary to check the possibility of
the structure resonance. The natural frequencies had been evaluated from the determinant equation
K Z2KM
det
0
where K is the stiffness matrix of the structure, KM – the mass matrix.
Fig 5. shows the notation of the nodal displacements for the static and dynamic approximation of the structure.
For the evaluation of the mass matrix the influence of axial forces had been taken into the solution.
Some results are presented in Fig. 6. The frequency produced by the dancers could be the same as the evaluated
natural frequency. It means that the unpleasant resonance effect could occur. We must note that the natural
frequency is highly sensitive to the mass represented by the people inside.
26
y
25
23
24
3
1
22
10
2
0
0
27
0
x
0
Fig. 5. The notation of the nodal displacements for the static and dynamic calculation
Ȧ2=84.5 s-
Ȧ2=108.5
2
2
Fig. 6. The natural frequency and the modes of vibration of the container swing structure
5
CONCLUSION
Presented structure represents a moving mechanism and it had to be prepared in very short time without any
training. For the authors it was extremely mentally exhausting event.
ACKNOWLEDGEMENT
This paper has been supported by Slovak Scientific Grant Agency, grant No. 1/0629/12.
REFERENCES
[1]
[2]
[3]
Clough, R.W. – Penzien, J.: Dynamics of Structures, McGraw-Hill, New York. 1993
Ravinger, J.: Stability & Vibration. STU, Bratislava, 2012
Ravinger, J.: Computer Programs – Static, Stability and Dynamics of Civil Engineering Structures. Alfa,
Bratislava, 1990. /in Slovak/
~ 196 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
ON STOCHASTIC APPROACH TO HUMAN-GRANDSTAND
INTERACTION
O. 5RNRã1 and J. 0iFD2
Abstract
In previous work, it has been shown that under reasonable assumptions, the response of a human-grandstand
system can be approximated satisfactorily with Gaussian processes compared to the Monte Carlo simulation.
Introduced restrictions included fixed spatial distribution of the crowd and deterministic passive crowd
parameters. This contribution tries to extend the stochastic approach in a systematic way to the random spatial
distribution of an active and a passive crowd. Finally, moment equations of the system are derived with an
attempt for their solution under some closure assumptions.
Key Words
Grandstand; Gaussian white noise; random vibration; active crowd; passive crowd
1
INTRODUCTION
In previous work, it has been shown that to achieve a reasonable level of approximation, mainly in terms of the
acceleration RMS values and to some extent in terms of displacement mean up-crossing rates, it is sufficient to
use a linear combination of independent AR(2) processes to represent an active crowd. However, quite stringent
assumptions were adopted; particularly the spatial distribution of the crowd was treated as fixed. Obviously,
randomizing the location of passive spectators leads to significant increase of the complexity and such
generalization results in random Green function and methods such as Perturbation, State Augmentation, etc. have
to be used. Hence, this contribution is limited only to two aspects under the following restrictions
x human-grandstand interaction assuming only an active crowd, but randomly distributed,
x human-grandstand interaction assuming both, an active and a passive crowd with random spatial
distribution.
In the first case, the solution is a slight generalization of quoted approach presented in [7], since all the
randomness stems from the right hand side, and is realized in terms of indicator random variables multiplied by
loading processes. The second case is more complicated because the random variables and/or processes are
present on both sides of the equation.
It is worth to mention that in both cases, despite the Gaussian forcing, the response is non-Gaussian. In the first
case it is due to a product of two random variables on right hand side, among which one is Gaussian; in the
second case the system is not deterministic, or from the point of view of the State Augmentation Method, the
system is nonlinear in state-space variables. But again we will adopt second order approximations, i.e. Gaussian,
since mainly the RMS values are of our interest.
1
,QJ2QGĜHM5RNRã&987LQ 3UDJXH)DFXOW\RI&LYLO(QJLQHHULQJ'HSDUWPHQWRI0HFKDQLFV7KiNXURYD3Uague 6 - Dejvice,
tel.:(+420) 22435 4478, e-mail: ondrej.rokos@fsv.cvut.cz.
2
3URI ,QJ -LĜt 0iFD&6F &VUT in Prague )DFXOW\ RI &LYLO (QJLQHHULQJ 'HSDUWPHQW RI 0HFKDQLFV 7KiNXURYD 3Uague 6 Dejvice, tel.:(+420) 22435 4500, e-mail: maca@fsv.cvut.cz.
~ 197 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
2
October 2013, Bratislava
PRELIMINARY REMARKS
Assuming geometrically and physically linear structure and employing the finite element method, the system is
described through following set of equations
ࡹࢆሷሺ‫ݐ‬ሻ ൅ ࡯ࢆሶሺ‫ݐ‬ሻ ൅ ࡷࢆሺ‫ݐ‬ሻ ൌ ࡳࢅሺ‫ݐ‬ሻ,
(1)
which is rewritten as the first order ODE in centered form
෩ ሺ‫ݐ‬ሻ
ࢆ
૙
ቈ ሶ ቉ൌቂ
ௗ௧ ࢆ
െࡹିଵ ࡷ
෩ ሺ‫ݐ‬ሻ
ௗ
෩ ሺ‫ݐ‬ሻ
ࢆ
૙
ࡵ
෩ ሺ‫ݐ‬ሻ,
቉ ൅ ቂ ିଵ ቃ ࢅ
ିଵ ቃ ቈ ሶ
ࡹ ࡳ
െࡹ ࡯ ࢆ
෩ ሺ‫ݐ‬ሻ
(2)
or more compactly
ࢄሶሺ‫ݐ‬ሻ ൌ ࢇࢄሺ‫ݐ‬ሻ ൅ ࢈ࢅሺ‫ݐ‬ሻǡ ‫ ݐ‬൒ Ͳ,
(3)
෩ and ࢄ ൌ ሾࢆ
෩் ǡ ࢆ
෩ሶ ் ሿ் are Rd/2 and Rd-valued stochastic vector processes, over-dot denotes the derivative
where ࢆ
with respect to time; ࡷ, ࡹ, ࡯ and ࡳ are (d/2, d/2) and GG¶ matrices of structure stiffness, mass, damping and
෩ represents RG¶-valued stochastic forcing term and ࢇ, ࢈ are (d, d), (d, d¶) matrices. Tilde
the force distribution. ࢅ
෩ ሺ‫ݐ‬ሻ ൌ ࢅሺ‫ݐ‬ሻ െ ࣆ௒ ሺ‫ݐ‬ሻ, ࣆ௒ ሺ‫ݐ‬ሻ ൌ ‫ࢅܧ‬ሺ‫ݐ‬ሻ. Since the mean
here and henceforth denotes a centered quantity, i.e. ࢅ
value response ࣆ௓ of Eq. (1) can be solved separately, we will work with centered form only.
Based on some heuristic arguments, Central limit and Rosenblatt theorems [3], we can adopt a Gaussian
approximation of the response in terms of the sum of independent AR(2) processes, for definition see [1]. This
simplification is also supported by the fact that from the serviceability point of view an RMS acceleration values
are critical. Variable ࢄ can be then enlarged to include also the state-space variables of forcing terms ࡿ,
෩் ǡ ࢆ
෩ሶ ் ǡ ࡿ் ሿ் . Resulting system is again in the form of Eq. (3), now the ,W{ 6'( (Stochastic
particularly ࢄ ൌ ሾࢆ
Differential Equation), for simplicity not relabeled. Forcing is just ࢅሺ‫ݐ‬ሻ ൌ ݀࡮ሺ‫ݐ‬ሻȀ݀‫ݐ‬, ࡮ሺ‫ݐ‬ሻ being the vector
Brownian motion. $FFRUGLQJWR,W{formula [4], the second order moment equations are derived in the form
ࢉሶ ௑ ሺ‫ݐ‬ǡ ‫ݐ‬ሻ ൌ ࢇࢉ௑ ሺ‫ݐ‬ǡ ‫ݐ‬ሻ ൅ ࢉ௑ ሺ‫ݐ‬ǡ ‫ݐ‬ሻࢇ் ൅ ࢈࢈்
డࢉ೉ ሺ௧ǡ௦ሻ
డ௧
(4)
ൌ ࢇࢉ௑ ሺ‫ݐ‬ǡ ‫ݏ‬ሻǡ ‫ ݐ‬൐ ‫ ݏ‬൒ Ͳǡ
where ࢉ௑ ሺ‫ݐ‬ǡ ‫ݏ‬ሻ ൌ ‫ܧ‬ሾࢄሺ‫ݐ‬ሻࢄ் ሺ‫ݏ‬ሻሿ denotes the covariance function. Since ࢇ and ࢈ are time-invariant, the solution
is an Ornstein-Uhlenbeck process with stationary limit distribution, which can be computed setting ࢉሶ ௑ ൌ ૙ in
Eq. (4) and solving appropriate algebraic, so-called Lyapunov equation. Stationary mean value ࣆ௑ ሺ‫ݐ‬ሻ is
obviously zero, because applied forces are centered. Solution can be also performed in frequency domain.
Coefficients for AR(2) processes can be obtained by optimization algorithms in frequency domain and the mean
value by the least squares method with truncated Fourier series based on measurements and/or artificial MC
(Monte Carlo) generators [6, 8].
3
RANDOMIZING THE SPATIAL DISTRIBUTION OF AN ACTIVE CROWD
In this section, a concise generalization of the case where only an active crowd with random spatial distribution
is present on the structure will be given. For the simplest case, it is reasonable to accept a non-informative
distribution, i.e. spatially delta-correlated field realized through discrete random independent indicators. Let us
accept the following form of the forcing term in Eq. (1), now denoted as ࡲ,
‫ܨ‬௜ ሺ‫ݐ‬ሻ ൌ ߯௜ ሼܻ෨௜ ሺ‫ݐ‬ሻ ൅ ߤ௒ ሺ‫ݐ‬ሻሽ,
(5)
where ‫ܨ‬௜ is the i-th forcing term, ܻ෨௜ is the zero mean AR(2) approximation introduced earlier, ߤ௒ is the mean
approximation based on truncated Fourier series and ߯௜ are iid (independent and identically distributed) indicator
random variables or Bernoulli trials
߯௜ ൌ ൜
Ͳǡ ܲሾ߯௜ ൌ Ͳሿ ൌ ͳ െ ‫݌‬
ͳǡ ܲሾ߯௜ ൌ ͳሿ ൌ ‫݌‬
(6)
for ‫ א ݌‬ሾͲǡͳሿ with moments ‫߯ܧ‬௜௞ ൌ ‫݌‬, ݇ ൌ ͳǡʹǡ ǥ. Hence, the right hand side of Eq. (1) has a vector form
ࡳࡲሺ‫ݐ‬ሻ ൌ ࡳ࣑ࢅሺ‫ݐ‬ሻ, where ࣑ ൌ ݀݅ܽ݃ሺ߯ଵ ǡ ǥ ǡ ߯ௗǯ ሻ. In this context, the probability ‫ ݌‬can be interpreted as an
intensity factor describing an overall loading scenario. Since the system is linear, by centering of Eq. (1) and
taking into account Eq. (5) and the fact that ߯௜ ¶VDUHiid, we obtain the mean response in the form ‫ࣆ݌‬௓ , where ࣆ௓
is the mean response of the fully occupied system loaded by ࢅሺ‫ݐ‬ሻ. Due to linearity, the indicator functions can be
~ 198 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
transferred to diffusion term RIWKH,W{ SDE (3) and change ࢈࢈் in Eq. (4) to ࢈‫ܧ‬ሾ்࣑࣑ ሿ࢈் which, taking again
into account iid of ߯௜ ¶V\LHOG the resulting covariance matrix in the form ‫ࢉ݌‬௑ , where ࢉ௑ denotes the covariance
෩.
matrix of fully occupied structure loaded by ࢅ
Let us compare the performance of the above method on the structure depicted in the Fig. 1a) with MC. Structure
represents a simple cantilever grandstand counting 72 positions for spectators, MC forcing generator according
to [8] employed, load level ‫ ݌‬ൌ ͲǤͷ. For results see Fig. 1b), 1c) and Tab. 1 below.
a)
b)
c)
Fig. 1. a) geometry of the structure with realization of uniform random crowd distribution for ‫ ݌‬ൌ ͲǤͷ, b) mean
response for labeled node, c) normed displacement histogram in comparison with standard Gaussian density
Model/Quantity
Analytical
MC 500
‫ݑݎܽݒ‬ሾ݉ଶ ሿ
1.468e-6
1.819e-6
‫ݑݎܽݒ‬ሷ ሾ݉ଶ Ȁ‫ ݏ‬ସ ሿ
1.843
2.231
ܴ‫ݑܵܯ‬ሾ݉ሿ
3.187e-3
3.159e-3
ܴ‫ݑܵܯ‬ሷ ሾ݉Ȁ‫ ݏ‬ଶ ሿ
2.991
2.925
ܶ݅݉݁ሾ‫ݏ‬ሿ
2.378
42.8861)
Tab. 1. Comparison of variance, RMS values and computer time consumptions; 1) time for 100 realizations
Note (Generalization to correlated fields): The assumption of independence and identical distribution of the
indicator variables ߯௜ yielding the diagonal form of the correlation matrix ‫ܧ‬ሾ்࣑࣑ ሿ is the simplest possible.
Nevertheless, it is reasonable to assume interactions between spectators, e.g. an isotropic homogeneous
correlation field in exponential form
‫ܧ‬ൣ߯௜ ߯௝ ൧ ൌ ݇௜௝ ݁ ିఈఘ೔ೕ ,
(7)
where ݇௜௝ , ߙ ൐ Ͳ and ߩ௜௝ ൌ ห࢘௜ െ ࢘௝ ห denotes mutual distance between i±th and j±th spectator, ࢘௜ being the
position vector. Generalization of Eq. (4) is straightforward and omitted for the case of brevity. To our
knowledge, no models are available in the literature and some experimental data would be helpful.
4
RANDOM DISTRIBUTION OF AN ACTIVE AND A PASSIVE CROWD
In this chapter we will assume both types of the crowd, and moreover that the grandstand is fully occupied.
Consequently, at all possible locations we are alternating between an active and a passive spectator, i.e. between
the force on the right hand side of Eq. (1) and a biodynamic model appearing in, and enlarging matrices ࡷ, ࡹ
and ࡯. Let us analyze following simple example: we have a harmonic oscillator with only two positions for
spectators, cf. Fig. 2, where only one position can be occupied by active spectator with probability ‫݌‬, or passive
spectator with probability ͳ െ ‫݌‬.
Fig. 2. Simple example of harmonic oscillator with two positions for spectators, ܹ௜ ሺ‫ݐ‬ሻ ൌ ݀‫ܤ‬௜ ሺ‫ݐ‬ሻȀ݀‫ݐ‬, ݅ ൌ ͳǡʹ,
mutually independent
~ 199 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Hence, the governing equations can be written as
൤
݉௦
Ͳ
ܼሷ
ܿ ൅ ߯ҧܿ௛
Ͳ
൨ ቈ ௦቉ ൅ ൤ ௦
െ߯ҧܿ௛
߯ҧ݉௛ ܼሷ௛
݇ ൅ ߯ҧ ݇௛
െ߯ҧܿ௛ ܼሶ௦
൨ቈ ቉ ൅ ൤ ௦
߯ҧܿ௛ ܼሶ௛
െ߯ҧ ݇௛
െ߯ҧ ݇௛ ܼ௦
ܹ ൅ ܹ߯ଶ
൨൤ ൨ ൌ ቂ ଵ
ቃǡ
߯ҧ ݇௛ ܼ௛
Ͳ
(8)
where ߯ҧ ൌ ͳ െ ߯, cf. Eq. (6). There are several approximation techniques with different levels of accuracy for
the solution of stated SDE: moment equations under some closure assumptions, Perturbation method, Taylor
series method, etc. Clearly, such an example can be easily solved analytically employing conditional analysis.
The situation is equivalent with probability ‫ ݌‬to the harmonic oscillator driven by Gaussian white noise of
intensity ͳ ൅ ɖ and to two-degree-of-freedom system with probability ͳ െ ‫ ݌‬driven by unit Gaussian white noise.
Averaging leads to linear interpolation in ‫ ݌‬between the two results. However, contrary to approximation
techniques, conditional analysis cannot be applied in general cases since too many combinations occur.
Results of some approximations can be found in Fig. 3, where the stationary variance of displacement and
velocity of the structure as functions of the level ‫ ݌‬are depicted. Biodynamic model according to [2] was used.
Results are highly sensitive to ݂ଵ and ߛ, but not to load intensity.
a)
b)
Fig. 3. Results for simple example, ߛ ൌ ݉௛ Ȁ݉௦ ൌ ͲǤͷ, eigen-frequency of empty grandstand ݂ଵ ൌ ͷ Hz
For more elaborate discussion, details and results please refer to the full text of this contribution available in
electronic form on the conference CD.
Note (The case of bouncing): In this case, an active as well as a passive crowd is in continuous contact with the
structure. Bouncing spectator consists of two parts: a forcing term and a biodynamic model (so-called actuator
[5]) and the problem can be fully resolved up to the Gaussian approximation of the force by methods introduced
in chapter 3: occupy all positions with biodynamic models and randomly activate some of them through ߯௜ .
ACKNOWLEDGEMENT
Financial support for this work from the Czech Technical University in Prague under Project No.
SGS13/034/OHK1/1T/11 is gratefully acknowledged.
REFERENCES
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
Brockwell, P. ± Davis, R. ± Yang, Y.: Continuous-time Gaussian autoregression. Stat Sinica 2007; 17: 6380.
Coermann, R.: The mechanical impedance of the human body in sitting and standing position at low
frequencies. Human Factors 1962(4): 227-53.
Grigoriu, M.: Applied non-Gaussian processes: examples, theory, simulation, linear random vibration, and
MATLAB solutions. Prentice Hall 1995.
Grigoriu, 06WRFKDVWLFFDOFXOXV$SSOLFDWLRQVLQVFLHQFHDQGHQJLQHHULQJ%LUNKlXVHU 2002.
Jones, C. ± Reynolds, P. ± Pavic, A.: Vibration serviceability of stadia structures subjected to dynamic
crowd loads: A literature review. Journal of Sound and Vibration 2011; 330: 1531-66.
Racic, V. ± Pavic, A.: Mathematical model to generate near-periodic human jumping force signals. Mech
Syst Signal Process 2010; 24: 138-52.
5RNRã 2 ± 0iFD - 7KH UHVSRQVH RI JUDQGVWDQGV GULYHQ E\ ILOWHUHG *DXVVLDQ ZKLWH QRLVH SURFHVVHV.
Advances in Engineering Software, In Print.
Sim, J.: Human structure interaction in cantilever grandstands. Ph.D. thesis 2006.
~ 200 ~
Proceedings of the 11th International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
RESPONSE OF A SIMPLY SUPPORTED BEAM EXPOSED TO A
HARMONIC FORCE WITH A RANDOM PARAMETERS
V. âiQD1
Abstract
In this paper is presented evaluation of a simply supported beam, which is exposed to the effects of a
harmonically varying force in time domain with some random parameters such as random amplitude and
random pacing frequency. This type of loading should be considered as the simplest model of a random
pedestrian, who is walking over the footbridge. Also it could be considered as loading from a crowd of vandals
with random frequency of jumping or bouncing. Structural parameters describing the footbridge are based on
the real structure across the Opatovicka Street in the Prague.
Key words
Deterministic pedestrian model; stochastic varying force; forced vibrations
1
INTRODUCTION
Loading of the structure, caused by human walking, is complex process, which is mostly simplified by
deterministic loading model. This model was derived from the theory of Fourier series and should be expressed
by the equation (1). In the next calculation is the force considered with random parameters, describing stochastic
frequencies of walking, stochastic human body mass and number of pedestrians walking synchronously across
the bridge. The comfort of pedestrians during walking, while the structure is vibrating, is limited by maximal
value of acceleration. Therefore, the probabilities of exceeding this limit will be calculated with consideration of
a different models defined by Bachmann, Ammann, Blanchard and Young. Characteristics of these models are
summarized in Tab.1.
mp f p
x
w x ,t Pb EI y z
Fig. 1. Scheme of the solved structure
1
Ing. 9ODGLPtUâiQD'HSDUWPHQWRIMechanics (k132), Czech Technical University in the Prague, Faculty of the
&LYLO (QJLQHHULQJ 7KiNXURYD 7 166 29 Praha 6 ± Dejvice, tel.: (+420) 22435 4478, e-mail:
vladimir.sana@fsv.cvut.cz
~ 201 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Solved structure corresponds to the real structure, which is placed in the Prague across the Opatovicka street.
Limits for acceleration of vibrating beam are considered as alim 0.5 [ms-2] (Eurocode), alim 0.5 f 0.5 [ms-2] (BS
5400) and alim 0.25 f 0.78 (Ontario Code OHBDC) [ms-2] f is the first natural bending frequency of the
structure. The first natural bending frequency of the footbridge across the Opatovicka street was determined by
the experiment ( f 1 2.75 Hz) it means, that limits for this structure are represented by numerical values BS
5400 ± alim
frequency.
0.83 Hz, Ontario Code OHBDC ± alim
0.55 Hz, which is similar to the Eurocode for this
Authors
D1
Blanchard and col.
(1977)
Bachmann and
Ammann (1987)
D1 0.275
D1 0.4 0.5
Young (2001)
D1 0.37 f p 0.95 Tab.1. Impact factors of the Fourier series
2
MATHEMATICAL MODELING OF THE FORCED VIBRATIONS
The structure is modeled as a dynamical system with single degree of freedom (SDOF), which is loaded by the
harmonically varying force with random parameters. The harmonic force is described by the equation (1) where
n is the number of pedestrians (synchronized walking), m p is the body weight, g is the gravitational acceleration,
D1 is the dynamic factor, f p is the frequency of walking
n ˜ ª¬mp g m p gD1 sin 2S f p t º¼
Ft (1)
F t w t kb
cb
Fig. 2. Mathematical, computational model
This SDOF system should be expressed by the second-order differential equation (2) with the initial conditions
dwt wt 0 (the vertical deflection) and
0 (the initial velocity of the system). It means, that footbridge
t 0
dt t 0
is inactive at the beginning of the analysis.
mb
d 2 wt dt
2
cb
dwt dt
kb wt ~ 202 ~
Ft (2)
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
3
October 2013, Bratislava
NUMERICAL SOLUTION
Numerical solution of the second-order diffHUHQWLDOHTXDWLRQLVGRQHDFFRUGLQJWRWKH1HZPDUN¶VȕLQWHJUDWLRQ
method. The process of solution is expressed by the equations (3) ± (5)
§1
·
wn twn ¨ G ¸ t 2 wn G wn 1 t 2
©2
¹
(3)
wn 1 J twn J twn 1
(4)
1 ­
ª
§1
· 2 º½
2
¬ªmb J tcb G t kb ¼º ® Fn 1 cb ¬ª wn 1 J twn ¼º kb « wn twn ¨ 2 G ¸ t wn » ¾
©
¹
¬
¼¿
¯
(5)
wn 1
wn 1
wn 1
Where t is the integration time step, w w w is the vertical deflection, velocity and acceleration of the beam. The
dimensionless parameters J and G were considered as 0.5 respective 0.25. Choosing of these values is the
1HZPDUN¶VPHWKRGXQFRQGLWLRQDlly stable (method of an average acceleration).
3.1
Estimation of numerical values
For solution of the differential equation (2) is necessary to estimate the stiffness of the structure kb , discretized
mass mb and viscous damping ratio cb . The stiffness is derived from the deflection in the middle of the span,
which is computed e.g. according to the principle of the virtual works as (loading force in the middle of the
48EI
FL3
. The viscous damping ratio is determined by using the logarithmic damping
span): wL 2
Ÿ kb
48EI
L3
decrement - 0.088 , which was found out by the experiment, carried out in-situ. cb 2[ kb mb and
[
1
.
2
§ 2S ·
1 ¨
¸
©- ¹
mb 66.515 t, cb 24.6297 kNsm-1, kb 1.1626 ˜ 104 kNm-1. The parameters, describing the pedestrian were
chosen stochastically: the body weight m p and number of synchronous pedestrians n with a uniform distribution
of probability mp  60;90 kg n  1;4 , the pacing frequency f p with a normal (Gaussian) distribution of
probability: mean value P
2 Hz and standard deviation V
Fig. 3. alim=0.5 ms-2; Į1=0.5; probability 0.0257
r0.5 Hz.
Fig. 4. alim=0.83 ms-2; Į1=0.5; probability 0.0016
~ 203 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
Fig. 5. alim=0.5 ms-2; Į1=0.666; probability 0.0504
October 2013, Bratislava
Fig. 6. alim=0.83 ms-2; Į1=0.666; probability 0.0085
Acceleration limit
Dynamic factor D1
0.5
0.83
0.5
0.83
0.5
0.5
0.5
0.666
0.666
0.275
Probability of
exceeding the limit
0.0257
0.0016
0.0504
0.0085
2.10-4
Tab. 2. Summary of the results
4
CONCLUSION
In this article were presented possibilities in modeling of loading of the footbridges, caused by walking or
running pedestrians. The loading model is expressed by harmonic force increased by the dynamic factor D 1 .
Values of this coefficient were defined by e.g. Blanchard, Bachmann and Ammmann and Young. Parameters of
harmonic force were chosen stochastically from 10 000 realizations of random processes. From each realization
of these were selected the maximal values of acceleration, computed via 1HZPDUN¶Vȕ integration method. These
maximal values of accelerations were compared with limits defined in Eurocode, BS 5400 and Ontario Code
OHBDC. Also the probabilities of exceeding of these limits were computed and summarized in the Tab.2.
5
ACKNOWLEDGMENT
This paper has been created thanks to the project (SGS 12/117/OHK1/2T/11) supported by the Czech Technical
University in the Prague, which is gratefully acknowledged.
6
LITERATURE
[1]
äLYDQRYLþ 6 ± 3DYLþ $ ± Reynolds, P..: Vibration serviceability of footbridges under human-induced
excitation. Journal of Sound and Vibration, 2005. Vol. 279. No. 1-2, pp. 1-74
Bachmann, H. ± Amman, W.: Vibrations in structures induced by man and machines. Structural
engineering documents. International Association for bridge and structural egineering (IABSE)
Newland, D. E.: Pedestrian excitation of bridges ± recent results. Tenth international congress on sound
and vibration (2003)
Design of footbridges (Background document).: Human induced vibrations of steel structures.
Brand, M., Sanjayan, G. J., Sudbury, A.: Dynamic response of pedestrian bridges for random crowdloading.
[2]
[3]
[4]
[5]
~ 204 ~
Proceedings of the 11th International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
'<1$0,&.È$1$/é=$/È9.<3523ċâË3ě(68/,&,
23$729,&.È
V. âiQD1 a M. 3ROiN2
Abstract
This paper deals with a dynamical analysis of footbridge across the Opatovicka streeet, which should to predict
influence of vibrations of footbridge caused by walking respectively running pedestrians. Numerical values
obtained from theoretic calculation have been compared with experiment.
.OtþRYiVORYD
'\QDPLFNiDQDOê]DOiYNDSURSČãt ]DWtåHQtFKRGFL; ELRG\QDPLFNêPRGHOFKRGFH
1
Ò92'
.RQVWUXNFHY\EUDQiSURG\QDPLFNRXDQDOê]XVHQDFKi]tY 3UD]HSĜHVXOLFL2SDWRYLFNi'ĤYRGMHMtKR]YROHQtSUR
dyQDPLFNRXDQDOê]XMHIDNWåH jHMtSUYQtYODVWQtIUHNYHQFHRK\ERYpKRNPLWiQtVSDGiGRLQWHUYDOX± 3 Hz DMHMt
hodnota je viz Tab.1. .RQVWUXNFH VWDWLFN\ SĤVREt MDNR SURVWê QRVQtN -HGQi VH R VSĜDåHQRX NRQVWUXNFL NGH
SĜtþQê ĜH] WYRĜt åHOH]REHWRQRYi GHVND D ãHVW RFHORYêFK QRVQtNĤ X]DYĜHQpKR SUĤĜH]X 1D WpWR NRQVWUXNFL E\O
URYQČå SURYHGHQ H[SHULPHQW ]DPČĜHQê QD ]MLãWČQt YODVWQtFK IUHNYHQFt D YODVWQtFK WYDUĤ NPLWiQt 'iOH E\O
RYČĜRYiQ SUĤEČK ]U\FKOHQt SĜL QHMUĤ]QČMãtFK NRPELQDFtFK ]DWtåHQt QDSĜ EČåQê SURYR] VNXSLQD V\QFKURQQtFK
FKRGFĤ VNXSLQD V\QFKURQQtFK EČåFĤ D VNXSLQD YDQGDOĤ VQDåtFtFK VH ]iPČUQČ UR]NPLWiYDW NRQVtrukci.
([SHULPHQWE\ORQXWQpSURYpVW]HMPpQD] WRKRGĤYRGXåHVHOiYNDQDFKi]tXYêFKRGXPHWUD&VWDQLFH+iMHDMH
WHG\ ]QDþQČ Y\XåtYiQD FKRGFL SUR SĜHFKRG IUHNYHQWRYDQp NRPXQLNDFH D WDNp ] GĤYRGX KRGQRW\ MHMt YODVWQt
IUHNYHQFH 7HQWR SRVWXS PČO XUþLW, zGD D SĜtSDGQČ SĜL MDNêFK VWDYHFK ]DWtåHQt GRFKi]t N RYOLYQČQt SRKRG\
FKRGFĤ. TDWR~URYHĖMHSRGOH(XURFRGXGDQiOLPLWHPSUR]U\FKOHQtNWHUêSURRK\ERYpNPLWiQtQDEêYiKRGQRW\
alim 0,5 ms-2.
9ODVWQtIUHNYHQFH [Hz]
3URVWRURYêPRGHO
(ADINA)
3UXWRYêPRGHO
(MATLAB)
Experiment
f(1)
f(2)
f(3)
f(4)
2,47
5,13
9,74
13,18
2,14
8,56
-
2,75
5,09
9,28
12,38
Tab. 1. 9ODVWQtIUHNYHQFHNRQVWUXNFH
1
,QJ 9ODGLPtU âiQD .DWHGUD PHFKDQLN\ N ýHVNp Y\VRNp XþHQt WHFKQLFNp Y 3UD]H )DNXOWD VWDYHEQt
7KiNXURYD 166 29 Praha 6 ± Dejvice, tel.: (+420) 22435 4478, e-mail: YODGLPtUVDQD@fsv.cvut.cz
2
prof. ,QJ 0LFKDO 3ROiN &6F .DWHGUD PHFKDQLN\ N ýHVNp Y\VRNp XþHQt WHFKQLFNp Y Praze, Fakulta
VWDYHEQt7KiNXURYD 166 29 Praha 6 ± Dejvice, tel.: (+420) 22435 4476, e-mail: polak@fsv.cvut.cz
~ 205 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Obr. 1. 3ĜtþQêĜH]NRQVWUXNFHOiYN\
2
9é32ý(79/$671Ë&+)5(.9(1&Ë$9/$671Ë&+79$5ģ.0,7È1Ë
3UR WHRUHWLFNRX PRGiOQt DQDOê]X E\O Y\WYRĜHQ SURVWRURYê PRGHO NRQVWUXNFH Y SURJUDPX $',1$ D GiOH
QDSURJUDPRYiQVNULSWY SURJUDPX0$7/$%NWHUêSUDFXMHSRX]HV SUXWRYêPPRGHOHPOiYN\DMHWHG\VFKRSHQ
XUþLWMHQRK\ERYpIUHNYHQFHDRK\ERYpYODVWQtWYDU\NPLWiQt
3UREOpPYODVWQtKRQHWOXPHQpKRNPLWiQtMHPRåQp]DSVDWY PDWLFRYpPWYDUXMDNR
T
T
> M @^w` > K @^w`
T
^0`
(1)
T
T
Kde > M @ je matice hmotnosti konstrukce, > K @ je matice tuhosti konstrukce, > w@ a > w@ jsou VORXSFRYp vektory
]U\FKOHQtUHVSHNWLYHSĜHPtVWČQtMHGQRWOLYêFKX]OĤY]QLNOêFKGLVNUHWL]DFtNRQVWUXNFH 7XWRVRXVWDYXVLPXOWiQQtFK
URYQLF MH PRåQp ĜHãLW QHMUĤ]QČMãtPL PHWRGDPL MDNR MH QDSĜtNODG -DFRELKR PHWRGD URYLQQp URWDFH DWG 3UR
SRURYQiYDFt YêSRþHW E\O QDSURJUDPRYiQ SRVWXS SUDFXMtFt QD SULQFLSX PHWRG\ LQYHU]QtFK LWHUDFt Stodolova
metoda) s Y\XåLWtP*UDPP± 6FKPLGWRYLRUWRJRQDOL]DFHSURXUþHQtY\ããtFKYODVWQtFKWYDUĤ
3
02'(/29È1Ë&+2'&ģ± 9<18&(1e.0,7È1Ë
V PRGHORYiQt FKRGFĤ NWHĜt ]SĤVREXMt NPLWiQt NRQVWUXNFH OiYN\, SDQXMH GRGQHV FHOi ĜDGD QHMDVQRVWt 9 tomto
þOiQNXMHSRURYQiQDRGH]YDRGPRGHOXKDUPRQLFN\SURPČQQpVtO\ELRG\QDPLFNêFKPRGHOĤSRSLVXMtFtFKRGFHD
modelu NRQVWDQWQtVtO\NWHUiVHSRK\EXMHSRNRQVWUXNFL NRQVWDQWQtU\FKORVWt DMH]YČWãHQiRG\QDPLFNêSĜtUĤVWHN
s KRGQRWDPL]tVNDQêPLSURYHGHQêPH[SHULPHQWHP
9\QXFHQpNPLWiQtMHSRSViQRQiVOHGXMtFt VRXVWDYRXGLIHUHQFLiOQtFKURYQLFGUXKpKRĜiGX:
T
T
T
> M @^w` >C @^w` > K @^w`
T
^F `
(2)
>C @ MH PDWLFH ~WOXPX > w@T VORXSFRYê YHNWRU U\FKORVWt > F @T VORXSFRYê vektor X]ORYpKR ]DWtåHQt ÒWOXP MH GR
YêSRþWX]DKUQXWMDNR5D\OHLJKĤY ~WOXP W]QåHVHPDWLFH~WOXPXY\MiGĜtMDNROLQHiUQtNRPELQDFHPDWLFHWXKRVWL
a hmotnosti >C @ D > M @ E > K @ NRHILFLHQW\OLQHiUQtNRPELQDFH D respektive E MVRXXUþHQ\]DSĜHGSRNODGXåH
QHMPpQČMHWOXPHQSUYQtWYDUNPLWiQt
~ 206 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
[1
. [ MH VRXþLQLWHO NULWLFNpKR ~WOXPX SUR SUYQt YODVWQt WYDU D Z1 je
Z1 1
SUYQtYODVWQtNUXKRYiIUHNYHQFHSĜLþHPå]ĜHMPČSODWtåH Z1 2S f 1
Z toho WHG\ Y\SOêYi åH D
[1Z1 š E
3.1
+DUPRQLFN\SURPČQQiVtOD
+DUPRQLFN\ SURPČQQi VtOD MH QHMþDVWČML SRXåtYDQêP PRGHOHP SUR SRSLV G\QDPLFNpKR ]DWtåHQt ]SĤVREHQp
SRK\EHPFKRGFĤSRNRQVWUXNFL-HRGYR]HQi] UR]YRMHGR)RXULHURYêFKĜDG, SĜLþHPåREY\NOHSRVWDþtSUDFRYDW
pouze s SUYQtPþOHQHPWRKRWRUR]YRMH6tODMHXPtVWČQDGRPtVWDV QHMYČWãtSRĜDGQLFtSĜtVOXãQpKRYODVWQtKRWYaru
NPLWiQtSURQiãSĜtSDGSURVWpKRQRVQtNXVHWHG\MHGQiRVWĜHGUR]SČWtOiYN\ s IUHNYHQFtRGSRYtGDMtFtIUHNYHQFL
FKĤ]H± EČKX
3.2
%LRG\QDPLFNêPRGHO
3ĜLWRPWR]SĤVREXPRGHORYiQtFKRGFĤVHMLåEHURXY ~YDKXELRG\QDPLFNpFKDUDNWHULVWLN\OLGVNpKRWČOD9 WpWR
SUiFLMHPRGHOSRXåLWMDNRW]YSDVLYQtPRGHOFKRGFHW]QåHPRGHOMHXPtVWČQRSČWGRVWĜHGXUR]SČWtOiYN\DGR
PtVWDNRQWDNWXMHXPtVWČQDKDUPRQLFN\SURPČQQiVtOD
3.3
.RQVWDQWQtVtOD
3RVOHGQtP SUH]HQWRYDQêP PRGHOHP SRSLVXMtFtP SRK\EXMtFtKR VH FKRGFH MH PRGHO NRQVWDQWQt VtO\ NWHUi VH SR
NRQVWUXNFL SRK\EXMH NRQVWDQWQt U\FKORVWt v . -HMt þDVRYê SUĤEČK MH PRåQp SRSVDW MDNR SHULRGLFN\ VH RSDNXMtFt
REGpOQtNRYêLPSXOVNWHUêSĤVREtY GDQpPERGČPtVWČGRãODSX SRþDV t W 7HQWRNRQWDNWQtþDVMHRGYLVOêRG
U\FKORVWL SRK\EX D MH PRåQp MHM RGHþtVW QDSĜtNODG ] JUDIĤ SUR SUĤEČK NRQWDNWQt VtO\ Y ]iYLVORVWL QD U\Fhlosti
FKĤ]H - EČKX. 9HOLNRVW VtO\ MH XYDåRYiQD MDNR VWDWLFNi þiVW NWHUi MH WYRĜHQD VRXþLQHP KPRWQRVWL FKRGFH m p a
JUDYLWDþQtKR ]U\FKOHQt g . '\QDPLFNê SĜtUĤVWHN MH SRWRP RGYR]HQ z P\ãOHQN\ åH EČKHP FKĤ]H GRFKi]t
k ÄYROQpPX SiGX³ KPRWQpKR ERGX R KPRWQRVWL FKRGFH m p 5\FKORVW KPRWQpKR ERGX v RNDPåLNX GRSDGX je
Y\MiGĜHQD ]QiPêP Y]WDKHP
2gh . 9êVOHGQê SĜtUĤVWHN MH SRWRP GiQ SRGtOHP K\EQRVWL m p 2gh a doby
kontaktu chodidla s NRQVWUXNFt W . 6tODMHWHG\Y\MiGĜHQDY]WDKHP
F
mp g 1
W
m
p
2gh
(3)
Z URYQLFHMH]ĜHMPpåHSRNXGE\VHþDVNRQWDNWX EOtåLOQHNRQHþQX FKRGHFVWRMtFtQDPtVWČ zbyl by pouze
þOHQY\MDGĜXMtFtVWDWLFNRXWtKXFKRGFH
1
­
½
lim ®m p g m p 2gh ¾ m p g
W
¯
¿
W of
4
(4)
3$5$0(7<352180(5,&.é9é32ý(7
3URQXPHULFNêYêSRþHWE\O\SRXåLW\QiVOHGXMtFtKRGQRW\RK\ERYiWXKRVW EI 3,83 ˜ 10 9 Nm2VSRMLWiKPRWQRVW
QD MHGQRWNX GpON\ P 5,3 t/m UR]SČWt NRQVWUXNFH L 25,1 m /RJDULWPLFNê GHNUHPHQW ~WOXPX E\O ]MLãWČQ
H[SHULPHQWiOQČ s hodnotou -
0,088 3UR Y\SRþWHQt NRHILFLHQWĤ OLQHiUQt NRPELQDFH PDWLFH WXKRVWL > K @ a
hmotnosti > M @ SĜL XYiåHQt 5D\OHLJKRYD ~WOXPX MH QXWQp ORJDULWPLFNê GHNUHPHQW ~WOXPX - SĜHSRþtWDW QD
VRXþLQLWHOSRPČUQpKR~WOXPX [ SRPRFtY]WDKX
[
1
§ 2S ·
1 ¨
¸
©- ¹
~ 207 ~
2
(5)
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
9\XåLWtP MLå YêãH ]PtQČQêFK Y]WDKĤ Y\FKi]t D
SURVWêQRVQtN
0,1851 a E
October 2013, Bratislava
0,0011 6WDWLFNêP VFKpPDWHP NRQVWUXNFH MH
9\SRþWHQp]U\FKOHQt
[ms-2]
Harmonicky
SURPČQQiVtOD
.RQVWDQWQtVtOD
%LRG\QDPLFNêPRGHO
Experiment
Maximum
0,413
0,428
0,362
0,38
Minimum
-0,239
-0,375
-0,354
-0,55
Tab. 2. 3ĜHKOHGY\SRþWHQêFK]U\FKOHQt
=È9ċ5
V WpWRSUiFLE\O\SUH]HQWRYiQ\]SĤVRE\PRGHORYiQtG\QDPLFNpKR]DWtåHQt]SĤVREHQpV\QFKURQL]RYDQêPEČKHP
dvojice osob s IUHNYHQFt EČKX f p 2,72 Hz NWHUp E\O\ QiVOHGQČ SRURYQiQ\ V YêVOHGN\ SURYHGHQpKR
experimentu -HGQi VH R PRGHO KDUPRQLFN\ SURPČQQp VtO\ XPtVWČQp GR VWĜHGX UR]SČWt SUR ]tVNiQt QHMYČWãt
HQHUJLH SUR Y\EX]HQt SUYQtKR YODVWQtKR WYDUX GiOH SRXåLWt ELRG\QDPLFNpKR PRGHOX SDVLYQtKR FKRGFH
s KDUPRQLFNêP ]DWtåHQtP XPtVWČQêP Y NRQWDNWQtP ERGČ V NRQVWUXNFt 3RVOHGQtP PRGHOHP MH SRWRP VtOD
NRQVWDQWQt YHOLNRVWL ]YČWãHQi R G\QDPLFNê SĜtUĤVWHN NWHUi VH SR NRQVWUXNFL SRK\EXMH NRQVWDQWQt U\FKORVWt D
v koQWDNWQtPERGČSĤVREtSRGREX t W NWHUi]iYLVtQDU\FKORVWLSRK\EX
32'ċ.29È1Ë
TDWRSUiFHY]QLNOD]DSRGSRU\JUantu (SGS 12/117/OHK1/2T/11). 3RGSRURYDQêPý987Y3UD]H
LITERATURA
[1]
[2]
[3]
[4]
[5]
äLYDQRYLþ 6 ± 3DYLþ $ ± Reynolds, P..: Vibration serviceability of footbridges under human-induced
excitation. Journal of Sound and Vibration, 2005. Vol. 279. No. 1-2, pp. 1-74
Bachmann, H. ± Amman, W.: Vibrations in structures induced by man and machines. Structural
engineering documents. International Association for bridge and structural egineering (IABSE)
âiQD9± 3ROiN0 Modal analysis and forced vibrations of footbridge due to running pedestrians. NMM
2013
)DQIXORYi(([SHULPHntal analysis of dynamic response of footbridges. Bachelor thesis. (2013)
Archbold, P., Keogh, J., Caprani, C., Fanning, P. (2011): A Parametric Study of Pedestrian Vertical Force
Models for Dynamic Analysis of Footbridges. Experimental Vibration Analysis for Civil Engineering
Structures.
~ 208 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
BADANIA MODELOWE WPŁYWU TECHNOLOGII
KATALITYCZNO-FIZYCZNEJ NA PARAMETRY
ODKSZTAŁCENIOWE GRUNTU SPOISTEGO
J. Sękowski1 and A. Siódmok2
Abstract
Cohesive soils, especially plastic ones, are often seen as useless in designed projects. Yet in many cases, it is
recommended to remove or replace them. However an alternative to the exchange of a weak soil is enhancing its
stability. The traditional stabilization process involves adding various materials to the soil (e.g. cement, lime,
resin, ashes, bitumen etc.) mixing them with the soil followed by compaction and maintenance.
The stabilization process with catalytic-physical technique is an interesting option, which improves physical soil
properties by adding chemical components. However, it is not in wide use in many countries, including Poland.
One of the reasons for this is due to the lack of a sufficiently extensive research base confirming the effectiveness
of this method.
In this paper, the authors present the results of model tests – made to analyze the impact of stabilization process
on treated soil deformation parameters.
Key Words
Stabilization process; physical-catalytic technology; cohesive soil; deformations parameters
1
WSTĘP
Stabilizacja gruntów spoistych jest od dawna przedmiotem zainteresowania geoinżynierii. Tradycyjne
rozwiązania wykorzystujące np. wapno, czy cement, częstokroć zastępowane są przez nowoczesne, mało
rozpoznane technologie. W tym artykule przedstawiono technikę katalityczno-fizyczną i jej wpływ na parametry
odkształceniowe gliny w świetle przeprowadzonych badań modelowych. Autorzy uważają bowiem, że tylko
badania terenowe oraz te wykonane na wielkogabarytowych modelach pozwolą najpełniej określić efektywność
technologii katalityczno-fizycznej w zakresie stabilizacji gruntów spoistych.
2
TECHNOLOGIA KATALITYCZNO-FIZYCZNA
Technologia katalityczno-fizyczna działa dwuetapowo. Przyczynia się do zwiększenia sił oddziaływania między
cząsteczkami drobnoziarnistych frakcji i nadaje całej strukturze cechy hydrofobowe. Znajduje zastosowanie
w gruntach o możliwie najbardziej zbilansowanej zawartości poszczególnych frakcji. Bardzo istotna jest
odpowiednia zawartość tych najdrobniejszych (frakcja pyłowa i iłowa), które odznaczają się wysoką
aktywnością fizyko-chemiczną, ze względu na znaczną powierzchnię właściwą. Są one bardzo wrażliwe na
działanie wody, co skutkuje pogorszeniem parametrów wytrzymałościowych i odkształceniowych. Technologia
1
Associate Prof., DSc., PhD, CEng J. Sękowski, Akademicka 5, 44-100 Gliwice, POLAND, +48-32-237-2873,
jerzy.sekowski@polsl.pl.
2
MSc.
A.
Siódmok,
Akademicka
5,
44-100
Gliwice,
POLAND,
+48-32-237-2873,
aleksandra.siodmok@polsl.pl.
~ 209 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
katalityczno-fizyczna powoduje modyfikację potencjałów elektrokinetycznych na granicy fazy stałej i ciekłej
drobnych, silnie reaktywnych cząsteczek. Wpływa na siłę przyciągania między nimi, ograniczając jednocześnie
ilość wody związanej. Ten proces utrwalany jest przez hydrofobizację strukturalną, utrudniającą ponowną
penetrację wody.
Znane są w Polsce i na świecie realizacje wzmocnienia konstrukcji drogowych, nasypów kolejowych, placów
składowych, parkingów i wiele innych [1]. Budownictwo drogowe stanowi kluczowy obszar wykorzystania
technologii katalityczno-fizycznej. Wśród licznych przykładów można wymienić wzmocnienie drogi leśnej
w powiecie rzeszowskim opisane szerzej w [4], a także zastosowanie technologii do budowy drogi gruntowej
w Chwaliszowie [3].
3
METODOLOGIA I WYNIKI BADAŃ MODELOWYCH
3.1 Opis stanowiska badawczego, użytych materiałów i przebiegu badań
Badania prowadzone były na dwuwarstwowym modelu podłoża, wykonanym w obudowie w formie skrzyni
o długości 250 cm i przekroju poprzecznym 62,5 cm x 62,5 cm. W skrzyni wydzielono dwie równe komory,
z których jedna przeznaczona była do badania podłoża z warstwą gruntu niemodyfikowanego, a druga z warstwą
gruntu poddanego wzmocnieniu przy użyciu technologii katalityczno-fizycznej.
Model został wykonany z piasku średniego i gliny pylastej saclSi. Krzywą uziarnienia tej ostatniej pokazano na
rys. 1. Piaskową podsypkę o miąższości 43 cm ułożono i zagęszczono w trzech warstwach w całej skrzyni.
Zagęszczanie przeprowadzone było za pomocą ubijaka o masie 4,88 kg opuszczanego z wysokości 0,8 m
(miejsce obok miejsca). W każdej z komór na jedną warstwę przypadało 80 zrzutów ubijaka.
zawartość cząstek o średnicy
mniejszej niż d [%]
saclSi
100
90
80
70
60
50
40
30
20
10
0
0,001
Sa
Si
0,01
0,1
średnica zastępcza [mm]
1
10
Cl
Fig. 1. The particle size distribution of tested saclSi
W pierwszej z komór, na tak przygotowanym podłożu, została wykonana z gliny pylastej (saclSi) wierzchnia
warstwa modelu o grubości 12,5 cm. Grunt przed zagęszczeniem został doprowadzony do wilgotności 12,2%, co
odpowiada jego wilgotności optymalnej, umożliwiającej maksymalne zagęszczenie. W drugiej komorze na
piaskowej podsypce ułożono glinę pylastą (saclSi) poddaną wcześniej stabilizacji (modyfikacji) metodą
katalityczno-fizyczną. Na rys. 2a przedstawiono skrzynię z opisanymi modelami badawczymi.
Proces modyfikacji gruntu tą techniką przeprowadza się przy wilgotności optymalnej gruntu stabilizowanego tj.
wspomnianej powyżej gliny. W pierwszej kolejności dozowany jest płynny komponent systemu. Zastosowano
0,4 ml koncentratu (rozcieńczanego z wodą w stosunku 1:20) na 1 kg gruntu. Po godzinnym leżakowaniu,
materiał zmieszano z proszkiem hydrofobizującym strukturę gruntu w ilości 30 g na 1 kg gliny.
~ 210 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
a
October 2013, Bratislava
b
Fig. 2. a) The double chamber box with the model of the substrate, b) the test apparatus
Na Stanowisko badawcze składały się trzy zasadnicze elementy: modele podłoża wykonane w dwukomorowej
skrzyni (opisane powyżej), zespół elementów przekazujących obciążenie na grunt (płyta VSS) oraz trzy
elektroniczne czujniki pomiarowe o dokładności odczytu 0,01 mm, rozmieszczone po obwodzie płyty (rys. 2).
Aparatura badawcza typu VSS składała się natomiast ze stalowej płyty o średnicy 16 cm, stalowych elementów
przekazujących osiowe obciążenie na płytę oraz hydraulicznego siłownika z manometrem (rys. 2b ).
Badanie przeprowadzane było zgodnie z [2]. Według wspomnianej normy powierzchnia 200 cm2 jest stosowana
do badania nośności podłoża i warstw podbudowy. Przyjęty został zakres obciążeń do 0,25 MPa (jak dla
podłoża) przy jednostkowym obciążeniu co 0,05 MPa.
Pomiary przemieszczeń pionowych płyty wykonywane były bezpośrednio po przygotowaniu modelu podłoża,
a następnie po 5, 50, 70 i 100 dniach. Model podłoża przez cały czas trwania badań znajdował się w warunkach
powietrzno-suchych, przy średniej temperaturze powietrza 18,5oC i wilgotności 30%.
3.2 Wyniki i analiza przeprowadzonych oznaczeń
W wyniku przeprowadzonych badań oznaczone zostały moduły odkształcenia E1 i E2 [MPa] dwuwarstwowych
modeli podłoża (mod - z gliną modyfikowaną i nmod – z gliną niestabilizowaną) w podanych okresach
czasowych dla przedziału obciążenia 0÷0,25 MPa (rys. 3).
a
b
ϭ ĚŽϬ͕ϮϱDWĂ
Ϯ ĚŽϬ͕ϮϱDWĂ
ϭϲϬ
ϭϲϬ
ϲϬ
ϲϬ
ͲϰϬ Ϭ
ϱϬ
ϭŶŵŽĚ
ϭϬϬ
ͲϰϬ Ϭ
ϱϬ
ϮŶŵŽĚ
ϭŵŽĚ
ϭϬϬ
ϮŵŽĚ
Fig. 3. The changes of deformation parameters E1 and E2 [MPa] (red line – the treated substrate model, dashed line –
untreated substrate model)
~ 211 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Jak wynika z rys.3a wartości modułu odkształcenia pierwotnego E1 [MPa] dla obu modeli w kolejnych okresach
pomiarowach osiągają zbliżone wartości (od 3 do 35 MPa). Tym samym nie zaobserwowano, dla tak
przygotowanych modeli, oczekiwanej poprawy parametru E1. Natomiast w przypadku wtórnego cyklu
obciążania, wartości modułów odkształcenia E2 w badanych modelach są różne. Wzmocnione podłoże ma
dwukrotnie wyższą wartość modułu E2 (40 MPa) niż glina niezmodyfikowana (20 MPa). Różnica między
kolejnymi wynikami maleje z czasem, co świadczy o wysokiej efektywności technologii już w pierwszym
okresie jej funkcjonowania.
Zaobserwowana została natomiast zmiana charakteru odkształceń pionowych w trakcie przykładania kolejnych
kroków obciążenia. Grunt niemodyfikowany pod wpływem obciążenia osiadał w sposób nagły, natomiast glina
modyfikowana zachowywała się bardziej plastycznie.
4
PODSUMOWANIE
Do stabilizacji gruntów spoistych, obok tradycyjnych rozwiązań, stosuje się także nowoczesne technologie.
Zdaniem autorów efektywność innowacyjnych metod wzmacniania podłoża najlepiej sprawdzać w terenie i na
podstawie badań modelowych. Przykład stanowią prowadzone przez doktorantkę prace monitorowania
parametrów odkształceniowych na drodze leśnej w powiecie rzeszowskim (realizacja w 2012 r.) oraz
przeprowadzone badania modelowe opisane w powyższym referacie. Wyniki tych badań potwierdzają
efektywność wzmocnienia gruntów spoistych, lecz w zakresie mniejszym od spodziewanego. Kontynuacja
badań wydaje się być konieczna w celu zweryfikowania wyników dotychczas przeprowadzonych analiz.
Planowane jest dalsze monitorowanie zmian parametrów odkształceniowych na drodze leśnej w Gminie Czudec
(powiat rzeszowski) oraz przeprowadzenie uzupełniających (do dotychczas wykonanych) badań laboratoryjnych.
ACKNOWLEDGEMENT
Autorka jest stypendystką w ramach projektu „DoktoRIS – Program stypendialny na rzecz innowacyjnego
Śląska” współfinansowanego przez Unię Europejską w ramach Europejskiego Funduszu Społecznego͘
REFERENCES
[1]
[2]
[3]
[4]
Asia – Europe Commerce LTD.: Case Studies. Brochures.
BN-64/8931-02: Drogi samochodowe. Oznaczanie modułu odkształcenia nawierzchni podatnych i podłoża
przez obciążenie płytą.
Duszyński, A.: Badanie sprawdzająco-aprobacyjne Consolid System dla zastosowania w budownictwie
drogowym. IBDiM-TW 50803/W-1214.
Siódmok, A.: Ulepszenie w technologii katalityczno-fizycznej drogi leśnej w gminie Czudec. ….
~ 212 ~
WK
3URFHHGLQJVRIWKH ,QWHUQDWLRQDO&RQIHUHQFHRQ
1HZ7UHQGVLQ6WDWLFVDQG'\QDPLFVRI%XLOGLQJV
2FWREHU%UDWLVODYD6ORYDNLD
)DFXOW\RI&LYLO(QJLQHHULQJ678%UDWLVODYD
6ORYDN6RFLHW\RI0HFKDQLFV6$6
1(:&20387$7,21$/0(7+2'2/2*<
)25&$/&8/$7,216:,7+,17(59$/180%(56
-6NU]\SF]\N
$EVWUDFW
7KH DLP RI WKH SDSHU LV WR SUHVHQW D QHZ DOJHEUDLF V\VWHP RI LQWHUYDO QXPEHUV DQG ZLWK VSHFLILFDOO\ GHILQHG
DGGLWLRQDQGPXOWLSOLFDWLRQRSHUDWLRQV7KHQHZQXPEHUVFDOOHGLQWHUYDOSHUWXUEDWLRQQXPEHUVDUHLQWURGXFHG
,W¶VSURYHGWKDWWKHQHZDOJHEUDLFV\VWHP,5HLVWKHH[WHQVLRQRIWKHV\VWHPRIUHDOQXPEHUV56RPHDGGLWLRQDO
SURSHUWLHVDVVXEWUDFWLRQLQYHUVLRQDQGGLYLVLRQDUHSUHVHQWHGWRR6RPHHOHPHQWDU\IRUPXODWLRQVIRULQWHUYDO
IXQFWLRQ H[WHQVLRQV DUH LQWURGXFHG DV ZHOO DV VRPH VROXWLRQ SURSHUWLHV RI OLQHDULQWHUYDO HTXDWLRQV&ODVVLFDO
LQWHUYDOSHUWXUEDWLRQSUREOHPVFDQEHVROYHGLQWKHQHZDOJHEUDLFV\VWHPDVHDV\DVXVXDOSUREOHPVRIDSSOLHG
PDWKHPDWLFVWKHRUHWLFDOSK\VLFVDQGWHFKQLTXHV$GGLWLRQDODQDO\WLFDOWUDQVIRUPDWLRQVDUHQRWUHTXLUHG
.H\:RUGV
,QWHUYDOVSHUWXUEDWLRQQXPEHUVLQWHUYDOHTXDWLRQVLQWHUYDOIXQFWLRQV
,1752'8&7,21
7KHRU\RISHUWXUEDWLRQVLVDSDUWRIVFLHQFHRIWKHJUHDWWKHRUHWLFDODQGSUDFWLFDOPHDQLQJ)ROORZLQJSDSHUV>@
WKHQHZXQLTXHDOJHEUDLFV\VWHPRYHULQWHUYDOVLVSUHVHQWHG&DOFXODWLRQVZLWKXVHRIQHZSHUWXUEDWLRQQXPEHUV
OHDG WR DSSOLFDWLRQV ZKLFKDUH PDWKHPDWLFDOO\ HTXLYDOHQW ZLWK ,RUGHU DSSUR[LPDWLRQV LQ FODVVLFDO SHUWXUEDWLRQ
PHWKRGV$GYDQWDJHVRIWKHQHZDOJHEUDLFV\VWHPDUHDVIROORZVZHFDQRPLWDOOFRPSOH[DQDO\WLFDOFDOFXODWLRQV
ZKLFKDUHW\SLFDOIRUH[SDQGLQJDSSUR[LPDWHGYDOXHVRIVROXWLRQVLQLQILQLWHVHULHVZHJHWDJUHDWVLPSOLILFDWLRQ
RIDOODULWKPHWLFFDOFXODWLRQVZKLFKDSSHDULQDQDO\WLFDOIRUPXODWLRQDQGDQDO\VLVRIWKHSUREOHPPRVWRINQRZQ
QXPHULFDO DOJRULWKPV FDQ EH VLPSO\ DGDSWHG IRU WKH QHZ LQWHUYDO DOJHEUDLF V\VWHP ZLWKRXW DQ\ VHULRXV
GLIILFXOWLHV:LWKWKHQHZDOJHEUDLFV\VWHPZHJHWDVHWRIYHU\VLPSOHDQGXVHIXOPDWKHPDWLFDOWRROVZKLFKFDQ
EHHDV\XVHGLQDQDO\WLFDODQGFRPSXWDWLRQDODQDO\VLVRIFRPSOH[DSSOLFDWLRQSUREOHPV([DPSOHVRIDSSOLFDWLRQV
IRU SHUWXUEDWLRQ IRUPXODWLRQ LQ WZR FODVVLFDO SUREOHPV RI FRPSXWDWLRQDO PHFKDQLFV DUH SUHVHQWHG ZLWKLQ D QHZ
DSSURDFKWR)X]]\%RXQGDU\(OHPHQW0HWKRG>@7KHIXOOOHQJWKSDSHUZLOOEHLQFOXGHGLQWRFRQIHUHQFH&'
,17(59$/3(5785%$7,21180%(56
8VXDOO\WKHFODVVLFDOLQWHUYDOQXPEHULVDQRUGHUHGFRXSOHRIUHDOVDDVXFKWKDWD D$QLQWHUYDOQXPEHU
FDQEHSUHVHQWHGLQWKHIRUP>DD@RUHTXLYDOHQW D >DD@ZKHUHUHDOQXPEHUVDDDUHFDOOHGHQGVOHIWDQG
ULJKWRIWKHLQWHUYDO
:LWKXVHRIPLGGOHRIWKHLQWHUYDOQDPHG D D DD
3URI GU KDE HQJ - 6NU]\SF]\N $NDGHPLFND *OLZLFH 3RODQG WHOHSKRQH PRELOHPDLOMHU]\VNU]\SF]\N#SROVOSO
~ 213 ~
WK
,QWHUQDWLRQDO&RQIHUHQFHRQ1HZ7UHQGVLQ6WDWLFVDQG'\QDPLFVRI%XLOGLQJV
2FWREHU%UDWLVODYD
DQGWKHLUUDGLXV
UDG D DD
ZHFDQQRWHWKHLQWHUYDOQXPEHULQWKHHTXLYDOHQWIRUP
D > D UDG D D UDG D @
7KH LQWHUYDO QXPEHU D FDQ EH LQ IDFW WKH RUGHUHG FRXSOH RI UHDOV D 'DU ZKHUH IRU VLPSOLFLW\ ZH QRWH
'D UDG D DQG ' >'D'D@FI>@
,QGHSHQGHQWLQWHUYDOSHUWXUEDWLRQQXPEHUV
$VVXPHWKDWWKHLQWHUYDOUDGLXVRI D LVDSHUWXUEDWLRQQXPEHULH
UDG D 'D HGDGD! 'D5H
7KHQZHFDQV\PEROLFDOO\QRWLFHWKDW
D > D 'D D 'D@ D 'DU > D HGD D HGD@ D H>GDGD@ D HG D D GD>HH@
,IZHGHILQHV\PEROLFLQWHUYDOSHUWXUEDWLRQQXPEHU H >HH@WKHQZHFDQZULWH
D D HG D D GD H 7KHVHWRILQWHUYDOSHUWXUEDWLRQQXPEHUVZLOOEHGHQRWHGDV,5H
$OJHEUDLFRSHUDWLRQVRYHULQGHSHQGHQWLQWHUYDOV
/HW IXUWKHU D D GD H E E GE H GHQRWH WZR LQGHSHQGHQW LQWHUYDOV 1RWLFH WKDW DOJHEUDLF RSHUDWLRQV IRU
LQGHSHQGHQWLQWHUYDOQXPEHUVDUHGHILQHGDVIROORZV
D E KXOO^D ED D EE `
ZKHUH ´´1RWLFHWKDWÄKXOO´ $GGLWLRQ
D E D E GDGE H 6XEWUDFWLRQ
D E D E GDGE H D E D E D GE E GD H 0XOWLSOLFDWLRQ
D
E
'LYLVLRQ
§
D ¨ GD
E ¨¨ E
©
D GE ·¸
H
E ¸¸
¹
7DE$OJHEUDLFRSHUDWLRQVRYHULQGHSHQGHQWLQWHUYDOV
'HSHQGHQWLQWHUYDOSHUWXUEDWLRQQXPEHUV
$OJHEUDLFRSHUDWLRQVRYHUGHSHQGHQWLQWHUYDOV
/HW IXUWKHU D D GD H E E GE H GHQRWH WZR GHSHQGHQW LQWHUYDOV 1RWLFH WKDW DOJHEUDLF RSHUDWLRQV IRU
LQGHSHQGHQWLQWHUYDOQXPEHUVDUHGHILQHGDVIROORZV
D E ^D ED D HGDE E HGEH H `
ZKHUH ´´
$GGLWLRQ
D E D E GDGE H 6XEWUDFWLRQ
D E D E GDGE H 0XOWLSOLFDWLRQ
D E D E D GE E GD H GD
D H ,QYHUVH
D D
D D § GD DGE ·
¨ ¸H 'LYLVLRQ
E E ©E
E ¹
7DE$OJHEUDLFRSHUDWLRQVRYHUGHSHQGHQWLQWHUYDOV
~ 214 ~
WK
,QWHUQDWLRQDO&RQIHUHQFHRQ1HZ7UHQGVLQ6WDWLFVDQG'\QDPLFVRI%XLOGLQJV
2FWREHU%UDWLVODYD
,QMHFWLRQRIV\VWHPV5DQG5HLQWR,5H
1RWLFHWKDWWKHGHILQHGDERYHILHOG,5HGRHVQ¶WFRQWDLQWKHILHOGRIUHDOQXPEHUV5DQGLQDQDQDORJRXVZD\WKH
ILHOGRISHUWXUEDWLRQQXPEHUV5H:HFDQSURYHWKDWUHDOQXPEHUVFDQEHWUHDWHGDVVRPHHOHPHQWVRIWKHILHOG
,5HZLWKWKHVDPHDOJHEUDLFRSHUDWLRQVDQGQHXWUDOHOHPHQWVRIDGGLWLRQDQGPXOWLSOLFDWLRQ
'(),1,7,21 7KH PDS M5,5H5o,5H ZH FDOO WKH LQMHFWLRQ RI DOJHEUDLF V\VWHP RI UHDO QXPEHUV 5 LQWR WKH
DOJHEUDLF V\VWHP RI ,5H LI M5,5H LV WKH IXQFWLRQ DQG NHHSV FRUUHVSRQGLQJ RSHUDWLRQV DQGQHXWUDO HOHPHQWV RI
DGGLWLRQDQGPXOWLSOLFDWLRQ
$VVXPHWKDWM5,5H[ [HUIRUDQ\[57KHIXQFWLRQM5,5HLVWKHLQMHFWLRQRIWKHILHOGRIUHDOQXPEHUVLQWR
WKHILHOGRISHUWXUEDWLRQLQWHUYDOQXPEHUV,5H5HDOO\LW¶VHDV\WRQRWLFHWKDWZHKDYHWKHSURSHUW\LI[z\[\5
WKHQZHKDYHWKDW[HUz\HUDQGLQFRQVHTXHQFHM5,5H[zM5,5H\
)LQDOO\ZHFDQQRWLFHWKDWWKHLQMHFWLRQM5,5HRIWKHV\VWHP5LQWRWKHV\VWHP,5HGHILQHVWKHLVRPRUSKLVPRI
WKHV\VWHP5RQWRVRPHVXEV\VWHPFRQWDLQHGLQWKHV\VWHP,5H*HQHUDOO\ZHKDYHWKHLQMHFWLRQRIWKHDOJHEUDLF
V\VWHP RI UHDO QXPEHUV 5x LQWR WKH V\VWHP RI SHUWXUEDWLRQ LQWHUYDO QXPEHUV ,5Hx VR ZH KDYH
DJHQHUDOLVDWLRQRIFODVVLFDODOJHEUDLFV\VWHPEDVHGRQUHDOQXPEHUV
,Q DQ DQDORJRXV ZD\ ZH FDQ VD\ WKDW MXVW GHILQHG ILHOG ,5H GRHVQ¶W FRQWDLQ DOVR WKH ILHOG RI UHDO SHUWXUEDWLRQ
QXPEHUV5HGHILQHGHDUOLHU>@:HFDQVKRZWKDWUHDOSHUWXUEDWLRQQXPEHUVFDQEHWUHDWHGDVVRPHHOHPHQWV
RIWKHILHOG,5HZLWKWKHVDPHDOJHEUDLFRSHUDWLRQVDQGQHXWUDOHOHPHQWVRIDGGLWLRQDQGPXOWLSOLFDWLRQ
6LPLODUO\ZHFDQSURYHWKDWWKHPDSM5,5H5Ho,5HLVWKHLQMHFWLRQRIWKHDOJHEUDLFV\VWHPRIHUHDOQXPEHUV5H
LQWRWKHDOJHEUDLFV\VWHP,5H
,17(59$/3(5785%$7,21)81&7,216
/HWWKHIXQFWLRQI\\5KDVDQH[SDQVLRQLQWRWKH7D\ORUµVVHULHVLQWKHSRLQW[ZKLFKFDQEHGHVFULEHGLQWKH
IRUP
I \
I [ cc
ccc
I c [ \ [ I [ \ [ I [ \ [ f
I [ ¦
N GN I
G[ N
N
[ \ [ N
[ \  5 )URPHTIROORZVWKDWLWVH[SDQVLRQ IH RQHLQWHUYDOVPD\EHGHILQHGDV
cc
ccc
I c [ IH [ G[H I [ G[H I [ G[H I [ G[H I [ G[I c [ H [ G[  5
(T FDQ EH XVHG LQ IXUWKHU FRQVLGHUDWLRQV WR FDOFXODWLRQV RI SHUWXUEDWLRQ YDOXHV RI IXQFWLRQV ZLWK LQWHUYDO
SHUWXUEDWLRQDUJXPHQWV
([DPSOHV
)XQFWLRQVLQXV
VLQH D ^VLQDD D ` ^VLQD HGD GD  D ` ^VLQD HGD FRVD GD  D ` VLQD H FRVD > GD GD@ VLQD H FRVD GD VLQD GD FRVD GH )XQFWLRQPRGXOH
7KHIXQFWLRQPRGXOHLVQRGLIIHUHQWLDEOHVRZHKDYHQRSRVVLELOLW\WRXVHWKHHT:HXVHWKHGHILQLWLRQRI
WKHLQWHUYDOIXQFWLRQ:HREWDLQ
~ 215 ~
WK
,QWHUQDWLRQDO&RQIHUHQFHRQ1HZ7UHQGVLQ6WDWLFVDQG'\QDPLFVRI%XLOGLQJV
2FWREHU%UDWLVODYD
_ D _ ^_D_D D ` >PLQ_D__D_PD[_D__D_@ >_ D _HGD_ D _HGD@ _ D _H>GDGD@ _ D _H GD _ D _GD>HH@ _ D _GD H &DQWLOHYHUEHDP
:HFDOFXODWHWKHGLVSODFHPHQWRIWKHHQGRIWKHFDQWLOHYHUEHDPRIOHQJWKOVWLIIQHVV(-ORDGHGDWWKHHQGZLWK
WKHIRUFH3$VVXPHWKDWDOOYDOXHVDUHRILQWHUYDOXQFHUWDLQW\7KHGLVSODFHPHQWRIWKHHQGRIWKHEHDPHTXDOV
G
3O (-
$VVXPHWKDWXQFHUWDLQW\RIDOOYDOXHVHTXDO RIWKHQRPLQDOYDOXHLH3 H 1O H P( H 1
P
- H P:HREWDLQ
3O H H (- H H § ˜ ·
H¨
˜
H
P
¸
¹
© G
5()(5(1&(6
>@ 1HXPDLHU$,QWHUYDO0HWKRGVIRU6\VWHPVRI(TXDWLRQV&DPEULGJH8QLYHUVLW\3UHVV3RUW&KHVWHU1HZ
<RUN0HOERXUQH6\GQH\
>@ 6NU]\SF]\N-3HUWXUEDWLRQPHWKRGV,$OJHEUD)XQFWLRQV/LQHDU(TXDWLRQV(LJHQYDOXH3UREOHPV1HZ
$OJHEUDLF 0HWKRGRORJ\ 3URF RI ,QWHUQDWLRQDO &RQIHUHQFH 1(: 75(1'6 ,1 67$7,&6 $1'
'<1$0,&6 2) %8,/',1*6 2FWREHU )DFXOW\ RI &LYLO (QJLQHHULQJ 687 %UDWLVODYD 6ORYDNLD
%UDWLVODYD
>@ 6NU]\SF]\N - 3HUWXUEDWLRQ 0HWKRGV 1HZ $OJHEUDLF 0HWKRGRORJ\ 3URF RI &00 ± &RPSXWHU
0HWKRGVLQ0HFKDQLFV-XQH&]ĊVWRFKRZD3RODQG&]ĊVWRFKRZD
>@ 6NU]\SF]\N - 3HUWXUEDWLRQ 0HWKRGV )RU 6\VWHPV :LWK ,QWHUYDO 3DUDPHWHUV 3URF RI ,QWHUQDWLRQDO
&RQIHUHQFH 1(: 75(1'6 ,1 67$7,&6 $1' '<1$0,&6 2) %8,/',1*6 2FWREHU )DFXOW\RI&LYLO(QJLQHHULQJ687%UDWLVODYD6ORYDNLD%UDWLVODYD
>@ 6NU]\SF]\N - 1RQVWDQGDUG 3HUWXUEDWLRQ 0HWKRGV ,QILQLWHVLPDO 0HWKRGRORJ\ 3URF RI ,QWHUQDWLRQDO
&RQIHUHQFH 1(: 75(1'6 ,1 67$7,&6 $1' '<1$0,&6 2) %8,/',1*6 2FWREHU )DFXOW\RI&LYLO(QJLQHHULQJ687%UDWLVODYD6ORYDNLD%UDWLVODYD
>@ 6NU]\SF]\N - 0XOWL ± 6FDOH +\SHU3HUWXUEDWLRQ 1XPEHUV ,Q 0HFKDQLFV 3URF RI ,QWHUQDWLRQDO
&RQIHUHQFH 1(: 75(1'6 ,1 67$7,&6 $1' '<1$0,&6 2) %8,/',1*6 2FWREHU )DFXOW\RI&LYLO(QJLQHHULQJ687%UDWLVODYD6ORYDNLD%UDWLVODYD
>@ 6NU]\SF]\N - %XUF]\ĔVNL7 7KHRUHWLFDODQG &RPSXWDWLRQDO $VSHFWV RI WKH )X]]\ %RXQGDU\ (OHPHQW
0HWKRGV .OXZHU $FDGHPLF 3XEOLVKHUV ,87$0,$&0,$%(0 6\PSRVLXP RQ $GYDQFHG 0DWKHPDWLFDO
DQG&RPSXWDWLRQDO0HFKDQLFV$VSHFWVRIWKH%RXQGDU\(OHPHQW0HWKRG0D\-XQH&UDFRZ
'RUGUHFKW%RVWRQ/RQGRQ
>@ 6NU]\SF]\N -:LQNOHU $ 3HUWXUEDWLRQ PHWKRGV ,, 'LIIHUHQWLDWLRQ ,QWHJUDWLRQ DQG (OHPHQWV RI
)XQFWLRQDO $QDO\VLV ZLWK $SSOLFDWLRQV WR 3HUWXUEHG :DYH (TXDWLRQ 3URF RI ,QWHUQDWLRQDO &RQIHUHQFH
1(: 75(1'6 ,1 67$7,&6 $1' '<1$0,&6 2) %8,/',1*6 2FWREHU )DFXOW\ RI &LYLO
(QJLQHHULQJ687%UDWLVODYD6ORYDNLD%UDWLVODYD
>@ 6NU]\SF]\N-:LWHN+)X]]\%RXQGDU\(OHPHQW0HWKRGV$1HZ3HUWXUEDWLRQ$SSURDFKIRU6\VWHPV
ZLWK )X]]\ 3DUDPHWHUV 3URF RI ,QWHUQDWLRQDO &RQIHUHQFH 1(: 75(1'6 ,1 67$7,&6 $1'
'<1$0,&6 2) %8,/',1*6 2FWREHU )DFXOW\ RI &LYLO (QJLQHHULQJ 687 %UDWLVODYD 6ORYDNLD
%UDWLVODYD
>@ :LWHN+0HWRGDUR]P\W\FKHOHPHQWyZEU]HJRZ\FKZDQDOL]LHNRQVWUXNFMLEXGRZODQ\FKRSDUDPHWUDFK
QLHSHZQ\FK3K''LVVHUWDWLRQ&LYLO(QJ)DFXOW\6LOHVLDQ8QLYRI7HFKQRORJ\*OLZLFH
~ 216 ~
WK
3URFHHGLQJVRIWKH ,QWHUQDWLRQDO&RQIHUHQFHRQ
1HZ7UHQGVLQ6WDWLFVDQG'\QDPLFVRI%XLOGLQJV
2FWREHU%UDWLVODYD6ORYDNLD
)DFXOW\RI&LYLO(QJLQHHULQJ678%UDWLVODYD
6ORYDN6RFLHW\RI0HFKDQLFV6$6
)(0$1$/<6,62)81&(57$,16<67(06:,7+60$//
,17(59$/3(5785%$7,216
-6NU]\SF]\N$%HOLQD
$EVWUDFW
,Q WKH SDSHU DQ LQWHUYDOSHUWXUEDWLRQRULHQWHG PHWKRGRORJ\ WR PRGHO VWUXFWXUDO DQG ORDGLQJ XQFHUWDLQWLHV
ZLWKLQ DQ ,QWHUYDO )LQLWH (OHPHQW 0HWKRG ,)(0 LV SUHVHQWHG :H GLVFXVV SRWHQWLDO DSSOLFDWLRQV RI LQWHUYDO
SHUWXUEDWLRQ QXPEHUV WKHRU\ WR GHWHUPLQH ERXQGV RI UHVSRQVH TXDQWLWLHV :H IRFXV RXU DWWHQWLRQ RQ
SHUWXUEDWLRQWKHRUHWLFDQGQRQVWRFKDVWLFGHVFULSWLRQRIXQFHUWDLQSKHQRPHQDLQ)(0DQGZLOOUHIHUWRWKHVH
DSSURDFKHVDV,QWHUYDO3HUWXUEDWLRQ)LQLWH(OHPHQW0HWKRG,3)(0$OOVWUXFWXUDODQGORDGSHUWXUEDWLRQVDUH
DVVXPHGWREHLQWHUYDOYDOXHVZLWKLQWHUYDOSHUWXUEDWLRQVDQGWKHVWUXFWXUHLVGLVFUHWL]HGXVLQJ)(07KLV\LHOGV
WKHHOHPHQWVRIWKHVWLIIQHVVPDWUL[DQGWKHFRPSRQHQWVRIWKHIRUFHYHFWRU ZLWKXQFHUWDLQWLHVWREHGHILQHGDV
LQWHUYDOYDOXHV
.H\:RUGV
,QWHUYDO)LQLWH(OHPHQW0HWKRG,)(0SHUWXUEDWLRQQXPEHUVLQWHUYDOHTXDWLRQVLQWHUYDOIXQFWLRQV
,1752'8&7,21
,Q HQJLQHHULQJ SUDFWLFH WKH VWUXFWXUDO DQG OLYH XQFHUWDLQWLHV DUH DOZD\V WDNHQ LQWR DFFRXQW WR DYRLG D ULVN LQ
LQGXVWULDO DQG XUEDQ HQYLURQPHQWV HVVHQWLDO LQ WKH SUHYHQWLRQ RI DFFLGHQWV DQG LQ WKH DQDO\VLV RI SRWHQWLDOO\
KD]DUGRXV VLWXDWLRQV WR SXEOLF KHDOWK DQG VDIHW\ 7KH SUREOHP RI ULVN EURDGO\ GHILQHG DV DQ XQGHVLUDEOH
LPSOLFDWLRQ RI XQFHUWDLQW\ DQG LWV DQDO\VLV FDQ EH FODVVLILHG LQWR WZR GLVWLQFW FDWHJRULHV7KH ILUVW FDWHJRU\ RI
SUREOHPV GHDOV ZLWK XQFHUWDLQWLHV ZKLFK DUH HVVHQWLDOO\ UDQGRP DQG WKHUHIRUH LWV QDWXUH LV SUREDELOLVWLF 7KH
VHFRQGFDWHJRU\LQYROYHVSUREOHPVZKLFKDUHQRWUHDOO\SUREDELOLVWLFEXWFDXVHXQFHUWDLQW\GXHWRLPSUHFLVLRQ
DVVRFLDWHGZLWKKXPDQEDVHGXQFHUWDLQW\LHFRPSOH[LW\RIWKHV\VWHPXQGHULQYHVWLJDWLRQDVZHOODVYDJXHQHVV
RIKXPDQWKRXJKWDQGSHUFHSWLRQSURFHVVHV
7KH SUREDELOLVWLF DSSURDFK KDV GRPLQDWHG PXFK RI WKH ZRUN RQ WKH UHSUHVHQWDWLRQ DQG PDQLSXODWLRQ RI
XQFHUWDLQWLHV RI )(0¶V XVHG IRU WKH GHVFULSWLRQ DQG FULWLFDO YDOXHV FDOFXODWLRQV LQ DQ DQDO\VLV RI XQFHUWDLQ
VWUXFWXUHV+RZHYHULQPDQ\FDVHVLWLVYLUWXDOO\LPSRVVLEOHWRGHWHUPLQHSUHFLVHO\WKHYDOXHRIWKHSUREDELOLW\
RIDJLYHQHYHQW6XFKDVLWXDWLRQPD\EHGXHHLWKHUWRODFNRIHYLGHQFHRUWRWKHLQDELOLW\RIWKHVDIHW\HQJLQHHU
WRPDNHDVLJQLILFDQWDVVHVVPHQWRIWKHIUHTXHQF\RIRFFXUUHQFHRIDQHYHQW,QRWKHUZRUGVWKHSUREDELOLW\RIDQ
HYHQWPD\EHLOOGHILQHGDQGLQVWHDGRIVSHFLI\LQJLWVQXPHULFDOYDOXHRQHZRXOGVLPSO\VD\WKDWDJLYHQHYHQW
LVERXQGHGIURPDERYHDQGEHORZKHQFHLWFDQEHFRQVLGHUHGWREHGHILQHGZLWKLQHQYHORSHERXQGV
0DQ\ GLIIHUHQW LQWHUSUHWDWLRQV DUH SRVVLEOH IRU WHUPLQRORJ\ RI XQFHUWDLQ DVSHFWV RI WKH )(0¶V :H IRFXV RXU
DWWHQWLRQRQLQWHUYDOVHWWKHRUHWLFDQGQRQVWRFKDVWLFGHVFULSWLRQRIXQFHUWDLQSKHQRPHQDLQ)(0DQGZLOOUHIHU
3URI GU KDE HQJ - 6NU]\SF]\N $NDGHPLFND *OLZLFH 3RODQG WHOHSKRQH PRELOHPDLOMHU]\VNU]\SF]\N#SROVOSO
0JU HQJ $ %HOLQD $NDGHPLFND *OLZLFH 3RODQG WHOHSKRQH PRELOH PDLODOHNVDQGUDEHOLQD#SROVOSO
~ 217 ~
WK
,QWHUQDWLRQDO&RQIHUHQFHRQ1HZ7UHQGVLQ6WDWLFVDQG'\QDPLFVRI%XLOGLQJV
2FWREHU%UDWLVODYD
WRWKHVHDSSURDFKHVDV,QWHUYDO)LQLWH(OHPHQW0HWKRG,)(0$OOVWUXFWXUDODQGORDGXQFHUWDLQWLHVDUHDVVXPHG
WREHLQWHUYDOYDOXHVDQGWKHVWUXFWXUHLVGLVFUHWL]HGXVLQJ,QWHUYDO)LQLWH(OHPHQWV7KLV\LHOGVWKHHOHPHQWVRI
WKHVWLIIQHVVPDWUL[DQGWKHFRPSRQHQWVRIWKHIRUFHYHFWRUZLWKXQFHUWDLQWLHVWREHGHILQHGDVLQWHUYDOYDOXHV
$SSOLFDWLRQVRIWKHVSHFLDONLQGRI))(0FDOOHG,QWHUYDO)LQLWH(OHPHQW0HWKRGV,)(0¶VDSSHDUWRKDYHEHHQ
LQLWLDWHGLQWKH7KHHDUOLHVWDSSOLFDWLRQVXVHGWKHLQWHUYDODULWKPHWLFIRUPXODWLRQDQGDOOXQFHUWDLQWLHVDUH
DVVXPHG WR EH GHILQHG LQ ERXQGHG LQWHUYDOV 7KH SURSRVHG WHFKQLTXH OHDGV WR FRPSXWDWLRQ RI LQWHUYDO
FKDUDFWHULVWLFVRIUHVSRQVHTXDQWLWLHV7KHSURFHGXUHFDQEHXVHGWRVROYHDZLGHYDULHW\RILPSRUWDQWVWUXFWXUDO
HQJLQHHULQJ SUREOHPV ZLWK GLIIHUHQW NLQGV RI XQFHUWDLQWLHV LQFOXGLQJ XQFHUWDLQ VKDSH RI VWUXFWXUH¶V ERXQGDU\
,OOXVWUDWLYHH[DPSOHRI'WUXVVLVVWXGLHGWRFRPPHQWKRZWRREWDLQJRRGDSSUR[LPDWLRQVRILQWHUYDOVROXWLRQV
,17(59$/3(5785%$7,21180%(56
8VXDOO\WKHFODVVLFDOLQWHUYDOQXPEHULVDQRUGHUHGFRXSOHRIUHDOVDDVXFKWKDWD D$QLQWHUYDOQXPEHU
FDQEHSUHVHQWHGLQWKHIRUP>DD@RUHTXLYDOHQW D >DD@ZKHUHUHDOQXPEHUVDDDUHFDOOHGHQGVOHIWDQG
ULJKWRIWKHLQWHUYDO:LWKXVHRIPLGGOHRIWKHLQWHUYDOQDPHG D D D D
DQGWKHLUUDGLXV
UDG D DD
ZHFDQQRWHWKHLQWHUYDOQXPEHULQWKHHTXLYDOHQWIRUP
D > D UDG D D UDG D @
7KH LQWHUYDO QXPEHU D FDQ EH LQ IDFW WKH RUGHUHG FRXSOH RI UHDOV D 'DU ZKHUH IRU VLPSOLFLW\ ZH QRWH
'D UDG D DQG ' >'D'D@FI>@
$VVXPHWKDWWKHLQWHUYDOUDGLXVRI D LVDSHUWXUEDWLRQQXPEHULH
UDG D 'D HGDGD! 'D5H
7KHQZHFDQV\PEROLFDOO\QRWLFHWKDW
D > D 'D D 'D@ D 'DU > D HGD D HGD@ D H>GDGD@ D HG D D GD>HH@
,IZHGHILQHV\PEROLFLQWHUYDOSHUWXUEDWLRQQXPEHU H >HH@WKHQZHFDQZULWH
D D HG D D GD H 7KHVHWRILQWHUYDOSHUWXUEDWLRQQXPEHUVZLOOEHGHQRWHGDV,5H
$OJHEUDLFRSHUDWLRQVRYHUGHSHQGHQWDQGLQGHSHQGHQWLQWHUYDOVDUHGHVFULEHGLQGHWDLOVLQ>@
),1,7((/(0(176:,7+,17(59$/3$5$0(7(56
$GLVFUHWHPRGHORIDOLQHDUILQLWHHOHPHQWZLWKXQFHUWDLQSDUDPHWHUVLVUHSUHVHQWHGE\WKHVWLIIQHVVPDWUL[ZLWK
HOHPHQWVZKLFKDUHLQWHUYDOQXPEHUV5HVSHFWLYHO\DGLVFUHWHPRGHORIDQXQFHUWDLQILHOGRIORDGVLVWKHYHFWRU
ZLWK LQWHUYDO YDOXHV 'LVFUHWL]DWLRQ RI D FRQWLQXXP LQ XQFHUWDLQW\ FRQGLWLRQV XVLQJ WKH WHFKQLTXH EDVHG RQ
ILQLWHHOHPHQWPHWKRGZLOOEHSUHVHQWHGRQWKHH[DPSOHRIDOLQHDUEDUHOHPHQW$VVXPHWKHFURVVVHFWLRQDUHDRI
WKH HOHPHQW LV GHQRWHG $ <RXQJ
V PRGXOXV RI WKH PDWHULDO ( $ERXW SDUDPHWHUV ZH DVVXPH WKDW WKH\ DUH
LQWHUYDOYDOXHVSK\VLFDOXQFHUWDLQWLHV6LPLODUO\ZHFDQDVVXPHWKDWERXQGDU\FRQGLWLRQVDVZHOODVWKHOHQJWK
RI WKH HOHPHQW PRGHO XQFHUWDLQW\ DUH LQWHUYDO YDOXHV 7KH\ ZLOO EH GHQRWHG LQ DJUHHPHQW ZLWK WKH QRWLRQ
LQWURGXFHGIRULQWHUYDOYDOXHVFI)LJ
$ ILHOG RI HOHPHQW GLVSODFHPHQWV ZKLFK LV WKH IX]]\ YHFWRU 8 H [ ZLOO EH DSSUR[LPDWHG E\ D OLQHDU
FRPELQDWLRQ RI WKH LQWHUYDO QRGH GLVSODFHPHQWV 8 H PXOWLSOLHG E\ LQGHSHQGHQW OLQHDU LQWHUYDO LQWHUSRODWLRQ
IXQFWLRQVGHQRWHGDV 1 [ ZKLFKDUHVLPSO\LQWHUYDOSRO\QRPLDOV)ROORZLQJZHKDYH
8H [ 8H
7
1 [ 8 H >X X @ ZKHUH
ª [ [º
« O O » ¬
¼
,Q DQ DQDORJRXV ZD\ DV LQ WKH FODVVLFDO ILQLWH HOHPHQW PHWKRG FI 5HI ZH FDQ REWDLQ YDOXHV RI WKH ORFDO
VWLIIQHVVPDWUL[ZKLFKDUHQRZLQWHUYDOQXPEHUV
$ ( ª º
.H
«
» O ¬ ¼
1 [
~ 218 ~
WK
,QWHUQDWLRQDO&RQIHUHQFHRQ1HZ7UHQGVLQ6WDWLFVDQG'\QDPLFVRI%XLOGLQJV
2FWREHU%UDWLVODYD
X H
XH
I H [H
IH ( $ O
)LJ,QWHUYDOEDUHOHPHQW
6LPLODUO\ZHGHWHUPLQHWKHYHFWRURIHOHPHQWIRUFHV0RUHFRPSOLFDWHGHOHPHQWVFDQEHFRQVLGHUHGVLPLODUO\LH
GHWDLOVRIDQDO\VLVIRUEHDPHOHPHQWVFDQEHIRXQGLQ5HIV
0(7+2'2/2*<2),17(59$/$/*(%5$,&23(5$7,216
$IWHU REWDLQLQJ WKH JOREDO LQWHUYDO VWLIIQHVV PDWUL[ DQG WKH JOREDO LQWHUYDO IRUFH YHFWRU WKH OLQHDU LQWHUYDO
DOJHEUDLFV\VWHPRIHTXDWLRQVEHFRPH
. ; ) ZKHUH . LVWKH Q u Q GLPHQVLRQDOSRVLWLYHO\GHILQLWHLQWHUYDOJOREDOVWLIIQHVVPDWUL[ZKLFKUHSUHVHQWVWKH
VWUXFWXUHZLWKXQFHUWDLQWLHV
; LVWKH Q u GLPHQVLRQDOLQWHUYDOYHFWRURIGLVSODFHPHQWV
) LVWKH Q u GLPHQVLRQDOLQWHUYDOYHFWRURIORDGV
75866:,7+81&(57$,13$5$0(7(56$1'/2$'6
7R LOOXVWUDWH FDOFXODWLRQ PHWKRGV WKH VSDFH WUXVV DV VKRZQ LQ )LJ ZDV DQDO\VHG 7KH WUXVV KDV EDUV QRGHV DQG VXSSRUWV 2QO\ RQH FRQFHQWUDWHG IRUFH DFWLQJ YHUWLFDOO\ RQ WKH QRGH VW ZDV FRQVLGHUHG 7UXVV
SDUDPHWHUV DUH DV IROORZV ( *3D $ (P DQG YHUWLFDO IRUFH '' N1
DFWLQJRQWKHVWQRGH
,WIROORZVWKDWGLVSODFHPHQWVVWUHVVHVEHQGLQJPRPHQWVDQGVKHDUIRUFHVZLOOEHLQWHUYDOYDOXHVWRR5HVXOWVDUH
SUHVHQWHG LQ )LJV ,Q WKH FRQVLGHUHG H[DPSOH IX]]LQHVV LV ORFDWHG LQWKH ORDG DFWLQJ RQWKH VWQRGH DQG
YDOXHVRIDUHDFURVVVHFWLRQVRIVRPHEDUVRIWKHVWUXFWXUHQXPEHUHG
)LJ7KUHHGLPHQVLRQDOWUXVVVWUXFWXUH
1RGH
'LVSODFHPHQW
'' H '' H '' H '' H '' H '' H '' H 7DE6DPSOHGLVSODFHPHQWVLQ]GLUHFWLRQ
~ 219 ~
WK
,QWHUQDWLRQDO&RQIHUHQFHRQ1HZ7UHQGVLQ6WDWLFVDQG'\QDPLFVRI%XLOGLQJV
0HPEHU
2FWREHU%UDWLVODYD
'HIRUPDWLRQ
''
''
''
''
''
''
''
''
''
''
7DE6DPSOHGHIRUPDWLLRQV
&21&/86,216
3UHVHQWHGLQWHUYDOILQLWHHOHPHQWPHWKRGLVWKHDOWHUQDWLYHPHWKRGRIDQDO\VLQJXQFHUWDLQSUREOHPVZKLFKDSSHDU
LQ PHFKDQLFV DSSOLHG WR VWUXFWXUH DQDO\VLV 0HWKRGV RI LQYHVWLJDWLRQV GLIIHU IURP FODVVLFDO PHWKRGV EDVHG RQ
SUREDELOLW\FDOFXOXV$SSOLFDWLRQRILQWHUYDODQDO\VLVPHWKRGVLVDTXLWHQHZDSSURDFKLQORRNLQJRQUHOLDELOLW\
SUREOHPV ZKLFK FDQ EH DQDO\VHG ZLWK ILQLWH HOHPHQWPHWKRG WHFKQLTXH ([DFW VROXWLRQV FDQ EH FRPSDUHG ZLWK
VROXWLRQVREWDLQHGE\VLPXODWLRQPHWKRGV1RWLFHWKDWQXPHULFDOFRPSOLFLW\GRHVQ¶WJURZGUDPDWLFDOO\ZLWKWKH
SUREOHP GLPHQVLRQ DV LQ FODVVLFDO LQWHUYDO PHWKRGV DQG QRZ LV QRW WKH PDLQ ERXQG LQ XVXDO DSSOLFDWLRQV RI
SUHVHQWHGPHWKRGV
5()(5(1&(6
΀ϭ΁ $OHIHOG*+HU]EHUJHU-,QWURGXFWLRQWR,QWHUYDO&RPSXWDWLRQV$FDGHPLF3UHVV1HZ<RUN
΀Ϯ΁ %DXFK + -DKQ .8 ± 2HOVFKODJHO ' 6XVVH + :LHELJNH 9 ,QWHUYDOPDWKHPDWLN %6* %*
7HXEQHU9HUODJVJHVHOVFKDIW%HUOLQ
΀ϯ΁ %XUF]\xVNL76NU]\SF]\N-7KH)X]]\%RXQGDU\(OHPHQW0HWKRG$1HZ0HWKRGRORJ\6FL)DVFRI
6LOHVLDQ7HFK8QLYVHU&LYLO(QJ*OLZLFH
΀ϰ΁ %XUF]\xVNL76NU]\SF]\N-7KH)X]]\%RXQGDU\(OHPHQW0HWKRG$1HZ6ROXWLRQ&RQFHSW3URFRI
;,,3ROLVK&RQIRQ&RPSXWHU0HWKRGV,Q0HFKDQLFV:DUVDZ=HJU]H3RODQG0D\
΀ϱ΁ %XUF]\xVNL76NU]\SF]\N-)X]]\$VSHFWV2I7KH%RXQGDU\(OHPHQW0HWKRG(QJLQHHULQJ$QDO\VLV
ZLWK%RXQGDU\(OHPHQWV6SHFLDO,VVXH6WRFKDVWLF%RXQGDU\(OHPHQW0HWKRGV
΀ϲ΁ .DFSU]\N-=ELRU\UR]P\WHZDQDOL]LHV\VWHPRZHM3:1:DUV]DZD
΀ϳ΁ .|\ORJOX +8 dDNPDN $6 1LHOVHQ 65. ,QWHUYDO 0DSSLQJ LQ 6WUXFWXUDO 0HFKDQLFV
&RPSXWDWLRQDO6WRFKDVWLF0HFKDQLFVHG6SDQRV%DONHPD5RWWHUGDP
΀ϴ΁ /RJDQ'/$)LUVW&RXUVHLQWKH)LQLWH(OHPHQW0HWKRG3:6.(173XEO&RPS%RVWRQ
΀ϵ΁ 0RRUH5(,QWHUYDO$QDO\VLV3UHQWLFH+DOO(QJOHZRRG&OLIIV
΀ϭϬ΁ 1HXPDLHU$,QWHUYDO0HWKRGVIRU6\VWHPVRI(TXDWLRQV&DPEULGJH8QLYHUVLW\3UHVV&DPEULGJH1HZ
<RUN3RUW&KHVWHU0HOERXUQH6\GQH\
΀ϭϭ΁ 6NU]\SF]\N - 0HWRGD UR]P\W\FK HOHPHQWyZ VNRQF]RQ\FK 1RZD PHWRGRORJLD 3URF RI ;;;9,
6\PSR]MRQ 0RGHORZDQLH Z 0HFKDQLFH :LVOD OXW\ =HV]\W\ 1DXNRZH .DWHGU\ 0HFKDQLNL
6WRVRZDQHM
΀ϭϮ΁ 6NU]\SF]\N-3RZQXN$0HWRGDUR]P\W\FKHOHPHQWyZEU]HJRZ\FK1RZDPHWRGRORJLD0DWHULDO\
NRQIHUHQF\MQH .RQIHUHQFMD 1DXNRZR '\GDNW\F]QD Ä1RZH 7HQGHQFMH : 1DXF]DQLX 0HFKDQLNL´
.ROREU]HJ±
΀ϭϯ΁ 6NU]\SF]\N - 3HUWXUEDWLRQ 0HWKRGV )RU 6\VWHPV :LWK ,QWHUYDO 3DUDPHWHUV 3URF RI ,QWHUQDWLRQDO
&RQIHUHQFH 1(: 75(1'6 ,1 67$7,&6 $1' '<1$0,&6 2) %8,/',1*6 2FWREHU )DFXOW\RI&LYLO(QJLQHHULQJ687%UDWLVODYD6ORYDNLD%UDWLVODYD
΀ϭϰ΁ 6NU]\SF]\N - 1HZ &RPSXWDWLRQDO 0HWKRGRORJ\ )RU &DOFXODWLRQV :LWK ,QWHUYDO 1XPEHUV 3URF RI WK
,QWHUQDWLRQDO&RQIHUHQFH1(:75(1'6,167$7,&6$1''<1$0,&62)%8,/',1*62FWREHU
)DFXOW\RI&LYLO(QJLQHHULQJ687%UDWLVODYD6ORYDNLD%UDWLVODYD
~ 220 ~
Proceedings of the 11th International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
VIBRATION OF IMPERFECT SLENDER WEB
ď. Šnirc 1 and J. Ravinger 2
Using the geometric non-linear theory (The Total Lagrange Description) in dynamics we can establish the
problem of the natural vibration of the structure including the effects of the structural and geometrical
imperfections. The incremental stiffness matrix can take into account the residual stresses (structural
imperfections) and the geometrical initial displacements (geometrical imperfections) as well. The behaviour of
columns, frames and thin-walled structures is sensitive to imperfections. This theory and results can be used as
a base for the non-destructive method for the evaluation of the level of the load and the imperfections.
Key Words
Stability, buckling, post-buckling, dynamic stability, vibration, geometric non-linear theory, initial
imperfections, thin-walled structures.
1
INTRODUCTION
The problem of the combination of the linear stability and the vibration of structures was solved a long time ago.
By the linear stability we mean the assumption of an ideal structure. Differences, between theoretical results and
the reality, forced researchers to search for more accurate models. The slender web as a main part of the thinwalled structure has significant post-buckling reserves and for a description of them it is necessary to accept
a geometric non-linear theory. Burgeen (1951) formulated the problem of vibration of an imperfect column. The
problem of the vibration of a slender web as a non-linear system was formulated by Bolotin (1956). The
vibration of the rectangular slender web taking into account the geometrical initial imperfections has been
investigated by many researchers. (Wedel-Heinen, J. 1991, Hui, D. 1984, Ilanko, S. and Dickinson, S. M. 1991,
Yamaki, V. at al. 1983). Ravinger (2012) arranged the general theory for the dynamic post-buckling behaviour.
Presented paper gives a short summary of this theory. The results show the peculiarities for the differences of the
support conditions for static behaviour and for the vibration of the column and a slender web as main
constructional elements.
2
THEORY
Von Kármán theory has been used for the description of the post-buckling behaviour of a thin-walled panel with
geometrical imperfections and residual stresses. By including inertia forces the problem is extended into
dynamics. A direct formulation of Hamilton’s principle for the dynamic post-buckling behaviour of a slender
web leads to a system of conditional equation describing this non-linear dynamic process. In the case of a static
problem, linearized assumptions are accepted for the evaluation of the elastic critical load. Analogously, in the
1
Ing. ď. Šnirc, Faculty of Civil Engineering SUT, 813 68 Bratislava, Radlinského 11, Slovakia., e-mail:
lubos.snirc@stuba.sk
2
Dr.h.c. prof. Ing. J. Ravinger, DrSc. e-mail: jan.ravinger@stuba.sk
~ 221 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
case of a dynamic problem, Hamilton’s principle is arranged in incremental form for the evaluation of the free
vibration.
A system of conditional equations in the incremental formulation of the post-buckling behaviour of the slender
web or a thin-walled structure can be written as
T
K MP 'DP K INCP 'D D K INC
WP 'D W F INTP F EXTP 'F EXTP
K INCW 'D W K INCWP 'D P F INTW FEXTW 'FEXTW
where indexes mean
M
- mass,
INC
0
(1a)
0
- incremental, INT – internal,
(1b)
EXT –
external,
P
– plate,
W
- web .
The incremental stiffness matrix of the web K INCW is linear and, consequently, we can proceed to the
elimination of Eqn.(1b) and thus obtain the system of equations
1
T
K MP 'DP ( K INCP K INC
WP K INCW K INCWP )'D P F INTP F EXTP 1
1
1
T
T
T
K INC
WP K INCW F INTW K INCWP K INCWP F EXTW 'F EXTP K INCWP K INCW 'F EXTW
0
(2)
Taking out the inertia forces from Eqn.(2) we have conditional equations describing the static post-buckling
behaviour of a slender web or large displacements of plates. The Newton-Raphson iteration can be used for the
solution of these equations. From a number of rules whose are valid in numerical models of static non-linear
problems we use one which can help us in establishing the free vibration problem.
K INC { J
Ÿ K INC
1
T
K INCP K INC
WP K INCw K INCWP
(3)
This means that the incremental stiffness matrix is equal to the Jacobian of the Newton-Raphson iteration of the
system of non-linear algebraic equations.
The problem of the free vibration including the effects of initial imperfections (initial displacement and residual
stresses) can be obtained in the following way. We suppose a system Eqn.(2) in equilibrium; then:
1
1
T
T
FINTP K INC
WP K INCWP F EXTW 'F EXTP K INCWP K INCW 'F EXTW
We suppose a zero increments in the external load:
'FEXTP
The increments of the plate displacements are assumed as: 'D P
0
'FEXTW
(4)
0
(5)
'D P sin( Zt ) ,
(6)
where Z is the circular frequency of the free vibration.
Inserting this into Eqn.(2) we have a problem of eigenvalues and eigenvectors: K INC Z 2 K MP
det
0
(7)
Eigenvalues are the circular frequencies and eigenvectors represent the modes of the vibrations. The incremental
stiffness matrix includes the level of the load and the initial imperfections as well.
3
EXAMPLES
The vibration of simple supported column
Simple supported column loaded in compression is the simplest example for the explanation of the presented
theory. In this case it is very important how we suppose the boundary conditions in the point of the action of the
external load. In the case of moving support we have obtained a trivial result. To take in consideration the effects
of initial displacements, the support must be fixed during the vibration process. (Fig. 1,2).
w0
Static
l
z,w
F
Vibration
x
w
N=-F
E,A,I,ȡ
l
z,w
Fig. 1. The simple supported column – different boundary conditions
~ 222 ~
x
w0
w
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
F/Fcr
October 2013, Bratislava
F/Fcr
1.0
1.0
F
0.1
B
0.5
w0/r=0.1
w0/r=1.0
l
0.5
wc
STATIC
0.5
VIBRATION
A
N=-F
w0/r=0.5
B (w0=0)
A
0
B
(Ȧ/Ȧ0)2
wc/r
0
10.0
5.0
w0/r=1.0
0.5
1.0
1.5
Fig. 2. The stability and the vibration of the imperfect column
Slender web loaded in compression
In the case of the slender web loaded in compression the in-plane boundary conditions play a crucial role as well.
(Fig.3)
1.5
V
V cr
p V .t STATIC p V .t
1.0
D0
D0
A - VIBRATION
0 .1
D0
0.
0.25
D
V cr
0.5
D
t
, D0
D0
t
B - VIBRATION
S 2 Et 2
3 1 Q 2 a2
D0
0 .5
Z2
Z02
0
0.5
1.0
1.5
Fig. 3. The vibration of the slender web loaded in compression
Slender web loaded in compression – the second mode of the initial imperfection
If the mode of the initial displacement is the same as second buckling mode the static post-buckling behaviour
could be in this second mode. This initial displacement mode has an influence to the circular frequency, but the
mode of vibration is the first buckling mode. (Fig. 4)
~ 223 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
D 01 S x1 S y 1 D 02 S x 2 S y 1
w0
S xm
p
D1
p0
pCR
sin
D2
p
mSx
, S xn
a
p0
pCR
2.0
2.0
2
pCR
Į2
1.5
1.0
October 2013, Bratislava
Į1
S Eh
0.15 ,D 02
0.01
D 01
0.01,D 02
0.15
Z 02
0.5
1.0
'D 1
1, 'D 2
1, 'D 2
0.04
0.01
S 4 Eh 2
31 - Ȟ 2 Pa 2
1.5
'D 1
1.0
'D 1
0.0001
'D 1 1, 'D 2 0.001
'D 1 1, 'D 2 0.000001
0
1.5
1, 'D 2
0.5
D
0
'D 1 , 'D 2 Ÿ Mode of vibration
2
D 01
0.5
nSy
a
2
31 Ȟ a
2
sin
0.5
1.0
1.5
§Z ·
¨¨ ¸¸
© Z0 ¹
2
Fig. 4. The influence of the mode of the initial displacement for the vibration of slender web loaded in
compression
4
CONCLUSION
The theory (and the experiments - Ravinger, (2012)) have proved the sensitivity of the circular frequency of free
vibration to the level of the load and different types of initial imperfections. This knowledge can be used as an
inverse idea. Measuring of the natural frequencies can give us a picture about the stresses and imperfections in
the structure. This idea represents a base for a non-destructive method for the evaluation of the properties of the
structure at all. The natural frequency is sensitive even to residual stresses and it is very important detail.
ACKNOWLEDGEMENT
This paper has been supported by Slovak Scientific Grant Agency, grant No. 1/0629/12.
REFERENCES
[1]
[2]
[3]
[4]
[5]
[6]
[7]
Bažant, Z. P. – Cedolin, L. (1991) Stability of Structures. Oxford University Press.
Bolotin, V. V. (1956). Dynamic Stability of Elastic Systems. GITL, Moscow, (in Russian, English
translation by Holden-Day, New York, 1964).
Burgreen, D. (1951). Free Vibration of Pin-ended Column with Constant Distance between Pin-ends. J.
Appl. Mechan. 18 ,135-139.
Ilanko, S. – Dickinson, S. M. (1991). On Natural Frequencies of Geometrically Imperfect Simply
Supported Plates under Uni-axial Compressive Loading. J. Appl. Mechan. 58, 1082-1084.
Ravinger, J. (2012) Stability & Vibration. STU, Bratislava.
Wedel-Heinen, J. (1991) Vibration of Geometrically Imperfect Beam and Shell Structures, IJSS 1, 29-47.
Yamaki, V. – Otomo, K. – Chiba, M. (1983) Non-linear Vibration of Clamped Rectangular Plate with
Initial Deflection and Initial Edge Displacement. Thin-Walled Structures, 1, 101-119.
~ 224 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
NUMERICAL MODEL OF UNDERPASS STRUCTURE
CALIBRATED BY TESTS
M. Sokol1 and /.RQHþQi2
Abstract
This paper deals with creating of numerical model of underpass structure, which was used for determination of
eigen frequencies of structures. Numerical model was calibrated by tests. Tests have been done on real structure
for two varied train speeds (express train ± 75,5 km/h and passenger train - 44,3 km/h). Model was used for
determination of dynamic factor of structure after successful calibration. Results from tests and numerical
calculations were compared and good coincidence was obtained. Results from tests were very important in this
case, because they helped to take better account moving load into the mode.
Key Words
Eigen frequencies; dynamic factor; numerical model; moving load; dynamic tests
1
INTRODUCTION
Underpass structure is located under the railway platform, which is built on the embankment. Embankment and
sub-soil of structure consist of fluvial gravel with grains smaller than 2 cm. Cross-section of reinforced concrete
underpass structure has a form of closed box ± section.
Dynamic tests were made from commonly occurring load in this part of line (express train and passenger train).
Portable three-channel measurement equipment was used for data recording of structure response due to moving
trains, during the tests. Changes of accelerations were measured by three piezoelectric accelerometers. First
accelerometer was placed on railway platform. Second accelerometer was used in order to measure accelerations
of ceiling of underpass in vertical direction. Last accelerometer was situated under the ceiling in order to
measure vibration of structure in horizontal direction. Comparisons of response spectrum of structure calculated
for all three accelerometers had approximately the same trend for both types of trains.
2
SETTING OF NUMERICAL MODEL
Two models (frame model and two dimensional FEM model) of structures were created in order to get
comparison between calculated eigen frequencies and these obtained from tests, [1].
2.1 Frame model of structure
As a first, frame model of structure was created. Cut-out of structure with width equalled to 1 m was used for
calculation of eigen frequencies and eigen modes, in this case. Equivalent springs at places where structure is in
1
Prof. Ing. Milan Sokol, PhD., Slovak University of Technology in Bratislava, Faculty of Civil Engineering,
5DGOLQVNpKR 068 Bratislava, Slovakia, milan.sokol@stuba.sk.
2
,QJ /HQND .RQHþQi 3K' 6ORYDN 8QLYHUVLW\ RI 7HFKQRORJ\ LQ %UDWLVODYD )DFXOW\ RI &LYLO (QJLQHHULQJ
5DGOLQVNpKR 068 Bratislava, Slovakia, lenka.konecna@stuba.sk.
~ 225 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
a contact with soil have been introduced according to [2] for soil-structure interaction. It seems that these spring
constants of vertical and horizontal supports are the most important parameter of frame model of structure. Half
of dilatation section (distance cca 7 m) was considered as active part of structure, and it was used for calculation
of equivalent spring constants of spring support. Width of structure equalled to 6,1 m was taken into account for
determination ratio of ground dimensions of foundation; because bottom desk and subconcrete plate work
together as one rigid unit. Bottom desk of structure is on massive layer of subconcrete plate. Therefore, it is
possible to consider, that stiffness of this desk is high order than stiffness of other parts of underpass structure. In
case of upper desk, weights of upper layers were included in total vibrating mass. This was made by change of
density which was used for modelling of upper desk of underpass structure. The value of alternative density was
equalled to 8200 kg/m3. First three resultant eigen frequencies were 27 Hz, 28 Hz and 39 Hz.
2.2 Numerical model of structure
Two dimensional FEM model of underpass structure was created and setting. Setting of numerical model was
made by determination of substitutive width of model by following way. Locomotive was statically applied on
rails in the place above the middle of ceiling of underpass structure. Static deflection calculated from numerical
model was compared with static deflection calculated by simplified calculation. Several iterations were done,
and resultant substitutive width of model was 8,2 m. This value was used for next dynamic analysis. Eigen
frequencies obtained from tests which were verified by solution of frame model, were also consistent with eigen
frequencies from solution of numerical model (first three eigen frequencies were 26 Hz, 30 Hz and 42 Hz).
Imperfection of wheels of locomotive was also taken into account in this dynamic analysis. This imperfection
could be caused by faulty production, attrition, perhaps even by movement of wheels through small grains of
gravel lying on rail. This imperfection was considered by increasing the value of load applied on the structure,
[3, and 4]. Subsequently, calibrated model was used for calculation of dynamic factor for varied train speeds
from 1 km/h to 160 km/h, with speed step 1 km/h, [5, 6, and 7].
3
CONCLUSION
Eigen frequencies of underpass structure were calculated by two models ± frame model of structure and
calibrated numerical model of structure. These calculated eigen frequencies were verified by results from tests,
which have done on real structure. Results from tests affirmed that it is important to consider this structure as a
complex system ± underpass structure with surrounding soil. Also it was necessary to consider train like moving
action. After that, this calibrated numerical model was used for determination of dynamic factor for varied train
speeds up to 160 km/h. Dynamic factors calculated from experimental results were in good coincidence with
dynamic factors calculated from results of numerical model. Therefore, the curve of dynamic factor would be
useful for design of structure. Nevertheless, it would be good to make additional tests on real structure in future.
These results could provide more information, which is needed for detection of reason of dominant effects in
graph of dynamic deflection.
ACKNOWLEDGEMENT
This paper has been supported by Grant Agency (grant VEGA No. 1/1119/11) and Slovak University of
Technology in Bratislava (grant from the program in support of young researchers - No. 7819).
REFERENCES
[1]
[2]
[3]
[4]
[5]
[6]
[7]
Kohnke, P.C (1989). Ansys, Eng. System, Theoret. Manual, Swanson Analysis System.
STN 73 0036, (1997). Seismic acWLRQRIVWUXFWXUHV6Ò71Bratislava.
6710HUDQLHG\QDPLFNêFKV~þLQLWHĐRYSULMD]GHYR]LGODFH]SUHNiåN\9\GDYDWHĐVWYR
~UDGXSUHQRUPDOL]iFLXDPHUDQLH3UDKD
671 =DĢDåRYDFLH VN~ãN\ PRVWRY 9\GDYDWHĐVWYR ~UDGX SUH QRUPDOL]iFLX D PHUDQLH
Praha.
MelcHU-'\QDPLFNpYêSRþW\PRVWRYQDSR]HPQêFKNRPXQLNiFLiFK(G6WUHGä8V
Flesch, R. (1993). Baudynamik, praxisgerecht, Band I, Berechnungsgrundlagen, Bauverlag.
Sokol, M., (2006): Reduction of soil vibration induced by traffic. Slovak Journal of Civil Engineering,
vol. 14, No. 3-4, pp. 33-36. ISSN 1210-3896.
~ 226 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
Celková únosnost malých železobetonových nosníkO. Sucharda1, S. Vrublová2 a J. Brožovský3
Abstract
The paper deals with the non-linear analysis of the small reinforced concrete beams. The bearing capacity was
calculated using ATENA - the software designed for the fracture-plastic modelling of reinforced concrete. The
method used for the analysis was the Finite Elements Method. The LHS (Latin Hypercube Sampling) and the
FREET software were used for the stochastic modelling.
Klíová slova
Beton; nelineární výpo#et; metoda kone#ných prvk%; experiment; analýza
1
ÚVOD
Problematiku betonu a betonových konstrukcí se zabývá The International Federation for Structural Concrete
(CEB-FIB), která pro návrh a analýzu vydává doporuení a publikace [1], které jsou výchozími dokumenty pro
tvorbu norem, nap. Eurocode 2. U návrhu staveb s využitím progresivních technologií a materiál% je pak nutné
zejména zohlednit specifické chování betonu, napíklad r%znou pevnost a zp%sob porušení v tlaku a tahu. Pi
podrobnjší analýze je pak vhodné zvolit fyzikáln nelineární výpoet [2] a [3].
Pro nelineární analýzu vznikla celá ada konstitutivních model% beton% a pístup% k modelování, mezi které patí
napíklad [5] a [12]. Nelineární analýza se také asto kombinuje s pravdpodobnostní analýzou [8], vedením
tepla, dynamikou nebo seismicitou. U pravdpodobnostní analýzy stavebních konstrukcí se m%že využít [9].
Nelineární analýzu je pak zejména vhodné použít v pípadech, kdy se hodnotí dopady mimoádných událostí u
pr%myslových podnik%. Uritým omezením použití nelineární analýzy je však nutná znalost specifických
vstupních parametr%, zejména vlastností materiálu, které nejsou standardn dostupné. Pro samotnou numerickou
analýzu naptí a deformací betonových konstrukcí se pak využívá metoda konených prvk% [11]. Pedložený
píspvek se zabývá urením celkové únosnosti železobetonových nosník% u provedených experiment% malých
nosník%. U výpotu se využije stochastické modelování pomoci metody LHS (Latin Hypercube Sampling) [10] a
výpoetní programu FReET [4]. Výpoetní program ATENA [3] využívá nelineární modely betonu - fractureplastic model for reinforced concrete.
1
Ing. Oldich Sucharda, Ph.D., VŠB – TU Ostrava, Fakulta stavební, Katedra stavební mechaniky, L. Podéšt
1875/17, CZ 708 33 Ostrava Poruba, tel.: (+420) 597 321 391, oldrich.sucharda@vsb.cz.
2
Sylva Vrublová, VŠB – TU Ostrava, Fakulta stavební, Katedra stavební mechaniky, L. Podéšt 1875/17, CZ
708 33 Ostrava Poruba.
3
Doc. Ing. Jií Brožovský, Ph.D., Katedra stavební mechaniky, Fakulta stavební, VŠB-Technická univerzita
Ostrava, Ludvíka Podéšt 1875/17, 708 33 Ostrava - Poruba, tel.: (+420) 597 321 321, e-mail:
jiri.brozovsky@vsb.cz.
~ 227 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Obr. 1. Zkušební vzorky (železobetonové nosníky, betonové krychle a válce)
2
ŽELEZOBETONOVÉ NOSNÍKY A VSTUPNÍ DATA
Pro experimenty byly zvoleny malé železobetonové nosníky. Tyto byly doplnny dále zkušebními tlesy:
betonovými krychlemi (150x150x150 mm), betonovými válci (v. 300 mm, p. 150 mm) a betonáskou výztuží
pro trhací zkoušky. Betonové vzorky jsou zobrazeny na Obr. 1. Vyhodnocení základních charakteristik pevnosti
v betonu v tlaku a tahu uvádjí Tab. 1. a Tab. 2.
Obr. 2. Schéma malých železobetonových trámc%
Obr. 3. Železobetonový nosník 10C
Schéma zkoušky železobetonových nosník% je zobrazeno na Obr. 2. Jednalo se o tybodovou zkoušku na
trámcích dlouhých l = 700 mm. Vzdálenost podpor byla 600 mm. Nosník tvercového pr%ezu 150 x 150 mm
byl vyztužen výztuží s krytím 25 mm od dolního okraje. Celkové schéma betonového trámce, polohy podpor a
zatížení jsou patrné na Obr. 2. Betonáská výztuž byla pr%mru 10 mm a oznaení B500. Pevnost oceli je fy 684
MPa a smrodatná odchylka je 2,99. Poet zkoušek betonáské oceli byl 6 kus%.
Pro daný typ železobetonového nosníku byly provedeny ti zkoušky, kdy pr%mrná celková únosnost byla
112,96 kN. Zp%sob porušení byl u všech železobetonových nosník% podobný a je patrný na obr. Obr. 3 a 4.
&ernou barvou jsou na obrázku oznaeny nejvýraznjší trhliny. Smrodatná odchylka celkové únosnosti byla
18,467 kN.
Obr. 4. Železobetonový nosník 10B
~ 228 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
Pevnost
betonu
fck,cube
fck
fck,cube,total
Pevnost
[MPa]
50,21
44,63
50,54
Smrodatná
odchylka
[MPa]
2,42
0,63
1,71
Dolní
kvantil
[MPa]
46,22
43,63
47,73
5%
ρ [kg/m3]
2320,2
2351,7
2337,6
October 2013, Bratislava
Vzorek
Krychle
Válec
Krychle + válec
Poet
zkoušek
4
6
10
Tab. 1. Pevnost betonu v tlaku
Pevnost betonu v tahu [MPa]
Pr%mr
Smrodatná odchylka
3
3,26
0,10
Píná pevnost betonu v tahu [MPa]
3,62
0,11
Tab. 2. Pevnost betonu v tahu
ρ [kg/m3]
2336,71
26,76
NUMERICKÉ MODELOVÁNÍ
Pro numerické modelování železobetonových nosník% byl zvolen poítaový program ATENA, který má
implementovanou celou adu konstitutivních model% betonu urených pro nelineární analýzu. Konkrétn použitý
model se oznauje fracture-plastic material model for concrete. Protože pro nelineární analýzu betonových
konstrukcí je nutná znalost specifických vlastností materiálu, které nejsou standardn dostupné, jsou ureny z
literatury nebo doporuených hodnot v programu ATENA [3], kdy výchozími parametry jsou hodnoty ze
zkoušek uvedených v pedešlé kapitole, pípadn se využilo [13]. Sí konených prvk% je vytvoena
automatickým generátorem pro typickou velikost koneného prvku 20 mm. Nelineární úloha se eší metodou
konených prvk% [11] a metodou Newton-Raphson. Zatížení bylo deformaní. K stochastickému modelování je
zvolena metoda LHS [10] a program FReET [4]. Pi výbru statistických parametr% se vycházelo z dostupné
integrované databáze stavebních materiál% a doporuení uvedených JCSS [7] a ISO [6].
U deterministického výpotu železobetonového nosníku se stedními hodnotami vstup% je zobrazen na Obr. 5 a 6
pr%bh rozvoje trhlin pro dva stavy porušení betonového nosníku bhem výpotu. Samotný pr%bh rozvoje trhlin
je podobný s experimenty. Nejprve vznikly tahové trhliny pibližn uprosted rozptí a následn se zaala tvoit
smyková trhlina.
Obr. 6. Zatížení 103,3 kN, min. crack 1-05 m
Obr. 5. Zatížení 43,3 kN, min. crack 1-06 m
Pr%bh smykové trhliny byl pibližn od
podpory k bodovému zatížení. Smyková
trhlina je dobe patrná na Obr. 3 u
experimentu a na Obr. 6. u numerického
výpotu.
Výsledný odhad celkové
únosnosti železobetonových nosník% je
zobrazen na Obr. 7. Stední vypotená
hodnota celkové únosnosti pro provedené
výpoty je 108,7 kN, kdy smrodatná
odchylka je 9,38 kN. Zvolený histogram byl
Weibull min.
Ex. 1
Ex. 3
Ex. 2
Obr. 7. Celková únosnost železobetonových nosník% - histogram
4
ZÁV$R
Byly provedeny zkoušky malých železobetonových nosník%, u kterých se urovala celková únosnost. Následn
po provedení zkoušek bylo provedeno srovnání s numerickým výpotem, který byl založen na nelineárním
~ 229 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
výpotu respektujícím skutené vlastnosti betonu. Konkrétn byl zvolen konstitutivní model betonu a program
ATENA [3]. Pro urení celkové únosnosti se využilo také stochastického modelování metodou LHS a programu
FREeT [4]. Výchozími vlastnostmi betonu byly krychelná pevnost, válcová pevnost a pevnost betonu v tahu. Pro
dané výsledky pevností zkušebních tles bylo možné dobe použít vzájemné pevodové vztahy dle doporuení.
Numerické výpoty železobetonových nosník% dobe vystihovaly postupný pr%bh porušování experiment%.
Skutené hodnoty celkové únosnosti železobetonových nosník% z experimentu 1 a 2 leží v krajních ástech
intervalu výpotu pomocí stochastického modelování. Hodnota celkové únosnosti železobetonových nosník%
z experimentu 3 pibližn odpovídá vypoítané stední hodnot z numerického modelu. Celkov je možné
zhodnotit, že zvolený model betonu umož(uje dobe vystihnout jak celkovou únosnost betonového nosníku –
experiment%, tak samotný pr%bh porušování bhem zatžování. Pi výpotu a vyhodnocování je nutné
zohlednit, že rozdíl vypotené a skutené maximální únosnosti je možné pisoudit aproximací specifických
parametr% a nejistotám ve vstupních datech. Další oblastí, která m%že výsledky ovlivnit, je modelování podpor a
zatížení nebo vliv velikosti koneného prvku.
POD$KOVÁNÍ
&lánek vznikl za podpory projektu Studentské grantové soutže VŠB-TU Ostrava. Registraní íslo projektu je
SP2013/99.
LITERATURA
[1]
CEB - FIP Model Code 1990: Design Code. by Comite Euro-International du Beton, Thomas Telford,
1993. ISBN 978-0727716965.
[2]
Chen W., F. Plasticity in Reinforced Concrete. Mc. New York: Graw Hill, 1982.
[3]
Computer program ATENA 2D: Theory Manual. Praha: &ervenka Consulting, 2000.
[4]
Computer Pragram FReET (Computer Pragram for Statistical, Sensitivity and Probabilistic Analysis):
Theory Manual. Brno, 2002.
[5]
&ervenka, J., Papanikolaou V. K. Three dimensional combined fracture-plastic material model for
concrete. Int. J. Plasticity, Vol. 24, 2008, no. 12, p. 2192-2220. ISSN 0749-6419.
[6]
ISO 2394 General principles on reliability for structures, ISO, 1998.
[7]
JCSS: Probabilistic model
http://www.jcss.ethz.ch/.
[8]
Kralik, J., Nonlinear probabilistic analysis of the reinforced concrete structure failure of a nuclear power
plant considering degradation effects, 3rd International Conference on Applied Mechanics and Mechanical
Engineering, ICAMME 2012, Applied Mechanics and Materials, Vol. 249-250, 2013, Pages 1087-1098,
ISSN 1660-9336. DOI: 10.4028/www.scientific.net/AMM.249-250.1087.
[9]
Krejsa, M., Janas, P., &ajka, R. Using DOProC method in structural reliability assessment. 2nd
International Conference on Mechatronics and Applied Mechanics, ICMAM 2012, Applied Mechanics and
Materials, Vol. 300-301, 2013, p. 860-869, ISSN 1660-9336, DOI: 10.4028/www.scientific.net/AMM.300301.860.
code. JCSS
working materiál
[online].
2012 [cit.
2012-01-01].
[10] Novák, D., Voechovský, M., Rusina, R. Small-sample Probabilistic Assessment - software FREET,”
ICASP 9, In 9th International Conference on Applications of Statistics and Probability in Civil
Engineering, San Francisco, USA, July 6-9, 2003, pp. 91-96 Millpress, Rotterdam. ISBN 90-5966-004-8.
[11] Rombach, G. Anwendung der Finite-Elemente-Methode im Betonbau. 2. Auflage. Berlin: Ernst & Sohn,
2007. ISBN 978-3-433-01701-2.
[12] Sucharda, O., Brozovsky, J. Approach to the Assessment of Concrete Structures based on Non-Linear
Elasto-Plastic Analysis. In Proceedings of the CST2009 Conference, Civil-Comp Press, paper 121, Funchal
2009. ISBN 978-190508830-0.
[13] Sucharda, O., Mikolášek, D., Brožovský, J. Determination of Concrete Cube Strength from used Samples.
Transactions of the VŠB - Technical University of Ostrava, 2012, n. 2, p. 1-9. ISSN 1804-4824.
~ 230 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
NUMERICAL AERODYNAMIC STUDY OF AN EXTRADOSED
CONCRETE BRIDGE IN CONSTRUCTION STAGE
G. Szabó1 and J. Györgyi2
Abstract
In this paper a numerical aerodynamic study of an extradosed concrete bridge in a cantilever construction stage
is presented. The vortex shedding phenomenon is investigated only. Detailed (numerical) structural and flow
models have been made in order to calculate the displacement of the bridge precisely due to vortex excitation.
The numerical results are compared with that of the Eurocode.
Key Words
Bridge structure; cantilever construction stage; FEM; CFD; Eurocode
1
INTRODUCTION
Aerodynamic study is of primary importance in case of slender bridge structures. Basically section wind tunnel
tests are performed or in special cases the whole bridge structure can be included [1]. In literature numerical
simulations are usual by means of 2D CFD simulations only. 3D simulations can be found in related with the
authors' research work [2]. In this paper the three-dimensional approach is exploited in order to study an
extradosed bridge in a cantilever construction stage (Fig. 1.). The length of the cantilever is around 90m. The
flutter performance of this bridge is good, as the torsional stiffness is large due to the cellular box girder. Instead
of flutter the vortex shedding investigations were selected to make. The vortex calculation can be performed via
the proposals of the Eurocode and advanced numerical simulations can also be done. The latter requires
structural dynamic models as well as CFD simulations. In this study both approaches are investigated.
Fig. 1. The bridge structure in a cantilever construction stage (M43 motorway over the Tisza river, Hungary)
1
2
Gergely Szabó, 1023 Budapest, Frankel Leó út 88-90, III/15, 0036-327-9262, mr.gergely.szabo@gmail.com
Dr. József Györgyi, BMGE Budapest, gyorgyi@ep-mech.me.bme.hu
~ 231 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
2
October 2013, Bratislava
NUMERICAL MODELS
An accurate numerical study of an aerodynamic problem of a bridge requires both precise structural FEM and
CFD models of the considered structure. The FEM model (Axis 9.0, finite element software) of the cantilever
can be seen in Fig. 2. with the first mode shape (on the left). The corresponding natural frequency is 0.54Hz. The
CFD models can be seen in Fig. 2. (on the right). Unlike the methods found in literature, the whole bridge deck
was considered in the CFD meshing. The upper picture shows the mesh around the whole haunch girder with the
traveler at the end of it. Constructing such grid is tedious, as complex geometries should be followed. The
section of the CFD mesh at the constant height section is shown in the lower picture (Ansys-CFX software). The
bridge deck consists of 15 segments, on which the lift forces were to be determined.
Fig. 2. The bridge structure (top left), the first mode shape (bottom left), the CFD models (right)
The CFD mesh consists of approximately 1.5 million cells. The simulation was done at U=10m/s constant inflow
velocity. The bridge size was set to 1:100 that is the size is 100 times smaller than the real bridge. The reason is
that there was a wind tunnel test with the same size; therefore comparison could be made this way. The time step
was set to 0.0002s, the total number of the time steps was 10000. The LES turbulence model was selected. The
result of the calculation was the lift force at each segment as a function of time. The lift force coefficients can be
calculated according to the c y = Fy /(0.5 ‹ U 2 BL) formula, where Fy is the lift force, is the air density, U is the
flow velocity, B (0.30m in case of the CFD) is the width of the bridge deck, L is the length of the segments. In
Fig. 3. the lift force coefficients are shown for the 2nd and the 10th segments only for better visibility.
0.20
cy_2
0.10
cy_10
cy_w ind tunnel
0.00
cy [-]
-0.10
-0.20
-0.30
-0.40
-0.50
0.00
0.20
0.40
0.60
0.80
t* [-]
Fig. 3. Calculated lift force coefficients as a function of (non dimensional) time
~ 232 ~
1.00
11th International Conference on New Trends in Statics and Dynamics of Buildings
3
October 2013, Bratislava
RESULTS
3.1 Numerical results
Once the lift coefficients are determined by using CFD, the structural dynamic displacement of the end of the
cantilever can be calculated. The modal analysis was used based on the dynamic mode shapes and natural
frequencies of the bridge. In case of calculating displacement, the first mode shape provided 1% accuracy;
therefore the following scalar equation has to be solved at each time step:
2
y1 (t) + Œ 01 y 1 (t) + Œ 01
y1 (t) = f1 (t)
(1)
8
0
4
-5
Ymin [mm]
Y [mm]
In (1)  is the damping parameter (equal to two times the percentage damping), y is the unknown scalar, from
which the unknown displacement vector (x) can be calculated by using the first mode shape: x = V1 y . The mode
shape vector contains 15 elements in connection with the CFD model that contains also 15 elements. The index
refers to the first mode shape. In (1) f is the modal load vector ( f = V1T q ), Œ01 is the 1st natural circular
frequency. From the lift force coefficient time series on all the 15 segments the displacement of the end point of
the cantilever was calculated. The non-dimensional time series (see Fig. 3.) can be used to calculate the real
bridge structure motion due to any wind speed. To do so, the time series had to be scaled, leading to different
time-scale that is different wind velocities mean different time steps. This is the reason for using nondimensional time scale with 1 for the end time. By using this approach the different time scales can be plotted in
a same diagram. The displacement can be seen in Fig. 4. On the left two different wind speeds were considered.
On the right, the maximum values are shown as a function of the wind speed. The vertical line represents the
maximum constant wind speed that can be relevant in a vortex shedding situation. As it can be seen, the
maximum vertical displacement is expected around 1cm.
0
-4
-15
Y_U=20m/s
-8
-12
0.20
-10
Y_U=25m/s
-20
0.40
0.60
0.80
1.00
0
6
12
18
24
30
36
U [m /s]
t* [-]
Fig. 4. Vertical dynamic displacement of the end of the cantilever (left: time series, right: maximums)
The calculation of the displacement and the scaling of the force coefficient time series is explained here briefly.
The CFD time step was Δt CFD = 0.0002 s , the total number of time steps was N=10000. The CFD wind speed
was U CFD = 10m/s . The height of the bridge in the CFD was D CFD = 0.04m . The height of the real bridge is
D = 4m . The lift force from the lift force coefficients can be easily obtained by using the real bridge deck width
(B=30m) and the section length (L=5m) at a desired wind velocity (U). As the size and the wind speed is
different from the CFD simulations, the time scale changes. Using the Strouhal-number as a non-dimensional
parameter (Str=fD/U, where f is the vortex frequency), the time scale can be calculated by using the
't = 't CFD (U CFD /U) ⋅ (D/D CFD ) expression. The total time is T = N ⋅ 't , then the non-dimensional time is
t * = t/T . By using this approach, a desired wind speed can be considered and the displacement can be calculated.
According to Fig. 3. the determination of the fluctuating forces is hard by means of wind tunnel tests. The reason
for that is the need of expensive measurement instruments for that purpose. The fluctuation frequency is high,
the peak value is around 40-50Hz, which is really complex to capture. Such force signal is unlikely to obtain on
a section model. Instead, the pressure time series could be measured, from which the total forces could be
integrated along the cross section perimeter. In this study the fluctuating lift force was not measured, mean value
of the lift force was measured only by using force transducers. Although there are no fluctuating forces to
compare with, the numerical results are accepted, as the mean value for the same cross section showed really
good coincidence (see Fig. 3.).
~ 233 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
3.2 Application of the Eurocode
If the results are expected to obtain in a preliminary design situation, no advanced simulations can be done. In
this case the Eurocode [3] needs to be used. The expressions of the EC can only briefly be addressed here. The
displacement of the end point of a cantilever can be determined by using (2), in which Y is the vertical motion
amplitude, Kw and K are factors that take the relation of the mode shape and the structure of the wind into
account. Sc is the Scrouton-number (3).
max(Y) = D ⋅ K w K ⋅ c 'y ⋅
Sc =
2 ⋅ m i, y ⋅ Ž s
‹ ⋅ D2
=
1 1
⋅
St 2 Sc
2 ⋅ 44000 ⋅ 0.04
= 176
1.25 ⋅ 4.00 2
(2)
(3)
Without CFD or wind tunnel tests the main problem is getting the aerodynamic parameters; the fluctuating lift
force coefficient ( c 'y ) and the Strouhal-number. In Eurocode the number of the considered cross sections are
limited, only a few idealized shapes are included. In engineering practice, similar cross section needs to be
applied. At the investigated bridge, the deck is a wide box section, which is best followed with a simple
rectangle among the cross sections in the Eurocode. The parameters for this section are c'y = 1.10 and St=0.10.
By using these parameters the displacement was calculated as max(Y)=246mm with a corresponding critical
wind speed of U=22m/s. At the critical wind speed the vortex frequency and the natural frequency of the bridge
coincide providing the maximal displacement. The numerical results gave a maximum value of 10mm, which
means that there is a big difference between the EC and the numerical approach; therefore it seemed necessary to
further compare the results in order to ascertain about the reliability of both the numerical approach and the
Eurocode. To do so, the expressions of the EC were combined with the parameters of the numerical approach.
The lift force coefficient and the Strouhal-number were to be taken from the CFD results, which was not easy to
do, as the lift force coefficient signal does not contain only one frequency. Still as an engineering approach,
c'y = 0.10 and St=0,16 (from the FFT of the signal) values can be used. By substituting these parameters into (2)
and (3) the maximum of 8mm can be obtained, which is in good agreement with the purely numerical value of
10mm. This means that the numerical method as well as the Eurocode is reliable, the difference comes from the
choice of the aerodynamic parameters. Seemingly the lift force coefficient for a similar cross section (rectangle)
can be ten times higher than the real bridge, leading to an order higher displacement in the final results.
4
CONCLUDING REMARKS
In this paper and advanced numerical technique based on CFD simulation was presented. An extradosed bridge
structure was studied in a 90m long cantilever construction stage. The aerodynamic forces were determined on a
three-dimensional CFD mesh, from which the lift force coefficients were obtained. The displacement of the end
point of the cantilever was calculated by means of modal analysis. The calculated value was 10mm. The
Eurocode provided a value of 246mm, by using a rectangle as a similar shape. The EC was tested based on
numerical aerodynamic parameters as well. This study highlights that advanced numerical approaches may be
important in case of bridge structures. On the other hand, the EC can also be used, but in this case the
aerodynamic parameters (dynamic lift force coefficient and the Strouhal number) need to be taken from CFD or
wind tunnel tests even in a preliminary design state in order to avoid highly unreliable results.
ACKNOWLEDGEMENT
This paper has been supported by the Hungarian State (NKTH, INNOCSEKK Plusz application) and the PontTerv Ltd. (Hungarian Bridge Design Company).
REFERENCES
[1]
Matthivat, J.: The cantilever construction of prestressed concrete bridges. John Wiley & Sons, New York,
352 p., 1983
[2]
Szabó, G. - Kristóf, G.: Three-dimensional flutter simulation. The Fifth International Symposium on
Computational Wind Engineering, Chapel Hill, North Carolina, USA, May 23-27, 8 p., 2010
[3]
MSZ-EN-1991-1-4-2007 (Eurocode, in Hungarian)
~ 234 ~
Proceedings of the 11th International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
Stress investigations of orthotropic decks
Sh. Urushadze1 and L. Frýba2
Abstract
The theoretical and experimental investigations of orthotropic decks on highway and railway bridges are
described. They were proofed statically and dynamically with respect to their fatigue properties. The results of
tests were concentrated in a form of a Wöhler line (S-N curve). The test specimens were carried out in a full
scale, so that they correspond to reality.
Key Words
Orthotropic decks, fatigue tests, highway and railway bridges.
1
INTRODUCTION
The orthotropic decks represent an important structural detail of steel structures. Their advantages are: low
weight and hight, big stiffness, low natural frequencies, etc. However, they provide also some important
disadvantages: being fully welded, some internal stresses appear in their details, in which the stress
concentrations and fatigue cracks under intensive dynamic loads appear.
Therefore, the international organisations ERRI (European Rail Research Institute), [1], and EU (European
Union], [2], began to investigate this important question. In recent years, we have applied several theoretical and
experimental methods to discover the reasons and progress of cracks in orthotropic decks and to develop the
appropriate methods for the design and applications of the orthotropic decks.
The authors, being fully engaged in the above questions, present the most important results of their
investigations. They describe the applied theoretical and experimental methods for the solution of this
economically very important problem, i.e. the statics, dynamics, fracture mechanics and fatigue of orthotropic
decks.
2
TEST SPECIMENS
It has appeared that the fatigue cracks are detected very often near the crossing of the cross girder with
longitudinal ribs. Therefore, we have paid special attention to that place. The Fig. 1 shows the critical detail
(crossing of the cross girder with a longitudinal rib), [1], [3],
1
Ing. Shota Urushadze, PhD, Institute of Theoretical and Applied Mechanics, v.v.i., Academy of Sciences of
the Czech Republic, Prosecká 76, Prague,190 00, Czech Republic, +420 222363071. e-mail:
Urushadze@itam.cas.cz..
2
Prof. Ing. Ladislav Frýba, DrSc. dr.h.c., Institute of Theoretical and Applied Mechanics, v.v.i., Academy of
Sciences of the Czech Republic, Prosecká 76, Prague,190 00, Czech Republic, +420 283881646. e-mail:
Fryba@itam.cas.cz.
~ 235 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Fig. 1. A typical detail of the orthotropic deck
35 models of orthotropic deck were produced in the approximate scale 1:1, the dimensions of which are
scheduled in the Fig. 2.
Fig. 2. The tested model of the orthotropic deck
The tests were carried out in the laboratory of the Institute of Theoretical and Applied Mechanics in Prague
(ITAM) under harmonic forces. The applied forces, i.e. the maximum and minimum forces as well as the
number of cycles up to the fracture were recorded.
The stress range
'V = V max – V min
~ 236 ~
(1)
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
represents the parameter which decides the fatigue. It is defined as a difference between the local stress
maximum V max and minimum
3
V min , respectively.
FATIGUE TESTS
The test results, i.e. the stress ranges 'V as a function of the number of stress cycles, N, are shown in the
Fig. 3. They were evaluated using the last square method and provided the mean value
'V = –10 6 N + 81.126 , (N/mm 2 )
valid in the range of assumed values
(2)
'V and N .
The fatigue cracks arise in the area of stress concentrations, i.e. usually in the places of crossing the cross
girders with longitudinal beams (ribs).
Fig. 3. Results of fatigue tests
4
ATTEMPT TO IMPROVE THE FATIGUE TESTS
We tried to improve the fatigue tests by gluing the strips of the carbon fibre reinforcement composites
(CFRC) at the critical places, see. the Fig. 4, [4].
However, the results were not too satisfying. The fatigue of such elements showed approximately the same
values as before. Moreover, the application in practice could be hardly realizable because the cracks must be
forecasted in advance.
~ 237 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Fig. 4. The specimen A 7 covered (glued) with the CFRC
5
CONCLUSIONS
The orthotropic decks on steel structures have been very popular on both the railway and highway bridges and
on other engineering structures due to their low weight, great stiffness and low constructional height. They
provide low first natural frequencies, their damping is sufficient, while the maintenance easy.
The design is based on the stress ranges
'V = V max – V min , whose values are prescribed in Eurocode 3. The
design should be provided using the elementary theory of strength of materials, folded plate theory, finite
element method, grillage theory, or any advanced approach of computing structural mechanics. It depends in
which detail you will investigate the appearing stresses. A combination of the folded plate theory (for global
stresses) with the finite element method (for local stresses) is also useful for the design of orthotropic decks, [5].
The welding technology is of decisive importance for the achievement of good quality of steel bridges.
Moreover, all constructional details should be carefully performed. These precautions can substantially affect the
residual stresses, which may be a source of fatigue failures. The symmetrical welding and cutouts are
recommended for steel bridges. A carefully preparation of the surface is also necessary, while the thermal
treatment may be in special cases also useful.
ACKNOWLEDGEMENT
The supports of the team solving the project BRIFAG - Bridge Fatigue Guidance (Research Fund for Coal and
Steel of the European Commission granted under the contract Nr. RFSR_CT-2008-00033) and of the grant in the
Czech Republic Nr.103/08/1340 as well as of the institutional programme RVO: 68378297 are acknowledged.
REFERENCES
[1] ERRI Research Reports/RP 1 to 4, Fatigue strength of railway bridges with orthotropic decks. Final Report,
European Rail Research Institute, Utrecht, 1992 to 1996.
[2] BRIFAG (Bridge Fatigue Guidance), Final Report of the European Commission – Research Fund for Coal
and Steel, Paris, 2008 – 2012.
[3] L. Frýba, L. Gajdoš : Fatigue properties of orthotropic decks on railway bridges. Engineering Structures, 21
(1999), pp. 639-652.
[4] L. Frýba, Sh. Urushadze : Improvement of fatigue properties of orthotropic decks. Engineering Structures,
33 (2011), pp. 1166-1169.
[5] Sh. Urushadze, L. Frýba, M. Škaloud, M. Pirner, M. Zörnerová : Fatigue problems of steel bridges,
Proceedings of the First International Conference on Railway Technology, (editor) J. Pombo), Civil-Comp
Press, Stirlingshire, Scotland, 2012, Paper 16, 12 pages.
~ 238 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
Analýza parabolické )et*zovky
J. Vašek1 a O. Sucharda2
Abstract
This paper deals with analysis of parabolic catenary. There are determined horizontal reactions using four
numerical methods. Computational complexity of select methods is compared. Computational task is
algorithmyzed in Matlab. Selected methods are the direct iteration method, regula falsi, bisection method and
the method of tangents. Selected parabolic catenary type has an additional condition length of rope.
Klíová slova
Parabolická 'et$zovka; algoritmizace; numerické metody; analýza; horizontální reakce
1
ÚVOD
Píspvek se zabývá analýzou parabolické etzovky na Obr. 1 numerickými metodami. Výpotem je urována
horizontální reakce tymi metodami, u kterých je srovnávána výpoetní náronost. Jedná se o metodu pímá
iterace, regula falsi, bisekce a metodu teen. Výpoetní úloha je algoritmizována v programu Matlab [6].
Konkrétn je zvolený typ úlohy parabolické etzovky s dopl(kovou podmínkou, kterou je délka lana. Pi
algoritmizaci se vycházelo z postup% [3].
Obr. 1. Parabolická etzovka
1
Jakub Vašek, VŠB – TU Ostrava, Fakulta stavební, Katedra stavební mechaniky, student oboru Konstrukce
staveb, L. Podéšt 1875/17, CZ 708 33 Ostrava Poruba, jakub.vasek.st@vsb.cz.
2
Ing. Oldich Sucharda, Ph.D., VŠB – TU Ostrava, Fakulta stavební, Katedra stavební mechaniky, L. Podéšt
1875/17, CZ 708 33 Ostrava Poruba, tel.: (+420) 597 321 391, oldrich.sucharda@vsb.cz.
~ 239 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
2
October 2013, Bratislava
VÝPO(ET PARABOLICKÉ #ET$ZOVKY
Lano zavšené ve dvou kloubech zatížené spojitým zatížením na vodorovný pr%mt je oznaován jako
parabolická etzovka [1] a [2]. Pro urení jednotlivých silových a geometrických veliin popisující danou
konstrukci je nezbytné znát horizontální reakci v závsných bodech lana. Tuto sílu nelze vyjádit pouze
z podmínek rovnováhy, je nutné zvolit dopl(kovou podmínku. V tomto konkrétním pípad se jedná o známou
délku lana. Pi výpotu horizontální síly se vychází z rovnice pro délku lana (1). Stanovení hodnoty vodorovné
síly H bylo provedeno iteraními metodami.
L=
[
(
λa =
3
)
(
H
λa 1 + λ2a + ln λa + 1 + λ2a + λb 1 + λb2 + ln λb + 1 + λb2
2q
qxd
,
H
λb =
q (l − xd )
a
H
xd =
l Hh
+
2 ql
)]
(1)
(2)
MODELOVANÝ P#ÍKLAD
V ešeném píkladu iní p%dorysná vzdálenost závsných bod% l = 30 m a výškové pevýšení h = 1 m. Spojité
zatížení nabývá hodnoty q = 0,8 kN/m. Dopl(ková podmínka urující délku lana je L = 33 m.
4
ITERA(NÍ METODY
Všechny iteraní metody vycházejí z rovnic (1) a (2). Další podmínkou pro tyto metody jsou volby jednotlivých
kritérií jako nap.: hodnota první aproximace, ukonovací podmínka atd. Pro následné porovnání jednotlivých
ešení byly zachovány stejné hodnoty pro totožná kritéria. Pi použití numerických metod se vycházelo [4] a [5].
P)ímá iterace
Její grafické znázornní je ukázáno na Obr. 2 a). Výslednou hodnotu pedstavuje pr%seík ervené a modré
kivky. Hodnota nulté aproximace potebné k iteraci je nastavena 1 kN. Dále byly zvoleny dv ukonovací
podmínky. Jedna pedstavuje pesný poet 100 iteraních krok% a druhá je reprezentována vzájemnou odchylkou
dvou po sob jdoucích vypotených hodnot, která iní 0,001 kN. U této metody nastal problém divergence.
Výsledné hodnoty nevedly ke správnému ešení. Proto byl algoritmus upraven tak, aby pracoval s inverzní
funkcí (znázornn zelenou barvou). Tímto opatením bylo docíleno hodnot horizontální síly pro odchylku
14,8853 kN a pro poet 100 krok% hodnoty 14,8911 kN.
Regula falsi
Nkdy bývá také oznaována jako metoda ttiv. Její naznaení m%žeme vidt na Obr. 2 b). Upravením rovnice
(1) do homogenního tvaru hledáme touto metodou pr%seík kivky s vodorovnou osou. Poátení podmínku
tvoí interval, ve kterém se námi hledaná hodnota nachází. První ti iteraní kroky jsou znázornny ttivami dané
kivky. Jak je z grafu patrno, tato metoda iteruje k výsledné hodnot 14,8937 kN velmi pomalu. Vstupní interval
obsahující hledaný výsledek je omezen zdola 1 kN a shora 40 kN. Podmínku zastavující iteraci je urena
odchylka dvou následujících vypotených hodnot, která opt iní 0,001 kN.
Bisekce
Metoda bisekce neboli p%lení interval% je metodou, která je vstupními kritérii obdobná metod regula falsi.
Zkoumaný interval je opt ohranien hodnotami 1 kN a 40 kN. Konenou podmínkou je také rozdíl dvou po
sob jdoucích hodnot iterací nastaven na 0,001 kN. Následující hodnotu ovšem uruje polovina výchozího
intervalu. Metoda bisekce je znázornna grafem na Obr. 2 c). Prvních pt iteraních krok% je znázornno
vodorovnými árami. Lze vidt, že interval obsahující výslednou hodnotu 14,8910 kN se rychle zmenšuje. Tato
metoda tedy iteruje podstatn rychleji než regula falsi.
Newtonova metoda
Následující iteraní krok je uren pr%seíkem teny vytvoené ve výchozí hodnot a vodorovné osy. Tato iterace
je znázornna grafem na Obr. 2 d). Výchozí a ukonující podmínka jsou totožné s metodou pímé iterace. Na
~ 240 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
grafu m%žeme vidt první tyi teny. Jejich piblížení k výsledné hodnot 14,8905 kN je relativn rychlé.
K algoritmizaci této metody bylo nutné využít výpoet derivace v jednotlivých iteraních bodech [3]. Pro
výpotový model byla použita tíbodová dopedná formule (3) s diferencí 0,01. Pi použití jiných formulí
nenastalo zvtšení asové náronosti Newtonovy metody. Z hlediska potu iteraních krok% nebyla metoda také
ovlivnna.
- 3.f (x) + 4.f (x + dif) - f (x + 2.dif)
2.dif
f , (x) =
(3)
a) Pímá iterace
b) Regula falsi
c) Bisekce
d) Newtonova metoda
Obr. 2. Parabolická etzovka – výsledky
5
Srovnání iteraních metod
Jednotlivé metody s popsanými vstupními parametry dosáhly hodnoty H pi zaokrouhlení 14,89 kN. S touto
hodnotou je již možno urit ostatní geometrické a silové parametry. Na Obr. 3 vlevo je znázornný pr%vs lana
dle zadaných parametr%.
Na Obr. 3 vpravo je znázornna závislost hodnot výpotových horizontálních sil na potu krok% u jednotlivých
metod. Nejvíce nároná metoda, z hlediska potebných krok%, vychází metoda regula falsi s celkovým potem
276 krok%. Tento výsledek je také dokázán grafem znázor(ující jednotlivé iteraní kroky metody na Obr. 2 b).
Nejmenší poet potebných iterací (7 krok%) byl získán z výsledk% Newtonovy metody.
V Tab. 1 je uveden nejen poet potebných iteraních krok% u jednotlivých metod, ale také jejich asová
náronost. Ta koresponduje s potem krok% až na Newtonovu metodu. D%vodem navýšení asu je delší operace
v jednom kroku zp%sobená výpotem derivací v jednotlivých bodech.
~ 241 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Obr. 3. Parabolická etzovka, vlevo - pr%vs lana, vpravo - srovnání metod
Název metody
Iterace (krok)
Iterace (odchylka)
Regula falsi
Bisekce
Newtonova metoda
6
H [kN]
Výpoetní kroky
14,8911
100
14,8853
44
14,8937
276
14,8910
16
14,8905
7
Tab. 1. Srovnání metod - výsledky
&as (s)
0,1393
0,0602
0,5492
0,0349
0,0777
ZÁV$R
V softwaru Matlab [6] byl naprogramován píklad ešící výpoet horizontální reakce u rovinné etzovky
iteraními metodami pímé iterace, bisekce, regula falsi a Newtonovy metody. Pi zkoumání výpoetní
náronosti byl sledován výpoetní as a poet iteraních krok%. Nejmenší potebný as k dosažení výsledku byl
namen u metody bisekce. U této metody je ovšem potebná znalost intervalu, ve kterém se nachází hledaná
hodnota. Proto k obecnjší algoritmizaci je vhodné použít Newtonovy metody. Poet iteraních krok% u této
metody vychází u modelovaného píkladu nejmenší i pes vtší výpoetní as. Výhodou této metody ve srovnání
s metodou bisekce je v zadání pouze první aproximaní hodnoty. Delší výpoetní as Newtonovy metody je
zp%soben rozsáhlejším iteraním krokem, ve kterém je nutné dopoítávat derivace v jednotlivých bodech.
POD$KOVÁNÍ
Píspvek vznikl za finanní podpory Ministerstva školství, mládeže a tlovýchovy &R z Operaního programu
Vzdlávání pro konkurenceschopnost v rámci projektu . CZ.1.07/2.3.00/20.0013 ,,Tvorba a internacionalizace
špikových vdeckých tým% a zvyšování jejich excelence na Fakult stavební VŠB-TUO". This paper was
supported by the Ministry of Education, Youth and Sports under the Operational Programme: OP for Education
for Competitiveness (ECOP) under VSB-TUO, Project No.CZ .1.07/2.3.00/20.0013.
LITERATURA
[1]
Benda, J. Stavební statika II. VŠB-TUO, Ostrava, 2005.
[2]
Kadlák, J., Kytýr, J. Statika stavebních konstrukcí I. Staticky ur#ité prutové konstrukce. Uebnice. Brno:
VUTIUM, 2001. ISBN 80-214-1877-X.
[3]
Krejsa, M. Algoritmizace inženýrských výpo#t% [online]. 2013 [cit. 2013-3-1]. Dostupný z WWW: <
http://fast10.vsb.cz/krejsa/>.
[4]
Rektorys, K. a kol. P'ehled užité matematiky I, 7. rozší'ené a dopln$né vydání, Praha: Prométheus, 2000.
720 s. ISBN 978-80-7196-180-2.
[5]
Rektorys, K. a kol. P'ehled užité matematiky II, 7. rozší'ené a dopln$né vydání, Praha: Prométheus, 2000.
874 s. ISBN 978-80-7196-181-7.
[6]
Program Matlab, Informace o programu: <http://www.mathworks.com/products/matlab/>.
~ 242 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
LIMIT STATE ANALYSIS OF STRUCTURES - SOME
EXTREMAL THEOREMS AND METHODS OF SOLUTIONS
I. Véghová1 and J. Sumec2
Abstract
In the present article the authors discuss the extremal theorems of a limit analysis of structures. Presented are
the theorems on the lower and upper limit of the ultimate load as well as uniqueness of the problem solution. The
validity of the elastic-plastic model is assumed. Studied are admissible values of external forces and
displacement speeds. The article is a continuation of work "Mechanical-Mathematical Aspect of the Limit State
Analysis of the Structures" presented by Authorst the last year in the NewTrends 2012 Proccedings.
Key Words
Limit state analysis of structure; Upper and lower-bound of load bearing capacity; Uniqueness of problems
solutions; Elastic - plastic model.
1
INTRODUCTION
In our paper, we devote attention, limit load of plates. As is known, plates are especially important parts of
buildings and mechanical engineering structural elements and systems. Considerable technical importance 2D
bearing systems leads to more extensive research in this area and explore new directions in solving their bearing
capacity and deformation [1, 5, 9, 10, 11, 12]. These directions are concentrated mainly on the development of
the theory of plasticity resistance as well as physically nonlinear theory. [1, 2, 4, 6, 7]. Plastic limit load theory is
based on the assumption perfectly plastic material, while neglecting the effect of elastic deformation, which is
compared with the plastic one considerably small.
Experimental results indicate that their carrying capacity is always greater than the theoretical results for the
above assumptions, for example [5, 7, 9]. Consequently, the calculation is always on the safe side.
Mechanical action and resistance of structures is determined by their mechanical properties and depends on the
elastic and plastic deformation. Same specificity represents reinforced. Behaves elastically only at low level
load. The increase in the external load stresses grows, which results it is the growth of internal forces and thus
the plastic deformation. In terms of plastic deformation, the course σ ~ ε depends on the physical properties of
the material structure.The characteristic element of the problem is achieving the limit load, which is a function of
different physical states, e.g. [1, 8, 9].
1
Ing. Ivana Véghová, PhD., Dept. of Struct. Mech., Faculty of Civil Engng, STU in Bratislava, Slovakia,
ivana.veghova@stuba.sk
2
Prof. Ing. RNDr. Mgr. Jozef Sumec, DrSc., Dept. of Struct. Mech., Faculty of Civil Engng, STU in Bratislava,
Slovakia, jozef.sumec@stuba.sk
~ 243 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
2
October 2013, Bratislava
UNIQUENESS OF PROBLEMS SOLUTIONS
The task of uniqueness, solution of the problem of the limit state of the structure we restrict to finding if field of
the generalized stresses Fi (x,y,z) and instantaneous rate of displacements Ůj(x,y,y) corresponding to the limit
loads ξ(δ)pj (x,y,z) are unique while pj(x,y,z) defines external loading on the surface S of the structure analyzed.
We will start from the principle of virtual forces, for example [4, 5].
We suppose that there exist two completely different solutions of the problem
& , f&
Fi , U
j i
where
& ′ , f& ′
Fi′, U
j i
ako aj
pre ξ G p j
(1)
f&i are instantaneous strain rate and ξG the limit load intensity. Integration of the individual parameters of
Eq. (1) over the volume V and the surface S of the structure we have
& dS = F f& dV = F′f& dV
ξG ∫ p j U
j
∫ ii
∫ii
Sp
V
i
V
i
i
(2a)
=0
V
& dS = F f& dV = F′f& dV
ξG ∫ p jU
j
∫ ii
∫ ii
Sp
∫ (F′ − F )f&
⇒
V
⇒
V
∫ (F′ − F )f& dV = 0
i
i
(2b)
i
V
On the part surface Su are considering zero kinematic conditions. For a surface S is valid,
S = Sp ∪ Su . Because
both terms under integrals Eqs. (2a), (2b) are "local" non-negative, as is apparent from Fig. 1, if we replace it for
parameters marked with an asterisk for without asterisk.
f&i∗
Fi∗
0
F&i∗ − Fi
f&i
Fi
Φ=0
Fig. 1. Hyper-surface with generalized stress vectors and immediate displacements speeds
Fulfillment of Eqs. (2) for pure-convex surface can be just as is holds
Fi = Fi′ pre f&i ≠ 0 ∧ f&i′ ≠ 0
(3)
Fi ≠ Fi′ pre f&i = 0 ∧ f&i′ = 0
(4)
or
The assumptions
f&i ≠ 0 and f&i′ ≠ 0 is one of the conditions for a full solution. The equality (3) implies that in
(
)
the deformed areas is plastic field force uniquely determined. In areas of solid state f&i = 0 forces field is not
uniquely determined Eq. (4) and it is needed to establish some boundaries, what influences from the terms of the
internal balance and boundary conditions expressed in stresses (this also applies for the boundaries of plasticity
areas). Needs to be further noted that when starting the plastic state of structure (generation of mechanism), in
the design does not involve redistribution of internal forces in the event that the geometry does not change.
~ 244 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
3
October 2013, Bratislava
BASIC THEOREMS OF THE LIMIT STATE ANALYSIS
For illustration, in this part of the article we will focus to the "extremal” theorems of carrying capacity of plates.
3.1 Theorem on the lower bound of the ultimate load
According to this theorem it is possible to determine limit values of ultimate load from the bottom. Theorem
allows to determine the mechanical ability of plate where manifest such a static possible distribution of internal
forces, that the resistance of the plate is as large as possible.
Theorem 1. From the statically possible loads ultimate load is the largest one [1, 6].
q m = sup q s
(5)
Proof: We will apply the virtual work theorem of moments (generalized internal forces) mi on virtual curvature
δκi equal to the work performed by the external load p(x,y) on the virtual deflections δfi. For statics possible load
∫m
δκ i dS = ∫ p s δf dS
(6)
δκ i dS = ∫ p m δf dS
(7)
is
S
S
Similarly, we have for the ultimate loading p m
∫m
S
is
S
where S is the surface of the plate. In the sense of definition statically possible moments mi not exceed the values
mi given of plasticity condition.
m is ≤ m i
(8)
for the whole area of plate. By subtracting of Eq. (6) from Eq. (7), we have
∫ (m
i
S
− m is )δκ i dS = ∫ (p m − p s )δf dS
(9)
S
Because δκi and δfi are under active loading positive, then with regard to the inequality (8) we get
ps ≤ pm
(10)
In the derivation of this theorem, we used the statical principle of loading capacity. Statically possible moments
distribution corresponds statically possible load ps.
Theorem 2. Limit load is the smallest of all kinematically possible loads [1, 6], i.e.
p m = inf p k
(11)
Proof: This proof is based on the same principle as in the proof Theorem 1. i.e. the resulting after rearrangements
we have
∫ (m
S
ik
− m i )δκ i dS = ∫ (p k − p m )δf dS
(12)
S
For kinematically possible field increments of displacements for moments is valid Φ(m ik ) = m T . For moments
that correspond to the ultimate load applied relationship Φ(m i ) ≤ m T , where Φ is called limit area. However
under active loading the virtual quantities are positive values δκi and δfi are positive, we can write
pk ≥ pm
(13)
From this theorem further imply minimum load carrying capacity condition [1, 2], which can be used in
determining the course of plastic joints.
~ 245 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
4
October 2013, Bratislava
METHODS OF PROBLEMS SOLUTIONS
We distinguish two basic methods for solving the problem.
4.1 Static method
The solution consists of determining: a) static possible field moments and transverse forces and b) ultimate load
starting with:
a) the equilibrium equations, b) the boundary conditions and c) the plasticity condition.
4.2 Kinematic method
Ii is based on the determination of traces of plastic joints. If the structural materials used here as brittle, their
plastification is accompanied by the occurrence of fracture lines. The solution then consists of determining:
a) kinematically possible strain increments, b) course of plastic joints and c) the ultimate load.
Being used:
a) kinematic dependence between increases δκi and δfi or, dependences between increments of the rotation
in singular plastic joints
b) equality of increment work external load and internal moment capacity
c) equality of balance between moments of external loads and internal ultimate moments of individual
parts of structure being divided of plastic joints.
ACKNOWLEDGEMENT
This paper has been supported by Grant Agency (grant No. 1/0629/12, No. 1/1186/12).
REFERENCES
[1]
Sobotka, Zd.: Theory of Plasticity and Limit Design of Plates. Elsevier, Amsterdam 1984.
[2]
Sawczuk, A. - Hodge, P. G.: Limit Analysis and Yielding line Theory, J. Appl. Mech., 35, 1968, pp.357362.
[3]
Véghová, I. - Sumec, J.: Mechano – matematické aspekty medznej únosnosti konštrukcií. In: Proc. of the
10th Int. Conference on New Trends in Statics and Dynamics of Bildings, Oct. 3–5, 2012 Bratislava,
Slovakia.
[4]
Washizu, K: Variational Methods in Elasticity and Plasticity (In. Russian). Moscow, Mir 1987.
[5]
Kaiser, J.: Elasticity and Plasticity (In. Slovak). ALFA, Bratislava, 1990.
[6]
Hill, R.: Mathematical Theory of Plasticity. Oxford University press, New York 1983.
[7]
Lubarda, V. A.: Elastoplasticity Theory. CRC Press, New York 2002.
[8]
Dill, E. H.: Continuum Mechanics, Elasticity, Plasticity, Viscoelasticity CRC Press, Taylor and Group,
LLC 2007.
[9]
Kormaníková, E. Šejnoha, M., Száva, I., Kotrasová, K., Doganu, F., Sičáková, A., Valenta, R.: Selected
Chapters of Mechanics of Composite Materials. Part i. Technical University of Košice, 2011, p. 264 ISBN
978-80-89284-86-3, EAN 9788089284863.
[10] Hruštinec, Ľ.: Analysis of Interaction Surface Foundation with Subsoil. (PhD Thesis in Slovak|). Issue No
12, Book series of scientific works of STU in Bratislava, Faculty of Civil Engineering, Publishing House
STU. 184 p. (Annex 459 p.), Bratislava, 2003.ISBN 80-227-1957-9.
[11] Hruštinec, Ľ.: Numerical Analysis of the Interaction between Shallow (Square, Circular, Strip)
Foundations and Subsoil. In: Journal of Civil Engineering and Architecture, USA, Aug. 2013, Volume 7,
No. 8 (Serial No. 69), pp. 875-886. ISSN 1934-7359.
[12] Minárová, M.: Mathematical Modeling of Rheological Material Properties – Differential Operators Forms
of Constitutive Equations. (In print) Slovak Journal of Civil Engineering.
~ 246 ~
Proceedings of the 11th International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
9é32ý(775+/Ë19 .58+29é&+1È'5ä,$&+
.ULVWtQD9UiEORYi1
Abstract
This article deals with the problem of cracks in the walls of the circular tanks. Describes the requirements for
crack width for a given reservoir and it shows classifications of tanks according to requirements for tightness
according to EN 1992-3. Further describes the calculation of the stress of cross sections exposed for bending
moment, or a combination of bending moment and axial force. Furthermore in this paper two ways to control the
crack width according to EN 1992-1-1 are analyzed.
.Đ~þRYpVORYi
.UXKRYpQiGUåHWUKOLQ\671(1-3
1
Ò92'
1DUDVWDM~FH SRåLDGDYN\ V~þDVQHM GRE\ QD NYDOLWX åLYRWQpKR SURVWUHGLD YHG~ N VWiOH þDVWHMãLHPX Y\XåtYDQLX
QiGUåtQD YRGX D LQpNYDSDOLQ\.UXKRYpQiGUåHVDY\XåtYDM~Y PQRKêFKRGYHWYLDFKKRVSRGiUVWYD7HQWRIDNW
vedie k SRWUHEHQHXVWiOH]GRNRQDĐRYDĢQiYUK\NRQãWUXNFLHNUXKRYêFKQiGUåt
.UXKRYpQiGUåHY\XåtYDM~WDNPHUYãHWN\RGYHWYLDKRVSRGiUVWYD9 V~þDVQRVWLPiSULEOLåQHYãHWNêFKQiGUåt
YDOFRYê WYDU .UXKRYê S{GRU\V QiGUåt Pi YêKRG\ KODYQH ] KĐDGLVND VWDWLFNpKR D HNRQRPLFNpKR = KĐDGLVND
VWDWLFNpKRV~NUXKRYpQiGUåHYêKRGQpKODYQHSUHWRåHREYRGRYpVWHQ\V~YRYRGRURYQRPVPHUHQDPiKDQpOHQ
ĢDKRP DOHER WODNRP 2SURWL WRPX Y QiGUåLDFK LQêFK S{GRU\VQêFK WYDURY V~ VWHQ\ QDPiKDQp NRPELQiFLRX
QRUPiORYHMVLO\D RK\ERYpKRPRPHQWX.
3RGQHWRPQDULHãHQLHWDNpKRWRW\SXQiGUåHV~QiGUåHQDELRRGSDGNWRUpVDY V~þDVQRVWLEXGXM~QD6ORYHQVNXYR
vHĐNRP SRþWH 1D ]iNODGH ]DKUDQLþQêFK WHFKQROyJLt V~ SRGGLPHQ]RYDQp KU~EN\ VWLHQ WêFKWR QiGUåt þR YHGLH
k LFKSRUXFKiP
2
.20%,1È&,(=$ġ$ä(1Ë
3ULQiYUKXQiGUåtSRþtWDPHV GYRPDPHG]QêPLVWDYPL
NRPELQiFLD]DĢDåHQtSUHPHG]QêVWDY~QRVQRVWL
‫ܵܯܧ‬l = 1,35‫ ݐ݈ݒܧ‬+ 1,2‫ ܽ݀݋ݒܧ‬,
(1)
NRPELQiFLD]DĢDåHQtSUHPHG]QêVWDYSRXåtYDWHĐQRVWL
‫ = ܲܵܯܧ‬1‫ ݐ݈ݒܧ‬+ 1‫ ܽ݀݋ݒܧ‬,
kde:
Evlt- YODVWQiWLDåQiGUåH
Evoda -WLDåYRG\Y QiGUåL
1
,QJ.ULVWtQD9UiEORYi6WDYHEQiIDN678%UDWLVODYDNULVWLQDYUDEORYD@stuba.sk
~ 247 ~
(2)
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
3RV~GHQtPQDPHG]QêVWDY~QRVQRVWLVDDQDO\]XMHVSRĐDKOLYRVĢSUYNXYRþLSRUXãHQLX]O\KDQLXDOHERFHONRYHM
GHãWUXNFLL
$E\ VPH ]DLVWLOL EH]SRUXFKRY~ SUHYiG]NX NRQãWUXNFLH NRQWUROXMHPH PHG]Qp VWDY\ SRXåtYDWHĐQRVWL 7X
posudzujeme vznik a UR]YRMWUKOtQSUHWYRUHQLDD obmeG]XMHPHQDSlWLHY PDWHULiORFK
3
52='(/(1,(1È'5äË32'ď$7(61267,671(1-3
3UHGYêSRþWRPãtUN\WUKOtQMHYKRGQp]DWULHGLĢQiGUåQDNYDSDOLQX SRGĐDSRåDGRYDQpKRVWXSĖDRFKUDQ\SURWL
SULHVDNX 2EPHG]HQLH WUKOtQ EXGH ]iYLVLHĢ RG ]DWULHGHQLD SUYNX D IXQNFLH NRQãWUXNFLH 1RUPD UR]OLãXMH ãW\UL
triedy (0-3).
3UH WULHGX WHVQRVWL P{åHPH SRXåLĢ QRUPX 671 (1 -1- þDVĢ NGH MH XYHGHQp åH WUKOLQ\ PXVLD
E\Ģ REPHG]HQHWDNDE\QHQDUXãRYDOLULDGQXIXQNþQRVĢNRQãWUXNFLHMHMWUYDQOLYRVĢD QHVS{VRERYDOLQHSULMDWHĐQê
Y]KĐDG 3RþtWDPH OLPLWQ~ ãtUNX WUKOLQ\ Zmax NWRUi ]RKĐDGĖXMH XYHGHQp NULWpULD D MHM KRGQRWD ]iYLVt RG WULHG\
prostredia.
3UHWULHGXWHVQRVWLP{åHPHXYDåRYDĢV WUKOLQRXSUHFKiG]DM~FRXFH]FHO~KU~ENXVWHQ\DOHãtUNDWUKOLQ\PiE\Ģ
PD[LPiOQH Zk1, vtedy P{åHPH XYDåRYDĢ VR VDPRXWHVQHQtP WUKOtQ 2GSRU~þDQp KRGQRW\ Zk1 SUH QiGUåH V~
GHILQRYDQpDNRIXQNFLHSRPHUXK\GURVWDWLFNpKRWODNXKD a KU~EN\VWHQ\QiGUåHK3UHKD/h ”Zk1= 0,2mm, pre
hD/h •Zk1 PPPHG]LĐDKOpKRGQRW\VDXUþXM~OLQHiUQRXLQWHUSROiFLRX
3UH WULHGX WHVQRVWL WUKOLQ\ NWRUp EXG~ SUHFKiG]DĢ FHOêP SULHUH]RP PXVtPH ~SOQH Y\O~þLĢ DN QLH V~ SULMDWp
RSDWUHQLDSURWLSULHVDNXEDULpU\SURWLYRGHYêVWHON\.
3UHWULHGXWHVQRVWLV~SRWUHEQpQD]DLVWHQLHYRGRWHVQRVWL]YOiãWQHRSDWUHQLDQDSUtNODGYêVWHON\DOHERSUHGSlWLH
2EPHG]HQLHãtUN\WUKOtQSUHFKiG]DM~FLFKFH]FHO~KU~ENXSULHUH]XWUHEDRYHULĢWDNåHQiYUKRYiKRGQRWDYêãN\
WODþHQHMREODVWLEHWyQXEXGHDVSRĖ[min SULNYi]L-VWiOHMNRPELQiFLt
4
4.1
.RQWURODãtUN\WUKOtQ
9êSRþHWQDSlWt
V priereze vznikne trhlina, ak v QDMYLDF ĢDKRYR QDPiKDQêFK YOiNQDFK EHWyQX GRVLDKQH QRUPiORYp QDSlWLH
KRGQRWXYlþãLXDNRIctm, resp. fctm(t).
Ak v SULHUH]H QHRþDNiYDPH Y]QLN WUKOLQ\ SRXåtYDPH SUH YêSRþHW QDSlWt Y]ĢDK\ ] SUXåQRVWL 5{]QH PDWHULiO\
v priereze ]RKĐDGĖXMHPH SRPRFRX LGHiOQHKR SULHUH]X NGH QDKUiG]DPH SORFKX YêVWXåH HNYLYDOHQWQRX SORFKRX
EHWyQXD SUHGSRNODGiPHGRNRQDO~V~GUåQRVĢRERFKPDWHULiORY
0RPHQWQDPHG]LY]QLNXWUKOLQ\NULWLFNêPRPHQWGRVWiYDPHWDNåHGRY]RUFRYQDYêSRþHWQDSlWtGRVDGtPH
SHYQRVĢEHWyQXY ĢDKXIctm. A NULWLFNêPRPHQWEXGHSUHSULHUH]QDPiKDQêRK\ERP
‫݉ݐ݂ܿ = ݎܿܯ‬
‫݅ܫ‬
(3)
‫ݐݖ‬,݉ܽ‫ݔ‬
a SUHNRPELQiFLXRK\ERYpKRPRPHQWXD QRUPiORYHMVLO\
‫ = ݎܿܯ‬ቀ݂ܿ‫ ݉ݐ‬െ
kde
ܰ‫݇ܧ‬
‫݅ܣ‬
ቁ
‫݅ܫ‬
‫ݐݖ‬,݉ܽ‫ݔ‬
,
(4)
Ai- SORFKDLGHiOQHKRprierezu
Ii- PRPHQW]RWUYDþQRVWLLGHiOQHKRSULHUH]X
zt,max- Y]GLDOHQRVĢĢDåLVNDLGHiOQHKRSULHUH]XRGVSRGQêFKĢDKDQêFKYOiNLHQ
$N QDSlWLH SUHNURþt PD[LPiOQH ĢDKRY~ SHYQRVĢ EHWyQX RþDNiYDPH Y]QLN WUKOLQ\ 3UH REGĎåQLNRYê SULHUH]
QDPiKDQê OHQ RK\ERYêP PRPHQWRP YLHPH YêSRþHW SRORK\ QHXWUiOQHM RVL Ä[³ XURELĢ SRPRFRX NYDGUDWLFNHM
rovnice:
2
2
ܾ
ܾ
‫ ݔ‬2 + ሾሺߙ݁ െ 1ሻ + ߙ݁ ‫ݏܣ‬1 ሿ‫ ݔ‬െ ሾሺߙ݁ െ 1ሻ‫ݏܣ‬2 ݀2 + ߙ݁ ‫ݏܣ‬1 ݀ሿ = 0.
A Y\SRþtWDĢPRPHQW]RWUYDþQRVWLLGHiOQHKRSULHUH]XN QHXWUiOQHMRVL
~ 248 ~
(5)
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
1
‫ ݔܾ = ݎ݅ܫ‬3 + ሺߙ݁ െ 1ሻ‫ݏܣ‬2 (‫ ݔ‬െ ݀2 )2 + ߙ݁ ‫ݏܣ‬1 (݀ െ ‫)ݔ‬2 .
3
MD[LPiOQHQDSlWLHY EHWyQH je ߪܿ,݉ܽ‫= ݔ‬
‫ܯ‬
‫ݎ݅ܫ‬
‫ ݔ‬a YRYêVWXåLߪ‫ݏ‬1 = ߙ݁
‫ܯ‬
‫ݎ݅ܫ‬
(6)
ሺ݀ െ ‫ݔ‬ሻ.
V SUtSDGH åH MH REGĎåQLNRYê SULHUH] QDPiKDQê RK\ERYêP PRPHQWRP D RVRYRX VLORX SRþtWDPH SRORKX
QHXWUiOQHM RVL ] momentovej podmienky ‫ݏܨ‬1 ሺ݀ െ ݁0 ሻ െ ‫ ܿܨ‬൫݁0 + ‫ݔ‬ൗ3൯ െ ‫ݏܨ‬2 ሺ݁0 + ݀2 ሻ = 0 NGH ÄH³ MH
excentricita osovej sily, e=M/N a e0= e- K3R~SUDYHY]QLNiNXELFNiURYQLFD
6
‫ ݔ‬3 + 3݁0 ‫ ݔ‬2 + ሾߙ݁ ‫ݏܣ‬1 ሺ݀ + ݁0 ሻ + ሺߙ݁ െ 1ሻ‫ݏܣ‬2 ሺ݁0 + ݀2 ሻሿ‫ݔ‬
ܾ
6
െ ሾߙ݁ ‫ݏܣ‬1 ݀ሺ݀ + ݁0 ሻ + ሺߙ݁ െ 1ሻ‫ݏܣ‬2 ݀2 ሺ݁0 + ݀2 ሻሿ = 0.
ܾ
(7)
NDSlWLHY EHWyQH je:
ߪܿ,݉ܽ‫= ݔ‬
െܰ‫ݔ‬
ߙ ݁ ‫ݏܣ‬1 ሺ݀െ‫ݔ‬ሻ+ሺߙ ݁ െ1ሻ‫ݏܣ‬2 ሺ݀ 2 െ‫ݔ‬ሻെ0,5ܾ‫ ݔ‬2
(8)
a QDSlWLHYRYêVWXåL
ߪ‫݁ߙ = ݏ‬
4.2
݀െ‫ݔ‬
‫ݔ‬
ߪܿ,݉ܽ‫ ݔ‬.
(9)
.RQWURODãtUN\WUKOtQEH]SULDPHKRYêSRþWX
3UHMHGQRGXFKRVĢEROLYêSRþW\ãtUN\WUKOtQVWDEXĐNRYDQp7LHWRWDEXĐN\V~XYHGHQpY norme STN EN 1992-1-1
a v norme STN EN 1992-V~XYHGHQpY SRGREHJUDIRY%ROLY\WYRUHQp]DSUHGSRNODGXåHMHSRXåLWiUHELHUNRYi
YêVWXåSHYQRVĢEHWyQXY ĢDKXY okamihu vzniku trhliny je fct,eff= 2,9 MPa a ]DĢDåHQLHPiGOKRGREêFKDUDNWHU
âtUNXWUKOLQ\RYSO\YĖXM~SDUDPHWUHQDSlWLHYRYêVWXåLSULHPHUYêVWXåHD ~þLQQêVWXSHĖY\VWXåHQLDOverenie
YêVWXåH P{åHPH URELĢ GYRPD VS{VREPL $N SR]QiPH QDSlWLD YR YêVWXåL ] WDEXĐN\ RGþtWDYDPH PD[LPiOQ\
SULHPHUSU~WDSUHNRQNUpWQX SRåDGRYDQ~ãtUNXWUKOLQ\7DE).
1DMYlþãtSULHPHUSU~WDY>PP@
NaplWLHYRYêVWXåL
[MPa]
wk= 0,4 mm wk= 0,3 mm wk= 0,2 mm
160
40
32
25
200
32
25
16
240
20
16
12
280
16
12
8
320
12
10
6
360
10
8
5
400
8
6
4
450
6
5
Tab.1 1DMYlþãLHSULHPHU\YORåLHNijs* na kontUROXWUKOtQSRGĐD671EN 1992-1-1, resp. STN EN 1992-3
Pre PD[LPiOQHY]GLDOHQRVWLSU~WRYSRXåtYDPHWDEXĐNXSULþRPSRXåtYDPHURYQDNêSRVWXS
0D[LPiOQDY]GLDOHQRVĢSU~WRYY>PP@
1DSlWLHYRYêVWXåL
[MPa]
wk= 0,4 mm wk= 0,3 mm wk= 0,2 mm
160
300
300
200
200
300
250
150
240
250
200
100
280
200
150
50
320
150
100
360
100
50
Tab. 2 0D[LPiOQDY]GLDOHQRVĢSU~WRYna kontUROXWUKOtQSRGĐD671(1-1-1, resp. STN EN 1992-3
~ 249 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
4.3
October 2013, Bratislava
9êSRþHWãtUN\WUKOtQ
3UHSUHVQHMãLH YêVOHGN\V~ v norme STN EN 1992-1-XYHGHQpY]RUFHQDYêSRþHWãtUN\WUKOLQ\7LHWRY]RUFHVD
Y\XåtYDM~SUHSRV~GHQLHY\VWXåHQpKRSULHUH]XD SRVN\WXM~NRQNUpWQXKRGQRWXãtUN\WUKOLQ\
‫ݎݏ = ݇ݓ‬,݉ܽ‫ ݉ݏߝ( ݔ‬െ ߝܿ݉ ),
kde
(10)
sr,max - PD[LPiOQDY]GLDOHQRVĢVXVHGQêFKWUKOtQ (12),
İsm - SULHPHUQpSRPHUQpSUHWYRUHQLHYêVWXåH
İcm - SULHPHUQpSRPHUQpSUHWYRUHQLHEHWyQXPHG]LWUKOLQDPL
5R]GLHOSRPHUQêFKSUHWYRUHQtEHWyQXD YêVWXåHSRþtWDPH]RY]ĢDKX
ߝ‫ ݉ݏ‬െ ߝܿ݉ =
kde
ߪ‫ ݏ‬െ݇ ‫ݐ‬
݂ ܿ‫ ݐ‬,݂݁
(1+ߙ ݁ ߩ ‫ ݌‬,݂݂݁ )
ߩ ‫ ݌‬,݂݂݁
‫ݏܧ‬
ߪ
൒ 0,6 ‫ ݏ‬,
‫ݏܧ‬
(11)
ʍs- QDSlWLHY ĢDKDQHM YêVWXåLY priereze s trhlinou
Įe- pomer Es/Ecm
ʌp,eff- ~þLQQêVWXSHĖY\VWXåHQLD$s/Ac,eff
kt- V~þLQLWHĐ]iYLVOêRGWUYDQLD]DĢDåHQLDSUHNUiWNRGREp]DĢDåHQLHSUHGOKRGREp]DĢDåHQLH
ÒþLQQiSORFKDEHWyQXVDXUþXMHSRGĐDQRUP\671(1-1-1 DNRV~þLQHIHNWtYQHMYêãN\SULHUH]XKc,eff a ãtUN\
prierezu.
0D[LPiOQXY]GLDOHQRVĢVXVHGQêFKWUKOtQY\SRþtWDPHSRGĐDY]RUFD
‫ݎݏ‬,݉ܽ‫݇ = ݔ‬3 ܿ + ݇4 ݇1 ݇2
kde
߶‫ݏ‬
ߩ ‫ ݌‬,݂݂݁
,
(12)
ʔs- SULHPHUSU~WD
c- NU\WLHSR]GĎåQHMYêVWXåH
k1- V~þLQLWHĐV~GUåQRVWL YêVWXåHSUHUHELHUNRY~YêVWXåSUHKODGN~YêVWXå
k2- V~þLQLWHĐ]RKĐDGĖXM~FLUR]GHOHQLHSRPHUQêFKSUHWYRUHQtSUHRK\ESUHFHQWULFNêĢDK
RGSRU~þDQpKRGQRW\SUHV~þLQLWHOHN3 a k4 V~N3= 3,4 a k4= 0,425.
5
=È9(5
3RåLDGDYN\GQHãQHMGRE\Q~WLDSURMHNWDQWRYQDYUKRYDĢNRQãWUXNFLHUêFKORDNYDOLWQHKODYQH]KĐDGLVNDNYDOLW\
MHQXWQpQH]DQHGEDĢQiYUKDMna med]QpVWDY\SRXåtYDWHĐQRVWL. 3ULQiYUKXNRQãWUXNFLL EH]WUKOtQMHG{OHåLWêDM
WHFKQRORJLFNê postup zhotovenia, poXåLWpPDWHULiO\D ULHãHQLHSUDFRYQêFKD GLODWDþQêFKãNiU
32Ć$.29$1,(
7HQWRSUtVSHYRNY]QLNRO]DILQDQþQHMSRGSRU\JUDQWRYHMDJHQW~U\0â65DNRSURMHNW9(*$
/,7(5$7Ò5$
>@ %,/ýË. - *5$0%/,ý.$ â %HWyQRYp NRQãWUXNFLH - 1iGUåH 9\GDYDWHĐVWYR STU v Bratislave, 1997,
ISBN 80-227-0923-9
>@ %,/ýË. - 1DYUKRYDQLH QRVQêFK NRQãWUXNFLt VWDYLHE - %HWyQRYp QiGUåH D ]iVREQtN\ 9\GDYDWHĐVWYR 678
v Bratislave, 2009, ISBN 978-80-227-3064-8
>@ %,/ýË. - ),//2 ď %(1.2 9 +$/921Ë. - %HWyQRYp NRQãtrukcie- QDYUKRYDQLH SRGĐD 671 (1
1992-1-1, 9\GDYDWHĐVWYR678Y Bratislave, 2008, ISBN 978-80-227-2940-6
[4] STN EN 1992-1-1 (XURNyG1DYUKRYDQLHEHWyQRYêFKNRQãWUXNFLtýDVĢ
[5] STN EN1992-3 (XURNyG1DYUKRYDQLHEHWyQRYêFKNRQãWUXNFLtýDVĢ1iGUåHQDNYDSDOLQ\]iVREQtN\
~ 250 ~
Proceedings of the 11th International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
NUMERICAL ANALYSIS OF CONSTRUCTION
OF RESIDENTIAL BUILDING TREATED
INFLUENCE OF MINING ACTIVITIES
M. Wieczorek1
Abstract
The work presents the numerical analysis of the eleven-storey residential building, which is characterized by
a high-excursion related to the impact of mining activities. The analysis was to determine the effort of building
construction, by the calculation of stresses in the exterior and interior walls located in underground floor
located. The results of the analysis and resulting conclusions have been presented.
Key Words
numerical analysis, impact of mining activities, reinforced concrete construction, prefabricated construction
1
INTRODUCTION
Together with the shifting of the front of mining exploitation the point of inflexion between the convex
and concave curvature of the trough basin of the site approaches the building structure, displacing itself under
the building, and then recedes together with the front of mining activities. Together with changes in the quantity
of inclination of the site in the course of the shift of the trough basin of mining there occur deflections
of the building from the perpendicular, accompanied by changes of the values and directions. This is connected
with the fact that this value occurs not only in one plain, but spatially.
The degree of inflections of the site, following the passing of the front of exploitation gradually decreases until
the site grow quiet again. Theoretically, after the passing of the front of exploitation the building ought to regain
its former state, unless in the course of the duration of this phenomenon some irreversible deformations
in the substrate have taken place. In most cases, however, due to the accumulation of numerous mining activities
or activation of a banding workings the process of changes in the inclination of the site, both in value
and direction, is rather complicated and may become hazardeous for the building in a way not foreseen
in the predictions. The formation of trough basins caused by mining results in transient inclinations of building,
structures from their vertical position, unless the front of operations retains in the vicinity of the building,
consolidating the inclination of the soil, and thus also of the building.
The inclination of buildings involves important problems concerning the utilization of these buildings [1]. From
the viewpoint of straight and statistic difficult to prevent such inclinations. This involves an additional
distribution of forces, which jointly with the dead load, useful load and strength of the wind influence the state
and stability of building [2]. The present paper is based on the publication [3], the aim of which was to check
the effort of the structure of an eleven-storeys building, taking into account its actual as well as the predicted
inclination from the perpendicular.
1
PhD. Eng. Mirosáaw Wieczorek, Silesian Technical University, Faculty of Civil Engineering,
Department of Building Structures, ul. Akademicka 5, 44-100 Gliwice, Poland; miroslaw.wieczorek@polsl.pl
~ 251 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
2
October 2013, Bratislava
CHARACTERISTICS OF THE BUILDING
The paper deals with a dethatched many-family building with eleven stores located on the street
Jankowskiego 16 in Bytom. It consists of two segments with cellars, independent of each other. In the top view
the dimensions of these segments are about 10,35×19,57 m with a height of 36,0 m. The building was
constructed of prefabricated large plates. The segments were founded or a foundation of reinforced concrete slab
a thickness of 60 cm. The basement is constructed of reinforced concrete slab a thickness of 22 cm, connected
with other by dowel-loop joints. The basement and all the storeys are covered by prefabricated reinforced
concrete floors with a thickness of 14 cm. The structural solution of the basement may be considered as being
stiff box, protecting the whole segment against effects of mining activities. The respective over ground store are
characteristic for the transverse arrangement of load-bearing walls. Constructional details of building are shown
in figures in the extended version of the article.
Fig. 1. The view of the analyzed building
3
Fig. 2. Numerical model of the whole building
NUMERICAL ANALYSIS
3.1 STATICAL ANALYSIS FROM THE VIEWPOINT OF INCLINATION
Due to inclinations of the site by the value T the building is exposed to additional horizontal loads FT, which
may approximately be determined as:
FT = G × Tb
(1)
where: G – mass of the building, Tb – inclination of the building [4].
In prognostications of inclinations of the building it is generally assumed that its inclination equals that
of the site, i.e. Tb = T. An inclination of the building involves the occurrence of additional horizontal forces,
which are components of vertical loads. Horizontal loads affect the whole building and must be transferred by
its carrying structure, retaining the required conditions of stability and strength. The hazard of any given
building, resulting from its inclination from the perpendicular depends on its geometric and structural
~ 252 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
characteristics and on the degree of the inclination. The vertical logs FT is taken over by the respective elements
of the buildings, particular through the walls of the basement while increasing their effort was.
The purpose of the calculation is to analyze the state of stress in the bearing walls of the building in the situation:
x present inclination with values Tmax,x = 11‰ oraz Tmax,y = 35,6‰,
x predicted inclination with values Tmax,x = 16‰ oraz Tmax,y = 40,6‰,
x rectification object.
3.2 DATA ASSUMED IN THE CALCULATIONS
The parameters of the materials were determined basing on technical documentation of the analyzed building.
The assumption considered in the calculations were:
x the walls of the basement, the external walls and floors – in compliance with the standard
PN-B-03264:2002 - concrete of the class B15; in compliance with the standard PN-206-1:2003 concrete of the class C12/15 with the following parameters of strength:
fck1 = 12 MPa, fck2 = 15 MPa, fctk = 1,6 MPa,
x the internal walls over-ground storeys and the foundation: in compliance with the standard
PN-B-03264:2002 - concrete of the class B20; in compliance with the standard PN-EN-206-2003 concrete of the class C12/15 with the following parameters of strength:
fck1 = 16 MPa, fck1 = 20 MPa, fctk =1,9 MPa.
where :
fck1 - strength characteristic for the compression of a cylinder specimen
fck2 - strength characteristic for the compression of a rectangular specimen
fctk -warranted average tensile strength
The calculations of the structure concerned the following loads:
x dead load - the values characteristic for the dead load were calculated basing on the geometrical
dimensions of the respective elements and taking into account the spatial loads,
x the wind load was determined in compliance with the standard PN-78-02011 as to the situation
of the considered building the site was qualified as belonging to the Zone 1. The period of free
vibrations of the building was calculated and the value of the logarithm of the dumping decrement was
determined, and thus the building was qualified as a nonflexible structure,
x the useful load was determined in compliance with the standard PN-82B-02003, the characteristic
useful load pk of the considered building amounts to:
o qk = 1,5 – at floors of the rooms, the bathroom and the kitchen
o qk = 3,0 – in the staircase and the lift
o qk = 0,5 – in the roof of 9th storey
x the load resulting from the inclination of the building from the perpendicular
3.3 THE MODEL OF CALCULATIONS
The numerical model of calculations (presented in figures in the extended version of the article) was constructed
basing on documentation of the design of the analyzed building [3].
3.4 RESULTS - STRESSES IN THE LOWER PART OF THE BUILDING
The result of the calculations are extensive results for the forces and stresses in all structural elements of each
of the five defined models. For example, all the components of the stress obtained (normal and tangential)
in each wall of each floor of each calculation scheme. Presentation of the results of the calculation is entirely
pointless and practically impossible. Therefore limited to the presentation of the principal stresses occur only
in load-bearing walls in underground storey, ground floor and first floor, this is where the highest values were
obtained. The calculation results show that most of the principal stresses occur during the rectification section
16B. This is due, inter alia, its inclination (the differences between the values of the stresses in the individual
models are not greater than 10%). The study included two cases of the building work, which is defined
as follows:
x situation 1: the building stands on the foundations and is deflected from the vertical (current state),
x situation 2: the building is erect and transmit loads to the foundation. It is a state in the target
rectification.
~ 253 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Below, in the following figures (Fig. 3÷4 in the extended version of the article), maps posted for the abovedefined stress situations. On the drawing up maps of the principal stresses obtained for the walls in the axis
operating in two design situations. Values of the major tensile stresses in any case not exceed the value
of 0.9 MPa, which means that it is not expected to exceed tensile strength of concrete, which is estimated
at no less than about 1 MPa. The minimum value of the compressive stress is less than -5 MPa. The stresses do
not exceed the compressive strength of the concrete, which is estimated to be not less than 15 MPa.
The rectification of the building will allow reduction of the tensile stresses in the walls of west elevation of each
of the analyzed objects by 50% to a maximum value 1.13 MPa, which is less than the expected value
of the tensile strength of the concrete.
a)
a)
b)
b)
Fig. 3. The vertical stresses ıyy
of in the east façade of building
4
Fig. 4. The vertical stresses ıyy
of in the west façade of building
SUMMARY
The numerical analysis of a segment of multi-storey building has proved that it can transfer loads caused by
a considerable inclination of the site. The numerical model was calculated in the scope of statics and strength,
taking into account the actual and prognosticated inclination of the building from the perpendicular. These
calculations permitted to prove that there do not occur any tensile stresses in the level of horizontal connections
all over the entire height of the building. The calculations have also shown that the stability of the walls of the
building will also be retained, because the conditions of the load-bearing capacity in the zone of horizontal
connections are maintained. The actual inclination of the building amounting to about 30‰ indicates that using
it is connected with much effort. Practically, the only way of eliminating undue troubles is to ensure
the perpendicularity of the building. The performed analysis has shown that the characteristics of strength
of the building qualify it for carrying out a process of rectification. The process of getting rid of the inclination
of a building, leading to it troublesome utilization has been dealt with by the author of [5].
REFERENCES
[1]
[2]
[3]
[4]
[5]
Kawulok M.: „Ocena wáaĞciwoĞci uĪytkowych budynków z uwagi na oddziaáywania górnicze”.
Wydawnictwo Instytutu Techniki Budowlanej, Warszawa 2000.
Gubrynowicz A., Kawulok M.: „Techniczno-uĪytkowe aspekty wychylenia budynków mieszkalnych
na terenach górniczych”. Ochrona Terenów Górniczych 76/1986.
Praca pt.: Obliczenia statyczno – wytrzymaáoĞciowe budynków znajdujących siĊ w Rudzie ĝląskiej przy
ul. Jankowskiego 16, 16A, 16B, 16C.
Sáowik L.: The computational analysis of the construction effort of the slanting multi – storey bulding.
Proceedings of the 10th International Conference on New Trends in Statics and Dynamics of Buildings,
October 3-5, 2012 Bratislava.
Niemiec T., Gromysz K.: Wybrane problemy prostowania obiektów budowlanych wychylonych z pionu.
BezpieczeĔstwo i ochrona obiektów budowlanych na terenach górniczych. III Konferencja naukowoszkoleniowa, Katowice - UstroĔ Zawodzie, 4-6 paĨdziernika 2010 r.
~ 254 ~
Proceedings of the 11th International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
NUMERICAL ANALYSIS OF THE EFFECT
OF THE UNCERTAINTY OF MECHANICAL PARAMETERS
OF THE SOIL ON THE BEHAVIOUR OF THE MASONRY
STRUCTURE OF A CHURCH SITUATED IN A MINING DISTRICT
M. Wieczorek1
Abstract
The calculated assessment of the effect of continuous changes in the deformation of the soil on untypical
masonry structures requires the application of simplified models of the soil and the building. More accurate
solutions may be found by analyzing the structure by means of a computer. The paper presents the way
and method of such an analysis in the case of a brickwork church constructed 100 years ago. In the analysis
the values of stresses in the walls of the church were compared, depending on the mechanical parameters
of the soil. The results of calculations in the form of maps displaying the distribution of the main stresses
in the walls and vaults coincided well with the areas of damages in the actual structure.
Key Words
numerical analysis, impact of mining activities, masonry construction
1
INTRODUCTION
In areas disposed to deformations of the soil due to mining activities, of essential importance is a qualitative
and quantitative assessment of the influence of these deformations on building structures. Deformations of the
soil are expressed by a series of parameters, mostly taken into account in calculations separately from each other.
The aim of the paper is to present by means of numerical calculations the influence of the forecasted changes in
the configuration of the surface of the territory of mining on the behaviour of a church in Bytom. For the purpose
of the analysis a numerical spatial model of the entire structure and the surrounding soil had to be constructed.
Then the model was solved taking into account the effects of the anticipated activity of the mine. Basing on the
results of calculations conclusions could be drawn concerning possible damages in the consider church.
2
CHARACTERISTICS OF THE BUILDING
The considered more than 100 year-old church was built in the neogothic style with three naves and a choir.
It has two towers with a height of 56 m at its east and a pentagonal presbytery at its west (Fig.1.). It is
a brickwork structure with "Rabitz" vaults (50 mm lime-mortal coating with an addition of flax or hemp fibers,
reinforced with metal grids, strutted on gothic arches and the walls of the naves (figures in the extended version
of the article). This church has been overhauled several times after the appearance of damages caused by
intensive mining activities in the region of Bytom. The first damages occurred already in the sixties of the
previous century. A general overhaul was carried out in the years 1983 - 1988, connected with anchoring the
1
PhD. Eng. Mirosáaw Wieczorek, Silesian Technical University, Faculty of Civil Engineering,
Department of Building Structures, ul. Akademicka 5, 44-100 Gliwice, Poland; miroslaw.wieczorek@polsl.pl
~ 255 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
foundations under the floor by means of steel and reinforced concrete braces in two mutually perpendicular
(orthogonal) directions. The vaults were provided with steel struts on the level of the pillar heads. Mining
operations in the vicinity of the church are, however, still continued. Therefore, further cracking’s in the walls
and vaults must be predicted, deteriorating successively the state of the structure. The deformation of the soil has
be qualified as belonging to the third category, the resistance of the church to the category "0". The technical
state of the church was assessed basing on a detailed survey and by testing the main materials, viz. bricks, mortar
and wood. In the course of this survey traces of repairs of cracking’s in the walls of central nave and the tower
were detected. The repairs consisted in renewing the brickwork or in injecting compositions of resin into the
cracks. The "Rabitz" vaults were reinforced from above by a ribbed coating of epoxy resin. After these repairs
the state of the brick structure was assessed to be satisfying.
Fig. 1. The view of the analyzed building
3
Fig. 2. Numerical model of the whole building
STATICAL ANALYSIS FROM THE VIEWPOINT OF INCLINATION
3.1 DATA ASSUMED IN THE CALCULATIONS
The parameters of the materials were determined basing on technical documentation of the analyzed building.
In the course of these investigations it was found the walls and pillars had been constructed of full bricks with
a compressive strength of fb = 10÷15 MPa on lime mortar with a strength of fb = 0,10 MPa.
The calculations of the structure concerned the following loads:
x dead load - the values characteristic for the dead load were calculated basing on the geometrical
dimensions of the respective elements and taking into account the spatial loads,
x the wind load was determined in compliance with the standard PN-78-02011 as to the situation
of the considered building the site was qualified as belonging to the Zone 1. The period of free
vibrations of the building was calculated and the value of the logarithm of the dumping decrement was
determined, and thus the building was qualified as a nonflexible structure,
x the snow load was determined in compliance with the standard PN-78-02011 as to the situation
of the considered building the site was qualified as belonging to the Zone 1,
x the load resulting from the inclination of the building from the perpendicular.
3.2 DESCRIPTION OF THE CALCULATION METHOD
Every structure positioned in a mining area is exposed to static or dynamic actions (effects) of the soil.
The effects of exploitation, both instantaneous and long-term ones, are generally connected with the geological
configuration of the given region, the levels of ground water, the deposition of strata to be mined or already
exploited and the methods of exploitation, which is of essential importance for the given area of mining. There
are several ways of calculating the deformation of the soil and referring it to the building structure, characterized
by indices of deformation of the site [6, 7, 8], meeting the requirements of construction engineering as
components of the predicted state of displacements of the surface. Basing on [4, 5], the effect of the deformation
of the site on the behaviour of the church was determined by assuming a model of cooperation of the soil with
the building, and according to [1, 2, 3] the dimensions of the assigned soil was assumed as shown in figure
in the extended version of the article. According to [11] the assigned soil in the analyzed model consists of two
strata: quaternary - 62 m (made ground, quicksand, silts, quicksand mixed with gravel and triassic ground - 45 m
(limestone, dolomite, grey silt. Lacking more precise data concerning the geophysical parameters of the soil,
which might permit to map exactly the behaviour of the soil, a score of various ways of calculations have been
considered as presented in table in the extended version of the article
~ 256 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
3.3 THE MODEL OF CALCULATIONS
Due to the complex geometry and the application of various materials characterized by nonlinear properties
and a distinct anisotropy, the model of the structure of the church and the cooperating soil cab solved only
numerically, applying, for instance the method FEM [9, 10]. The solution may be divided into the following
stages: definition solid ground with the object; assumption of the boundary conditions; mapping of the geometry
of the building (Fig. 2); assumption of the characteristic of the material; determination of the effects of steady
and environmental loads; determination of the influence of mining activities - basing on [11], assuming the effect
of the curvature of the site with a radius of R = 6 km, the horizontal deformation of the site E = 6 mm/m
and its inclination amounting to T = 6 mm/m.
3.4 RESULTS OF THE NUMERICAL ANALYSIS
The analysis of calculations of the structure comprised the following combinations of loads:
• Combination No. 1: dead load of the elements plus the steady load of the roof and the load of the wind
and snow,
• Combination No. 2: dead load of the elements plus the steady load of the roof and the load of wind
and snow, as well as the load due to the curvature of the site,
• Combination No. 3: dead load of the elements plus the steady load of the roof and the load of the wind
and snow, as well as the load due to the inclination of the site,
• Combination No. 4: dead load of the elements, the steady load of the roof and the load of wind
and snow, as well as the load caused by the creeping of the site.
a)
b)
c)
d)
Fig. 3. The examples of maps stress obtained for the walls – Model 16 Axis A:
a) Combinatin No. 1, b) Combinatin No. 2, c) Combinatin No. 3, d) Combinatin No. 4
Calculation of the four combinations of presented above were performed for each of the 18 models of the soil.
The stresses in the structure were analyzed for the walls situated along the axes A÷C and 1÷6, as shown
in the figure in the extended version of the article. The examples of maps stress obtained for the walls and vaults
were presented at Fig. 3.
3.5 ANALYSIS OF THE RESULTS
Basing on the obtained maps of stresses, in the walls and vaults, it has been found that:
• the most unfavorable values of stresses were obtained by setting-up the parameters of the load-bearing
capacity of the soil as Model No. 16 (the soil consisting of limestone and sand). The values of stresses
obtained in the case of others arrangements of the strata do not differ by more the 14% from the values
of stresses obtained for even the most unfavorable arrangement of strata in the soil,
• the obtained values of maximum stress indicate that the behaviour of the building structure affected by
mining activities are imposed by the geotechnical parameters of the first layer consisting of sand
~ 257 ~
th
11 International Conference on New Trends in Statics and Dynamics of Buildings
•
•
•
•
4
October 2013, Bratislava
and gravel,
in every calculated model, the most stressed elements of the structure are the walls of the transept
of the church and the coatings of the vaults,
the obtained values of the main stresses (tensile and compressive stresses ı1 and ı2) permit to asses
in percentage the increase of the internal forces in the structure due to the activities of mining,
and to determine the zones in which the occurrence of cracking’s may be predicted in the fields
exceeding the tensile strength of the materials,
the highest tensile stresses were encountered in the vaults in the combination of loads No. 2, as well as
in the walls of the transept in the case of the combination No. 4,
the areas with tensile stresses exceeding the boundary values, obtained among others, coincide with
the areas with existing already damages.
SUMMARY
The applied analysis of the masonry church by means of the FEM, dealt with in this paper, permits merely
a qualitative assessment of the resistance of complicate structure to the influence of prognosticated damages
caused by the activity of mining. The results of calculations in the form of maps illustrating the distribution
of the main stresses permit to predict the areas of probable damages. In order to avail ourselves of the values
of stresses, which would permit to analyze the problem quantitatively we must apply a software which takes into
account the nonlinear material properties of the soil and the masonry, the possibility of degradation
of the parameters of strength of the respective structural elements. Moreover, the parameters assumed
in the calculation programme ought to be determined basing on adequate geophysical investigations.
In spite of the accepted simplified assumptions (among others the line characteristics of the materials,
a simplified geometry of the structure of the building) concerning the considered church, the calculate analysis
displayed a considerable coincidence of the obtained results with the observed damages - the localization
of the zones of boundary tensile stress coincide with the localization of cracking’s in the structure of the church.
REFERENCES
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
Bloodworth A. G.: Three-Dimensional Analysis of Tunneling Effects on Structures to Develop Design
Methods. D. Phil. Thesis. Oxford University Civil Engineering, Department of Engineering Science, 2002.
Bloodworth A. G., Houlsby G. T.: Three Dimmensional Analysis of Building Settlement Caused by Shaft
Construction. Proceedings International Symposium on Geotechnical Aspects of Underground
Construction in Soft Ground, Tokyo, 19-21 July, 1999, pp. 607÷612.
Burd H. J., Houlsby G. T., Augarde C.E., Liu G.: Prediction of Tunnel-Induced Settlement Damage to
Masonry Structures. Proceedings of the ICE, Geotechnical Engineering, vol. 143, 2000, pp. 17÷30.
Fedorowicz L.: Zagadnienia kontaktowe budowla – podáoĪe gruntowe. CzĊĞü I. Kryteria modelowania
i analiz podstawowych zagadnieĔ kontaktowych konstrukcja budowlana – podáoĪe gruntowe. Wyd. Pol.
ĝl., Gliwice 2006.
Fedorowicz J.: Zagadnienia kontaktowe budowla – podáoĪe gruntowe. CzĊĞü II. Kryteria tworzenia i oceny
modeli obliczeniowych ukáadów konstrukcja budowlana – podáoĪe górnicze. Wyd. Pol. ĝl., Gliwice 2008.
Instrukcja 286. Wytyczne projektowania budynków o Ğcianowym ukáadzie noĞnym podlegających
wpáywowi eksploatacji górniczej. Wydawnictwo ITB, Warszawa 1989.
Instrukcja 364/2000. Wymagania techniczne dla obiektów budowlanych wznoszonych na terenach
górniczych. Wydawnictwo ITB, Warszawa 2000.
Instrukcje, Wytyczne, Poradniki 416/2006. Projektowanie budynków na terenach górniczych.
Wydawnictwo ITB, Warszawa 2006.
Krykowski T., Pająk Z.: Analiza dynamiczna murowej konstrukcji koĞcioáa na terenie górniczym. Przegląd
Górniczy 2003 t. 59 nr 7/8, s. 27-32
àodygowski T., Wierszycki M.: Analiza numeryczna ceglanej kopuáy zabytkowego koĞcioáa. InĪynieria
i Budownictwo Nr 7, 2002.
Opinia geologiczno-górnicza nr 39/2012 dla budynku koĞcioáa p.w. Dobrego Pasterza poáoĪonego
w Bytomiu przy ulicy Popieáuszki 4.
PN-81/B-03020 Grunty budowlane. Posadowienie bezpoĞrednie budowli. Obliczenia statyczne
i projektowanie.
ZiĊtkowski L.: Badania rozspajania bloków skalnych i betonowych metodą elektro hydrauliczną.
Rozprawa doktorska. Akademia Górniczo-Hutnicza, Kraków 2007.
~ 258 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
SIMULATING THE NATURAL WIND IN BLWT – WIND TUNNEL
IN LABORATORIES OF STU
D. Zacho1 and O. Hubová2 and P. Lobotka3
Abstract
A boundary layer wind tunnel was built at STU Bratislava in co-operation with Aeronautical Research and Test
Institute (VZLÚ) in Prague for simulation of wind effects on buildings and engineering structures. The
experimental investigations have been performed in Boundary Layer Wind Tunnels (BLWT), where atmospheric
circulation is reproduced. These types of tunnels are differing from the aeronautic ones for their length from
inlet to test section. This is necessary for correctly reproduce the roughness of the earth surface covering
different terrain categories according to EN 1991-1-4. Article deals with the brief description of the preparation
and measuring boundary layer for the urban terrain (terrain category III or IV according EN 1991-1-4), which
is simulated with rough elements and barriers of different heights.
Key Words
Boundary layer, wind tunnel, wind velocity, turbulence intensity, characteristics of atmospheric turbulence near
ground, power spectrum density
1
INTRODUCTION
Boundary layer wind tunnel STU in Bratislava is the wind tunnel with turbulent wind flow according to different
terrain category and possibility laminar flow with wind velocity up to 32m/s for section models. BLWT is
designed with open circuit scheme (see Fig.1) and two test sections.
Test section 8 - with BL simulation will be used for experimental tests to assess the wind-induced pressure field
and pressure coefficients on atypical structures. Using the turn table it is possible to investigate many directions
of incoming wind. In this area it is possible investigate the effects of different directions of incoming wind on
pedestrian comfort by flow visualizations and also dispersion of pollutant.
Boundary layer developing zone 7 - has 14, 35 m length including 2, 5 m long model section.
Test section 6 - with laminar flow will be used for measurements aero-elastic instabilities for the slender
structures with more than fundamental mode and also for the sectional models. The range of stream velocity
varies from 0, 2 to 32 m/s.
1
Mgr. D. Zacho, VZLÚ a.s. Beranových 130, Praha - Letňany, Czech Republic, e-mail: zacho@vzlu.cz
Doc. Ing. O. Hubová, PhD., Slovak University of Technology, Faculty of Civil Engineering, Slovak Republic,
e-mail: olga.hubova@stuba.sk.
3
Ing. P. Lobotka, Slovak University of Technology, Faculty of Civil Engineering, Slovak Republic, e-mail:
peter.lobotka@stuba.sk.
2
~ 259 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
2
October 2013, Bratislava
BOUNDARY LAYER
Simulated boundary layer require the similarity criteria in four basic parameters: profile of mean value of
longitudinal component of velocity vector, profile of turbulence intensity of this component, integral length scale
and power spectral density of vortexes in the air flow. Velocity profiles must be investigated for different
roughness and we are able to obtain information on type and quality of boundary layer. The special devices like
grids or foil (Fig.2) and Counihan vortex generators or 2D barriers are inserted along wind tunnels.
For this purpose an anemometer with heated wire is a proper device, working on the principle of King's cooling
law. CTA (Constant Temperature Anemometry) is used for measuring velocity in a point and continuously
provides information on the velocity in time series. Presently the BLWT tunnel is equipped with Mini CTA
(Fig.3), sufficient for simple experiments.
1
2
3
4
5
dust filter
inlet area
turbulence grid
contractions
area for barriers or Counihan – type elliptic wedge
vortices generators
6 model area for laminar flow (2, 6 x 1, 6)
7 boundary layer developing zone
8 test section (2, 6 x 1, 6)
10 ventilators
11 end diffuser
12 outlet area
Fig. 1. Scheme of BLWT STUBA in Bratislava
Fig.2. a) Typical arrangement of simulation hardware (in mm)
3
b) arrangement in BLWT STU
BASIC DESIGN CHARACTERISTICS OF BOUNDARY LAYER
For the experimental measurements in BLWT it is necessary to design the laboratory simulation of atmospheric
boundary layer for different terrain categories. The basic characteristic descriptors - mean wind velocity,
fluctuating parts of the wind velocity (in x, y and z directions), turbulence intensity, turbulence integral scale are
depended on regional roughness. Analyses of the design characteristics according to different authors and codes
and experimental measurements give us information for modeling wind flow according to EN 1991-1-4.
~ 260 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
3.1 Mean wind velocity
The vertical line of the mean wind velocity by the neutral air flow should be defined by logarithmic law (1).
v m ( z ) = (u ∗ / κ ) ⋅ ln ( z / z 0 )
(1)
u∗ = τ 0 / ρ is frictional speed
where
τ0
is shear stress at the ground,
ρ
is air density
κ = 0, 4 von Kármán coefficient
We can find roughness length z0 for the different
terrain types using experimental measurements near
ground in the atmospheric surface layer (ASL).
z 0 - is parameter, which describes logarithmic law
profile of the mean wind velocity above different
roughness of the terrain, (height of extrapolation to
the mean wind = 0).
The results of the experimental measurements in the
preparation of boundary layer are shown in Fig. 4.
Fig.3. Mini CTA for experimental measurements in BLWT STU
The mean wind velocity due to EN 1994-1-4 depends on terrain roughness and is defined up to 200 m by
logarithmic law:
vm ( z ) = cr ( z ) ⋅ co ( z ) ⋅ v b = k r ⋅ ln( z / z 0 ) ⋅1 ⋅ v ref
vref
where
(2)
is basic wind velocity at the height 10m above terrain FUR (Flat Uniformly Rough – Terrain II)
c r ( z ) = k r ln( z / z 0 )
k r = 0,19 ⋅ ( z 0 / z 0, II )
for z min ≤ z ≤ z max
is the roughness factor
0 , 07
(3)
is terrain factor, depends on the roughness length z 0 :
z 0 is roughness length, z min is minimum height, z max is 200 m.
c o ( z ) is orography factor
z 0, II = 0,05 m (for ter. Cat. II), z 0 = 0,3 m (for ter. Cat. III), z 0 = 1 m (for ter. Cat. IV)
EN 1991-1-4 Mean wind velocity
Mean wind velocity
1,00
1,2
0,90
1
0,80
0,8
0,70
B = 150 m m , f = 18 Hz
0,60
z/zG
z/zG
B = 150m m , f= 26Hz
B = 200m m , f= 18 Hz
0,6
B= 200m m , f= 26 Hz
Terrain III
0,50
Terrain IV
0,40
0,4
0,30
0,20
0,2
0,10
0
0
0,5
1
1,5
2
0,00
0,00
vm /vre f
Fig.4. Experimental measurement of the vm ( z )
for different barriers and wind velocity
3.2
0,50
1,00
1,50
2,00
v m /v re f
Fig.5. vm ( z ) as a function of height and terrain category
according to EN 1991-1-4
Turbulence intensity
The turbulence intensity I v,i (z ) is defined as the standard deviation of the turbulence divided by mean wind
velocity in different directions (x, y and z). The turbulence intensity was developed using micro-meteorological
measurement by different researchers (Kaimal, Busch, Panofsky). The rules for determination of I v,i ( z ) without
thermal effects are given in expression (4).
~ 261 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
I v,i ( z ) =
October 2013, Bratislava
σi (z)
Ai
κ ⋅ (σ i / u∗)
=
=
vm ( z ) ln( z / z 0 )
ln( z / z 0 )
(4)
For longitudinal component Ai = 1, for crosswind part Ai = 0, 8 and for vertical part Ai = 0, 5.
In general the longitudinal turbulent component is the most significant one with respect to the response of
a structure.
The experimental measurements of distribution turbulence intensity in boundary layer are shown in Fig.6.
The similar distribution for along wind turbulence intensity is given in EN 1994-1-4 (see Fig.7).
σ ( z)
kI
1
=
=
(5)
I v (z ) = v
vm ( z ) c o (z) ⋅ ln ( z / z 0 ) c o (z) ⋅ ln ( z / z 0 )
EN 1991-1-4 Turbulence intensity
1,00
0,90
&'*ͬƐ+
**
0,80
&'
*ͬƐ+
**
0,70
z /z G
&'*ͬƐ+**
&'
*ͬƐ+**
#$#% 0,60
Terrain III
0,50
Terrain IV
0,40
0,30
0,20
0,10
0,00
0,00
10,00
20,00
30,00
40,00
50,00
Iv %
!"
Fig.6. Experimental measurement of the I v (z )
for different barriers and wind velocity
4
Fig.7. Turbulence intensity profiles for different terrain
categories according to EN
CONCLUSION
The paper shows that detailed measurements of the wind action, especially near the ground, help us to prepare
boundary layer in BLWT according to EN 1991-1-4. It is necessary to compare various measurements with
different roughness of terrain and to choose optimal parameters for model tests in wind tunnel. By comparing the
velocity and turbulence of the surface layer we can choose and classify terrain roughness between the III and IV
according to EN standards, which corresponds to the roughness of terrain in Bratislava.
The basic design characteristics of the boundary layer, i.e. components of the time and height dependent wind
velocity vector, give us roughness length z 0 , turbulence length scales Lv (z ) and power spectral density
function S v (n) . For higher structures models it is necessary to prepare fully developed boundary layer with
gradient height zG = 0.5 - 1.5 m and scale M = 1:200-1:600. Experimental measurements in BLWT STU so far
have ensured height of boundary layer about 1.05 m.
ACKNOWLEDGEMENTS
This paper has been supported by Grand Agency VEGA of the Slovak Republic (grant. reg. No. 1/0480/13).
REFERENCES
[1] EN 1991-1-4 Eurocode 1: Actions on structures-Part 1-4: General actions-Wind actions 2005
[2] Pirner, M. - Fischer, O.: Zatížení staveb větrem, vydalo ČKAIT Praha 2003, ISBN 80-86769-10-0.
[3] Jirsák, M. - Hora, A. - KRÁL, J.: Větrný tunel VZLÚ/KÚ ČVUT pro modelové zkoušky staveb. Letecký
zpravodaj č.1, 8-15 VZLÚ 1997.
[4] ACSE Manuals and Reports on Engineering Practice, no.67. Wind Tunnel studies of buildings and
structures. Aerospace Division of the American Society of Civil Engineers. Preklad Jirsák, M. : Studie
budov a konstrukcí ve vetrných tunelech., ČKAIT Praha, 2009, ISBN 978-80-87093-87-0
[5] Jirsák M. - Král J.: A new wind tunnel VZLÚ/KÚ for wind engineering, EECWE' 94 paper, Warszaw
1994.
[6] Wieringa, J.: Representative Roughness Parameters for Homogeneous Terrain. Boundary Layer
Meteorology, 63, 323-363, 1993.
~ 262 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
GALERKINS METHOD APPLIED IN CALCULATIONS OF BAR
SYSTEMS ACCORDING TO THE SECOND ORDER THEORY
J. Zamorowski1
Abstract
The paper presents Galerkin’s variation method which is applied for the purpose of solving differential equations of the equilibrium of an ideal bar according to the second order theory, as quoted by Březina [1]. These
equations are nonlinear both in the case of bending them in two planes and in the case of torsion. If compared
with equations of the theory of the first order, these equation contain additional factors (the so-called factors of
the second order), being the result of the effect of internal forces on the deformations, which may be determined
as additional loads 2]. Generally, on this stage of calculations, basing on the increments in the i-1 step, the i-th
values of additional loads can be calculated, and basing on those also the i-th increments of disp1acements. The
process presented above, concerning the iterative solution of the equations of the equilibrium of the bar, has
been illustrated by calculations of a freely supported flat bar, affected by external and additional loads.
Key Words
Galerkin’s method, twisted bar, second order theory.
1
WSTĘP
Podstawowe wzory metody przemieszczeń (tzn. wzory na momenty wyjściowe i wzory transformacyjne) dla
pręta idealnego wg teorii II rzędu można uzyskać z różniczkowych równań równowagi odkształconego pręta dla
zginania w płaszczyznach głównych i skręcania podanych w pracy Březiny [1]. Przy oznaczeniach jak w [1]
mają one postać
[
]
+ [N (η − a θ )] + ( M θ )
'
EJ yξ IV + N (ξ ' + a yθ ' ) + ( M xθ ) '' = q x ,
EJ xη IV
[
' '
'
x
y
''
= qy ,
]
(1)
'
EJ ωθ IV − GJ d θ '' + (r 2 N − 2b y M x + 2bx M y − 2bω B)θ ' + a y ( Nξ ' ) ' − a x ( Nη ' ) '
[
]
− M 'y' η + M xη '' − M x'' ξ + M xξ '' + q x [η + (e x − a x )θ ] − q y ξ − (e y − a y )θ = mk
oraz
M y = EJ yξ '' , M x = EJ xη '' , B = − EJ ωθ '' .
(1a)
Równania te stanowią uogólnienie równań stateczności Własowa [2]. W tych równaniach po lewej stronie występują dodatkowe składniki zawierające tzw. efekty II rzędu. Są one wynikiem działania sił wewnętrznych na
1
Jan Zamorowski Ph.D, Silesian University of Technology in Gliwice, Faculty of Civil Engineering, Poland,
44-100 Gliwice, ul. Akademicka 5, e-mail: zamski@interia.pl
~ 263 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
odkształceniach. W [2] określa się je jako obciążenia dodatkowe (q x , q y , m ). Można w nich wyróżnić składniki
jednofunkcyjne (zwane dalej liniowymi) oraz dwufunkcyjne (nieliniowe). Składniki jednofunkcyjne są zależne
od przemieszczeń jednego z trzech stanów równowagi (zginania w dwóch płaszczyznach i skręcania), składniki
dwufunkcyjne (nieliniowe) są zależne od iloczynu przemieszczeń i momentów zginających dwóch z trzech stanów równowagi. Można dokonać dalszego podziału składników jednofunkcyjnych: na zależne tylko od przemieszczeń rozpatrywanego stanu równowagi (liniowe 1) oraz na zależne od przemieszczeń pozostałych dwóch
stanów równowagi (liniowe 2).
Rozwiązanie równań (1) jest uciążliwe. Z tego względu w znanych z literatury rozwiązaniach wg teorii II rzędu
[3-8] najczęściej uwzględnia się tylko składniki z siłą osiową i pochodnymi przemieszczeń. Rozwiązania te są
jednak poszerzone o wpływy wstępnego wygięcia prętów [3-7] oraz wstępnego wygięcia i ścinania – np. [8].
W referacie zamieszczono rozwiązanie równań (1) wariacyjną metodą Galerkina. Wyrażając przemieszczenia
przez szeregi trygonometryczne przedstawiono wzory na obciążenia dodatkowe – liniowe i nieliniowe. Sprawdzono poprawność iteracyjnego sposobu rozwiązania pojedynczego równania dla przypadku pręta ściskanego
obciążonego poprzecznie. Ograniczono przy tym efekty II rzędu do dodatkowego składnika w postaci iloczynu
siły osiowej i pochodnej przemieszczenia, gdyż dla takiego przypadku można było łatwo uzyskać również rozwiązanie dokładne. Następnie przedstawiono wariacyjną metodę Galerkina do rozwiązania układu równań (1)
z liniowymi i nieliniowymi obciążeniami dodatkowymi. W celu wyznaczenia współczynników kanonicznego
układu równań Galerkina korzystano z szeregów trygonometrycznych.
2
ROZWIĄZANIE
Jako podstawę przybliżonego rozwiązania pręta wg teorii II rzędu przyjęto trzy niezależne od siebie równania
wg teorii I rzędu – na zginanie w płaszczyznach głównych i skręcanie. Przy oznaczeniach jak w pracy [1] równania te mają postać
EJ y ξ IV = q x , EJ xη IV = q y , EJ ωθ IV − GJ d = m.
(1b)
Wartości przemieszczeń i sił wewnętrznych od obciążeń zewnętrznych qx, qy, m obliczone z równań (1b) stanowią
wielkości wyjściowe (0) do obliczeń pierwszych (1) wartości dodatkowych obciążeń. Od tych obciążeń z trzech
równań I rzędu oblicza się pierwsze przyrosty przemieszczeń (ugięć i kąta skręcania), które stanowią podstawę do
obliczeń drugich (2) wartości dodatkowych obciążeń, a te z kolei do drugich przyrostów przemieszczeń itd. Ogólnie w i-tym kroku obliczeniowym wyznacza się, na podstawie przyrostów przemieszczeń z i–1 kroku, i-te wartości
dodatkowych obciążeń, a na ich podstawie i-te przyrosty przemieszczeń. W przypadku obciążeń przyrostowych
obciążenie wyjściowe (0) w poszczególnych krokach stanowią przyrosty obciążeń zewnętrznych – w tym przyrosty
siły osiowej ΔN k .
Przykładowo dla pręta zginanego w płaszczyźnie x − z , przy założeniu stałej wartości siły osiowej na długości
pręta i oznaczeniach jak w [1], na dodatkowe obciążenie otrzymuje się wzór (porównaj (1))
[
]
'
'
q x = − N (ξ + a yθ ) ' − ( M xθ ) ' ' = − N ξ '' − a y N θ '' − M x' 'θ + 2 M x' θ ' + M xθ ' ' .
(2)
Wyrażając przemieszczenia przez szeregi trygonometryczne
ξ = ∑ ξ n sin
nπz
nπz
, η = ∑η n sin
,
l
l
θ = ∑ θ n sin
nπz
l
(2a)
oraz uwzględniając, że M x = − EJ xη ' ' , otrzymuje się
2
2
2
nπ z
nπ z
nπ z
nπ z
⎛ nπ ⎞
⎛ nπ ⎞
⎛ nπ ⎞
qx = N ∑ξn ⎜
+ a y N ∑θ n ⎜
+ EJ x ∑η n ⎜
⋅ ∑ θ n sin
⎟ sin
⎟ sin
⎟ sin
l
l
l
l
⎝ l ⎠
⎝ l ⎠
⎝ l ⎠
n
n
n
n
(2b)
3
2
2
nπ z
nπ z
nπ z ⎛⎜
nπ z ⎞⎟
⎛ nπ ⎞
⎛ nπ ⎞
⎛ nπ ⎞
⎛ nπ ⎞
,
+ 2 EJ x ∑η n ⎜
⋅ ∑θ n ⎜
+ EJ x ∑η n ⎜
⋅ − ∑θ n ⎜
⎟ cos
⎟ cos
⎟ sin
⎟ sin
l
l
l ⎜⎝ n ⎝ l ⎠
l ⎟⎠
⎝ l ⎠
⎝ l ⎠
⎝ l ⎠
n
n
n
Korzystając z równań (1), w podobny sposób można zapisać wyrażenia na dodatkowe obciążenia dla zginania
w drugim kierunku ( q y ) i skręcania (m ).
~ 264 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Przyjmuje się, że znane są wartości początkowe (0) przemieszczeń i sił przekrojowych z rozwiązania równań I
rzędu – zginania w płaszczyznach głównych i skręcania (patrz wzory (1)) – ze względu na obciążenie zewnętrzne wyrażone w formie szeregów trygonometrycznych, co pozwala obliczyć pierwsze wartości obciążeń dodatkowych q x1 , q 1y , m 1 ze wzoru (2b) i analogicznych do niego dla i = 1.
W kolejnych (i-tych) krokach obliczeniowych rozwiązuje się równania
EJ y (ξ i ) IV − q xi = 0,
EJ x (η i ) IV − q yi = 0,
EJ ω (θ i ) IV − GJ d (θ i ) '' − m i = 0.
(3)
Do ich rozwiązania można zastosować metodę wariacyjną Galerkina, którą przedstawiono niżej na przykładzie
pierwszego (1) kroku obliczeniowego zginania w płaszczyźnie x − z , któremu odpowiada równanie
EJ y (ξ 1 ) IV − q x1 = 0.
(4)
W celu rozwiązania tego równania przyjmuje się funkcję ξ 1 w postaci szeregu
ξ 1 = ∑ aiϕ i ( z ) dla i = 1, 2, ..., n
(4a)
i wymaga, aby lewa strona równania (4) była ortogonalna względem wszystkich funkcji tego szeregu
IV
~1
∫ (EJ y ∑ aiϕi − q x )ϕ k dz = 0 dla i, k = 1, 2,..., n.
(4b)
l
Rozwijając sumę pod całką i wprowadzając oznaczenia
δ ik = ∫ EJ yϕiIV ϕ k dz,
l
Δ q, k = ∫ q~x1ϕ k dz,
(4c)
l
otrzymuje się tzw. kanoniczny układ równań Galerkina ze względu na współczynniki ai
a1δ11 + a2δ 21 + a3δ 31 + ..... = Δ q,1
a1δ12 + a2δ 22 + a3δ 32 + ..... = Δ q, 2
a1δ13 + a2δ 23 + a3δ 33 + ..... = Δ q,3
(4d)
...
W przypadku ortogonalnych funkcji ϕi i ich parzystych pochodnych δ ik = 0 dla i ≠ k w miejsce układu (4d)
otrzymuje się układ równań niezależnych
a1δ11 = Δ q,1
a2δ 22 = Δ q ,2
a3δ 33 = Δ q,3
(4e)
...,
gdzie δ kk = ∫
EJ yϕ kIV ϕ k dz.
l
Zgodnie ze wzorem (4a) można zapisać
ξ 1 = ∑ ak ϕ k ( z ), gdzie a k = Δ q , k δ kk .
(4f)
1
Przyjmując funkcję ξ w postaci szeregu trygonometrycznego ϕk ( z ) = sin kπz l , otrzymuje się
4
4
kπ z
kπ z
⎛ kπ ⎞
⎛ kπ ⎞ l
2 kπ z
1
dz = EJ y ⎜
dz , ξ 1 = ∑ a k sin
.
⎟ sin
⎟ , Δ q ,k = ∫ q x sin
l
l
l
⎝ l ⎠
⎝ l ⎠ 2
l
δ kk = ∫ EJ y ⎜
l
(4g)
Wyraz wolny Δ q,k należy obliczyć wg wzoru (4g) dla wszystkich składników dodatkowego obciążenia q x1 −
dwóch liniowych i trzech nieliniowych ze względu na funkcje trygonometryczne – jak we wzorze (8c) w pełnej
wersji referatu. Przykładowo dla
~ 265 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
2
q x1 = ∑ aξ0, n sin
n
nπ z
⎛ nπ ⎞ 0
, gdzie aξ0, n = N ⎜
⎟ ξn
l
⎝ l ⎠
(5)
otrzymuje się
2
Δ q , k = ∫ ∑ aξ0, n sin
l n
kπ z
kπ z
l
⎛ kπ ⎞ l 0
dz =aξ0, k ⋅ = N ⎜
⋅ sin
⎟ ξk .
l
l
2
⎝ l ⎠ 2
(5a)
W przypadku składnika nieliniowego
4
iπ z
jπ z
⎛ iπ ⎞
⋅ ∑ θ 0j sin
, gdzie aη0, i = EJ x ⎜ ⎟ ηi0
l
l
⎝ l ⎠
j
⎛
iπ z
jπ z ⎞
kπ z
⎟ sin
dz.
= ∫ ⎜⎜ ∑ aη0,i sin
⋅ ∑ θ 0j sin
⎟
l
l ⎠
l
j
l⎝ i
q x1 = ∑ aη0,i sin
i
Δ q, k
(5b)
(5c)
Dla drugiego składnika nieliniowego
3
q x1 = ∑ bη0,i cos
i
3
iπ z
jπ z
⎛ iπ ⎞
⎛ jπ ⎞ 0
⋅ ∑ bθ0, j cos
, gdzie bη0,i = 2 EJ x ⎜ ⎟ ηi0 , bθ0, j = ⎜
⎟θ j
l
l
l
⎝ l ⎠
⎝ ⎠
j
⎛
iπ z
jπ z ⎞
kπ z
⎟ sin
Δ q, k = ∫ ⎜⎜ ∑ bη0,i cos
⋅ ∑ bθ0, j cos
dz.
⎟
l
l
l
j
l⎝ i
⎠
(6)
(6a)
UWAGI KOŃCOWE
Przedstawione rozwiązanie można wykorzystać w przypadku modelu obliczeniowego pręta z dodatkowymi
obciążeniami liniowymi i nieliniowymi. W rozwiązaniu można uwzględniać wszystkie składniki II rzędu, lub
tylko wybrane z uwagi na oczekiwaną dokładność. Rozwiązanie to można wykorzystać również w przypadku
przyrostowego narastania obciążeń. W porównaniu z innymi rozwiązaniami, np. [9] konieczna jest dodatkowa
iteracja związana z koncepcją dodatkowych obciążeń. Z kolei, zaletą tego rozwiązania jest dokładniejszy opis
przestrzennego zachowania się pręta. W praktycznym zastosowaniu rozwiązanie to należy jednak uzupełnić
jeszcze o wpływ wstępnych imperfekcji geometrycznych.
LITERATURA
[1] Březina V.: Stateczność prętów konstrukcji metalowych. Arkady, Warszawa 1966.
[2] Własow W.Z.: Tonkostiennyje uprugije stieržni. Gos. Izd. Fiziko-Matematiczeskoj Literatury, Moskwa
1959.
[3] Bródka J., Cwalina W.: Sztywność i nośność ram stężonych o węzłach podatnych. Wydawnictwo Politechniki Białostockiej, Białystok 1998.
[4] Chen W.F., Lui E.M.: Stability Design of Steel Frames. CRC Press, Boca Raton 1991.
[5] Pałkowski Sz.: Podstawy stateczności konstrukcji prętowych. Politechnika Koszalińska, Koszalin 1999.
[6] Pałkowski Sz.: Konstrukcje stalowe. Wybrane zagadnienia obliczania i projektowania. PWN, Warszawa
2001.
[7] Rykaluk K.: Zagadnienia stateczności konstrukcji metalowych. Dolnośląskie Wydawnictwo Edukacyjne,
Wrocław 2012.
[8] Zamorowski J.: Analiza ustrojów prętowych i cięgnowych w ujęciu geometrycznie nieliniowym. Sympozjum „Projektowanie koncepcyjne – kształtowanie konstrukcji. Konstrukcje z blach fałdowych. Konstrukcje cięgnowe”, Rzeszów 2000, s. 107-120.
[9] Zamorowski J.: Przestrzenne konstrukcje prętowe z geometrycznymi imperfekcjami i podatnymi węzłami.
Wydawnictwo Politechniki Śląskiej, Gliwice, 2013.
~ 266 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
NUMERICAL INVESTIGATIONS OF A SEQUENTIALLY
LOADED FLAT FRAME WITH FLEXIBLE NODES
J. Zamorowski1 and L. Niewiadomski2
Abstract
The present paper deals with tests of frame systems constructed of rolled form sections, joined in the nodes by
blind bolts of the type BOM-R16.6, basing on results of experimental tests of such connections [1], concerning
alternating loads. The calculations were carried out making use of the author’s computer programme based on
a calculation model [2]. Eight different histories of loading were considered, viz. dead load, snow and alternatively affected by the wind. The calculations concern a system without any curved initial imperfections, as well
as those with such imperfections. Thus, differences were obtained in the values of the bending moment in the
spandrel beam of the frame at various sequences of the wind load, reaching up to 20 % in comparison with the
results obtained in the case of simultaneously exerted loads. The history of loading has been found to be probably an essential factor in designing bar structure consisting of thin-walled elements, connected by lap joints.
Key Words
Flexible nodes, alternating loads, sequentially loads.
1
WSTĘP
W dostępnej literaturze technicznej, np. [3, 4], znane są wyniki badań doświadczalnych i numerycznych
różnego typu ram z podatnymi węzłami przy określonych kombinacjach obciążeń. Brak jest natomiast takich
badań przy obciążeniach zadawanych sekwencyjnie jedno po drugim. Jest to spowodowane tym, że w dostępnych inżynierskich programach komputerowych nie można zmieniać podatnościowych charakterystyk węzłów
wg pętli histerezy i zadawać obciążenia sekwencyjnie. W pracy [1] przedstawiono model obliczeniowy przestrzennych konstrukcji prętowych z geometrycznymi imperfekcjami (przechyłowymi, łukowymi i mimośrodami
w połączeniach prętów w węzłach) oraz podatnymi węzłami, w ujęciu przyrostowym wg teorii II rzędu. W modelu tym ujęto możliwość obliczania układów obciążanych sekwencyjnie z charakterystykami podatnościowymi
węzłów M − φ i N − δ zmieniającymi się według pętli histerezy. W rozwiązaniu wstępnie zdeformowanego
(giętnie i skrętnie) pręta uwzględniono wpływy: ściskania i sił poprzecznych na giętną deformację pręta, zginania na sztywność osiową, przemieszczeń prostopadłych do osi pręta na wartość siły osiowej i kosinusów kierunkowych oraz zmiany nachylenia cięciwy pręta na wartości sił poprzecznych. Korzystając z tego rozwiązania
opracowano autorski program komputerowy, za pomocą którego można przeanalizować płaską ramę z podatnymi na obrót i przesuw węzłami. Program ten wykorzystano do analizy układu poprzecznego hali zaprojektowanego z kształtowników giętych, obciążonego sekwencyjnie ciężarem własnym, śniegiem i wiatrem.
1
2
Jan Zamorowski Ph.D, Silesian University of Technology in Gliwice, Faculty of Civil Engineering, Poland,
44-100 Gliwice, ul. Akademicka 5, e-mail: Zamski@interia.pl
Lesław Niewiadomski Ph.D, Silesian University of Technology in Gliwice, Faculty of Civil Engineering,
Poland, 44-100 Gliwice, ul. Akademicka 5, e-mail: lesław.niewiadomski@polsl.pl
~ 267 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
2
October 2013, Bratislava
ANALIZA UKŁADU POPRZECZNEGO HALI
Analizie poddano jednonawową ramę stalową o rozpiętości 12,0 m i wysokości w kalenicy 5,1 m – patrz rys. 1.
Rys. 1. Charakterystyki ramy
Fig. 1. Characteristics of the frame
Założono, że rama będzie wykonana z kształtowników giętych z blach, łączonych w węzłach za pomocą sworzni
jednostronnych BOM-R16-6. Przyjęto, że słupy będą kotwione za pośrednictwem krótkich elementów z 2 ceowników 200x50x5 osadzonych w fundamentach (patrz rys. 2c w pełnej wersji referatu). W połączeniach ceowników (rygla i elementów kotwiących) ze słupami założono po 5 sworzni z każdej strony słupa, przyjmując, że 4
sworznie będą oddalone o 77,8 mm od punktu chwilowego obrotu, a piąty sworzeń będzie usytuowany w tym
punkcie (patrz rys. 2a i c w pełnej wersji referatu). W stykach ściągu i rygla ramy przyjęto po 2 sworznie dla
każdego ceownika. W obliczeniach uwzględniono podatność węzłów na obrót (węzły 2, 3, 8 i 9) oraz na przesuw (węzły 2, 4, 5 i 8), przyjmując zależności M − φ i N − δ w postaci pętli histerezy (patrz rys. 3 w pełnej
wersji referatu). Założono przy tym, że ściąg rygla ramy połączony jest przegubowo z ryglem.
Pełna pętla histerezy pojawia się tylko w zginanych węzłach dolnych przy obciążeniu układu poprzecznego
ciężarem własnym i przemiennie działającym wiatrem.
Krzywe I i III pętli w połączeniach zginanych określono na podstawie wyników badań zawartych w pracy [1] na
rys. 8.4, przyjmując je w postaci odwrotnej funkcji Chena-Kishiego.
φ=
M
1
1,569 ⎤ 1,569
⎡ ⎛ M ⎞
1088 ⋅ ⎢1 − ⎜
⎟
⎢⎣ ⎝ 19,584 ⎠
, φ = φ2 +
M
1
,
(1)
⎡ ⎛ − M ⎞1,569 ⎤ 1,569
⎥
1088 ⋅ ⎢1 − ⎜⎜
⎟⎟
⎢⎣ ⎝ 19,584 ⎠
⎥⎦
⎥
⎥⎦
Uzyskane wyniki dla jednego połączenia (ceownika z rurą) przedstawiono na rys. 4 w pełnej wersji referatu. Dla
obustronnego styku wartość kąta obrotu zmniejszono o połowę.
Proste II i IV dla jednostronnego połączenia opisano równaniami
φ=
M − M1
M − M3
+ φ1 oraz φ =
+ φ3 .
1088
1088
(2)
Krzywe I’ i III’, z uwagi na mały zakres wartości kątów obrotu i związaną z tym znikomą różnicę między
sztywnością początkową a sieczną (patrz rys. 5 w pełnej wersji referatu), przyjęto w postaci linii prostych łączących odpowiednio punkty 4 i 1 oraz 3 i 2 (patrz rys. 3b w pełnej wersji referatu).
~ 268 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
W przypadku zależności N − δ równania krzywych I i III dla jednego łącznika w węźle przyjęto w postaci
N
δ=
⎡ ⎛ N ⎞
100000 ⋅ ⎢1 − ⎜
⎟
⎢⎣ ⎝ 200 ⎠
1
0,55 ⎤ 0,55
,
N
δ = δ2 +
⎡ ⎛−N ⎞
100000 ⋅ ⎢1 − ⎜
⎟
⎢⎣ ⎝ 200 ⎠
⎥
⎥⎦
1
0,55 ⎤ 0,55
(3)
.
⎥
⎥⎦
Tak obliczone przesunięcia δ w dolnych węzłach słupa redukowano dziesięciokrotnie (10 sworzni), a w węzłach
ściągu – czterokrotnie (4 sworznie). Podobnie jak w przypadku zależności M − φ krzywe I’ i III’ zastąpiono
prostymi.
W obliczeniach uwzględniono różne kombinacje obciążeń ciężarem własnym, śniegiem i przemiennie działającym wiatrem (ze współczynnikiem ψ0 = 0,6), o charakterystycznych wartościach jak na rys. 1, wprowadzając
obciążenia sekwencyjnie w różnej kolejności – patrz tablica 1. W tablicy przyjęto oznaczenia: G – obciążenie
stałe, S – obciążenie śniegiem, W – wpływ wiatru, 1(2,3)f – pierwsza (druga, trzecia) faza.
Nr
1
1
2
3
4
5
6
7
8
Obciążenia sumaryczne
2
G+S+W(1f)1)
G
G+S
G
G
G
G
G
Obciążenia dodawane kolejno
do stanu poprzedniego
3
W (2 cykle, 1f)
W(1f)
S, W(1f)
S, W(1f, 2f, 3f)
S, W(1 cykl i 1f)
S, W(1 cykl i 1f, 2f, 3f)
S, W(2 cykle i 1f)
Tab. 1. Historia obciążeń
Obliczenia wykonano dla układu bez wstępnych imperfekcji łukowych oraz z tymi imperfekcjami (l/200)
w elementach ściskanych. Wybrane wyniki obliczeń zestawiono w tablicach 2 i 3 dla układu ze wstępnymi wygięciami prętów.
Opis
Wielkości
1
2
uy3 [mm]
uy9 [mm]
uz6 [mm]
M2 [kNm]
M3 [kNm]
σmax [MPa]
M8 [kNm]
M9 [kNm]
σmax [MPa]
M4 [kNm]
M6 [kNm]
σmax [MPa]
M5 [kNm]
Ml/2 [kNm]
Nl/2 [kN]
Przemieszczenia
Pręt 1
Pręt 2
Pręt 4
Pręt 5
1(bpw)
3
–0,617
14,33
77,92
16,30
–37,61
267,9
28,44
–41,11
292,1
24,31
0,879
222,5
22,53
*)
*)
1
4
10,47
39,29
154,6
3,428
–27,98
201,9
16,27
–31,30
224,8
35,25
16,23
293,0
33,59
35,99
143,7
Historia obciążenia
3
4
5
5
6
7
7,172
7,18 –30,81
36,60
36,39 –0,881
157,6
156,5
159,6
3,509
3,553
14,76
–26,99 –27,14 –31,41
195,1
196,2
225,7
15,79
15,80
3,778
–31,29 –31,47 –26,19
224,8
226,1
189,6
36,07
35,87
34,04
16,63
16,48
16,90
298,9
297,4
285,2
33,89
33,67
36,69
41,60
41,38
43,00
143,9
143,5
144,4
6,8
8
2,966
32,78
159,6
3,623
–26,30
190,4
14,94
–31,32
225,0
36,62
16,89
302,9
34,08
41,90
144,5
Tab. 2. Wyniki obliczeń ramy z podatnymi na obrót i przesuw węzłami z uwzględnieniem f 0
~ 269 ~
9
9
10,16
38,84
153,9
3,542
–28,12
202,9
16,23
–31,42
225,7
35,12
16,15
292,0
33,47
37,47
143,3
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Wykorzystane w tablicach oznaczenia prętów i węzłów przedstawiono na rys. 1. W kolumnie 2 tablicy 2 zamieszczono opis przedstawianych wielkości, to jest: poziomych przesunięć węzłów 3 i 9, ugięcia węzła w kalenicy, momentów przywęzłowych (ze wskaźnikiem opisującym węzeł), maksymalnych naprężeń w pręcie uzyskanych ze wzorów wytrzymałościowych oraz momentu zginającego i siły osiowej w środku rozpiętości pręta 5.
W kolejnych kolumnach tablicy (od 4 do 9) zamieszczono wyniki obliczeń otrzymane dla obciążenia wprowadzanego sekwencyjnie zgodnie z opisem historii wg tablicy 1. W kolumnie 3 tablicy zamieszczono wyniki obliczeń dla układu bez podatnych węzłów (bpw), przy obciążeniach działających jednocześnie.
W tablicy 3 w kolumnie 6, porównano wartości sił wewnętrznych i naprężeń uzyskane dla obciążeń zadawanych
w kolejności zgodnej z historią, z typowymi wynikami, jakie otrzymuje się podczas projektowania obiektów, to
jest przy jednoczesnym działaniu wszystkich obciążeń w kombinacji. Różnice te w ramie ze wstępnie wygiętymi
prętami w przypadku ugięcia węzła kalenicowego przekraczają 3%, w przypadku wytężenia słupów wynoszą
około 0,6%, a w przypadku momentu zginającego w ryglu ramy sięgają aż 20%.
Historia obciążeń
Opis wielkości
1
Max(uy3, uy9) [mm]
uz6 [mm]
Ext(M3, M9) [kNm]
Ext(M2, M8) [kNm]
Max(σ1, σ2) [MPa]
Max(M4, M5) [kNm]
M5,l/2, max [kNm]
N5,l/2, max [kNm]
1(bpw)
1
Od 3
do 9
2
14,33
77,92
–41,11
28,44
292,1
24,31
3
39,29
154,6
–31,30
16,27
224,8
35,25
35,99
143,7
4
38,84
159,6
–31,47
16,23
226,1
36,69
43,00
144,5
Procentowe różnice
(3) − (2)
(4) − (3)
⋅100%
⋅100%
( 2)
(3)
5
6
174,2
–1,15
98,4
3,23
–23,9
0,54
–42,8
–0,25
–23,0
0,58
45,0
4,09
19,5
0,6
Tab. 3. Procentowe różnice ekstremalnych wartości przemieszczeń, sił wewnętrznych i naprężeń
w ramie ze wstępnymi wygięciami prętów
W kolumnie 5 tablicy 3 przedstawiono procentowe różnice wartości uzyskanych dla układów z podatnymi
i sztywnymi węzłami, obciążonych równocześnie ciężarem stałym, śniegiem i wiatrem. Różnice te w ramie
z imperfekcjami łukowymi w przypadku przemieszczeń poziomych wynoszą około 174%, a pionowych 98%.
Wytężenie słupów w ramie z podatnymi węzłami jest mniejsze o około 24%, a moment zginający w ryglu jest
większy o około 45% – patrz kolumna 5 w tablicy 3.
3 UWAGI KOŃCOWE
Na podstawie przedstawionych wyników obliczeń prostego układu poprzecznego można wnioskować, że historia obciążenia może być istotnym czynnikiem w projektowaniu układów prętowych. Wskazują na to różnice
w wartościach sił wewnętrznych i przemieszczeń uzyskanych przy obciążeniach sumarycznych i wprowadzanych sekwencyjnie w różnej kolejności. Są to jednak pierwsze wyniki i wymagają potwierdzenia w numerycznej
analizie różnorodnych obiektów.
LITERATURA
[1]
Wuwer W.: Podatne połączenia na sworznie jednostronne w prętowych konstrukcjach cienkościennych.
Zeszyty Naukowe Politechniki Śląskiej, s. Budownictwo, z. 1710, Gliwice 2006.
[2]
Zamorowski J.: Przestrzenne konstrukcje prętowe z geometrycznymi im perfekcjami i podatnymi węzłami.
Wydawnictwo Politechniki Śląskiej, Gliwice, 2013.
[3]
Bródka J., Cwalina W.: Sztywność i nośność ram stężonych o węzłach podatnych. Wydawnictwo Politechniki Białostockiej, Białystok 1998.
[4]
Bródka J., Barszcz A., Giżejowski M., Kozłowski A.: Sztywność i nośność stalowych ram przechyłowych
o węzłach podatnych. Oficyna Wydawnicza Politechniki Rzeszowskiej, Rzeszów 2004.
~ 270 ~
th
Proceedings of the 11 International Conference on
New Trends in Statics and Dynamics of Buildings
October 3-4, 2013 Bratislava, Slovakia
Faculty of Civil Engineering STU Bratislava
Slovak Society of Mechanics SAS
OPTIMIZATION OF MIXING THE VARIOUS COMPONENTS OF
FLY ASH BASED ON THE GRAIN SIZE FOR USE IN
COMPOSITE CEMENTS
O. Zobal1, V. Šmilauer2 and Z. Bittnar3
Abstract
The use of fly ash in cement/concrete is a common thing for decades, but only to the extent up to 30% by weight
of clinker. However, with regard to the sustainable development of society and still above average ash
production in the Czech Republic it is appropriate to start using this material to a much greater extent. One of
the basic and also the biggest problems is the high variability of fly ash. This paper deals with the optimization
of mixing the various components of fly ash based on the grain size. The grading curves were obtained
experimentally. Based on the grain size curves was made required optimization. This optimization could be one
of the ways to problem solve high variability of fly ash.
Keywords
Fly ash; cement; grain size; optimization
1
ÚVOD
Náhrada slínku popílkem, pípadn jiným materiálem je bžná a ovená vc již adu let. V &eské republice to
popisuje norma &SN EN 197-1, která definuje složení smsných cement% a lze nahrazovat slínky z 20 až 35 %
hmotnosti slínku jinou složkou [1]. Když se však nahradí vtší množství než 35 % slínku popílkem, tak takové
smsi ješt pln ovené nejsou. Takový zásah má samozejm velký vliv na výsledné vlastnosti smsi a
hotového materiálu. Výrazn pozitivní vliv má taková náhrada na nár%st hydrataního tepla, ovšem problémem
je napíklad pomalý nár%st poáteních pevností betonu. Dále je jedním z nejvtších problém% výrazná
variabilita samotných popílk%. [2],[3] Jak však dokazuje nedávno provedená analýza betonu odebraného
z pehradního tlesa VD Orlík, kde bylo práv z d%vodu odstranní problému s vysokým nár%stem hydrataního
tepla nahrazeno tém 30 % slínku popílkem, m%že takový beton dosahovat vynikající kvality i po 50 letech.
Jedná se o velice kompaktní materiál a u tohoto betonu byla namena pevnost v tlaku více jak 40 MPa [4]. Pi
stavb pehradního tlesa VD Orlík bylo použito tém 1 milion m3 betonu. Obrovské množství stavebního
materiálu sebou pinášelo úskalí variability kvality používaných materiál%. Z toho d%vodu byla zízena
staveništní kontrola a bhem výstavby bylo provedeno 9000 r%zných zkoušek a 30 000 nedestruktivních mení
1
Ing. O. Zobal, Faculty of Civil Engineering, Czech Technical University in Prague, Thákurova 7, 166 29 Praha
6; Phone (+420) 2-2435-4495; Fax (+420) 2-2431-0775; e-mail: ondrej.zobal@fsv.cvut.cz.
2
Doc. Ing. V. Šmilauer, Ph.D., Faculty of Civil Engineering, Czech Technical University in Prague, Thákurova
7, 166 29 Praha 6; Phone (+420) 2-2435-4483; Fax (+420) 2-2431-0775; e-mail: smilauer@cml.fsv.cvut.cz.
3
Prof. Ing. Z. Bittnar, DrSc., Faculty of Civil Engineering, Czech Technical University in Prague, Thákurova 7,
166 29 Praha 6; Phone (+420) 2-2435-3869; Fax (+420) 2-2431-0775; e-mail: bittnar@fsv.cvut.cz.
~ 271 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
vývoje vlastností betonu [5]. Tento píspvek se zabývá optimalizací míšení r%zných složek popílku na základ
zrnitosti. Kivky zrnitosti byly získány experimentáln a poté byla provedena požadovaná optimalizace.
2
OPTIMALIZACE R"ZNÝCH SLOŽEK POPÍLKU
V &eské republice není zvykem, tak jako je tomu v jiných zemích, kde je významná produkce popílku (USA,
Austrálie, Nmecko, Ukrajina), tídit popílek na jednotlivé frakce a tím zefektivnit jeho následné využití. ºešená
tepelná elektrárna se ovšem posunula smrem dopedu a používá na výstupu spalování 4 filtry, ze kterých
získává 4 sekce (frakce) popílku. Hrubá sekce I tvoí 80,5 % produkce, sekce II odpovídá 7,2 % produkce a
nejjemnjší popílek je získán ze sekce III, která ovšem tvoí pouze 1,8 %. Sekce IV je ješt hrubší složka než
sekce I a pro naše úely použití do smsných cement% se proto nehodí. Jednotlivé sekce jsou míchány ze složek
A a B tak, aby výsledná sms odpovídala normovým požadavk%m pro použití do smsných cement%. Souasný
stav je takový, že složka A i B tvoí shodn 50% podíl výsledné smsi. Složka A se získává mícháním sekce II a
III v pomru 4:1. Složka B je pímo sekce I. Cílem je nalézt takové míšení, aby se maximáln využila složka B,
které je nejvtší produkce. Zde se zabýváme pouze mezerovitostí výsledné smsi, která má vliv na pevnost
betonu.
2.1 K)ivky zrnitosti
Na základ namené granulometrie a získaných kivek zrnitostí byla provedena optimalizace míšení složek A a
B. Na Obr. 1 jsou uvedeny kivky zrnitosti jednotlivých sekcí popílku a porovnání s cementem Mokrá CEM
42,5R.
Obr. 1. Kivka zrnitosti cementu CEM 42,5 R Mokrá a popílk% z jednotlivých sekcí sledované elektrárny.
2.2 Požitý algoritmus
Pibližné ešení vychází z “píinkových ar mezerovitosti” jednotlivých frakcí. Tato metoda umož(uje rychlý
výpoet z libovolné kivky zrnitosti. Pro samotný výpoet mezerovitosti a hutnosti byl použit algoritmus z [6].
Celý algoritmus byl naprogramován v jazyce Python 2.7 s využitím objektového programování a grafických
knihoven. Na Obr. 2 je vidt použitá kivka pro simulaci mezerovitosti.
~ 272 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
October 2013, Bratislava
Obr. 2. Mezerovitost pro monodisperzní soustavu kulových ástic je 0.375, pimícháním velkých i malých
ástic mezerovitost klesá dle dané kivky, z [6]
2.3 K)ivka mezerovitosti
Simulaci mezerovitosti po smíšení složky A a B v daném pomru jednotlivých sekcí znázor(uje Obr. 3.
Minimální mezerovitost vychází pi pomru 20 % složky A a 80% složky B. Typická kivka mezerovitosti nemá
píliš ostrý extrém, variabilita kivek zrnitosti tedy nehraje kritickou roli.
Obr. 3. Typická kivka mezerovitosti míšení jednotlivých sekci popilku
~ 273 ~
11th International Conference on New Trends in Statics and Dynamics of Buildings
3
October 2013, Bratislava
ZÁV$R
Cílem naší práce je nahradit ideáln alespo( 50 % slínku popílkem. To sebou nese krom pozitiv samozejm i
problémy. Mezi nejvtší problémy patí pomalý nár%st poáteních pevností betonu a vysoká variabilita popílk%.
Problém s poátení pevností se dá vyešit tak, že se najde vhodné využití pro tuto aplikaci a tím jsou napíklad
základové konstrukce, kde se navíc jedná o velké objemy materiálu a tím i vtší potenciální spotebu popílku.
S variabilitou popílku se lze také vypoádat, jak je vidt na výstavb jedné z nejvýznamnjších staveb v &eské
republice VD Orlík, když je provádna písná kontrola a zkoušky.
Další možností, jak potlait variabilitu popílk% je jejich tídní na výstupu spalování. Provedená optimalizace
míšení takto tídného popílku ukazuje, že pi vhodném postupu lze dosáhnout efektivnjšího využití tohoto
primárn odpadního materiálu. Optimalizace se statistikou kivek zrnitosti ukazuje, že optimální zastoupení
složky B je pibližn 80 %, tedy oproti souasnému stavu navýšeni o 30 % využití sekce I, která tvoí cca 80 %
produkce popílku píslušné elektrárny. Tvar kivky mezerovitosti nemá ostrý extrém, variabilita kivek tedy není
kritickým faktorem. Bylo tedy nalezeno optimum mezerovitosti pro složky A a B. Toto vypoítané optimum je
teba v další práci experimentáln ovit na reologii a na nár%stu pevnosti betonu.
POD$KOVÁNÍ
Tento experiment na stavební fakult &VUT v Praze mohl probhnout díky finanní podpoe z projektu FRTI3/757.
LITERATURA
[1] &SI: EN 197-1: Cement – &ást 1: Složení, specifikace a kritéria shody cement% pro obecné použití, Praha,
2001, tab. 27 (in Czech), ICS 91.100.10
[2] Neville, A., M.: Properties of concrete, 2009, pp. 503-505, ISBN 978-04-7023-527-0
[3] Feko, P.: Popílky, Vysoká škola bá(ská, Technická univerzita Ostrava, 2003, pp. 122-163 (in Czech),
ISBN 80-248-0327-5
[4] Zobal, O., Padevt, P., Šmilauer, V., Kopecký, L., Bittnar, Z.: Experimental analysis of material and
mechanical properties of the concrete dam Orlik after 50 years, In: Betonáské dny 2012. Praha: &eská
betonáská spolenost &SSI, pp. 248-253, ISBN 978-80-8076-104-2
[5] Keil, J.: Výstavba vodního díla Orlík – sborník statí, Národní podnik vodní stavby, 1966, (in Czech)
[6] Reschke, T.: Der Einfluss der Granulometrie der Feinstoffe auf die Gefugeentwicklung und die Festigkeit
von Beton, Ph.D. Thesis, Weimar, 2000
~ 274 ~
AUTHOR INDEX
Adamczyk, K. ..............27
Al Sabouni-Zawadzka, A. .. 47
Aminbaghai, M. .........147
Baláž, ď. ..................1, 73
Basinski, W. ..................5
Belina, A. ...............9, 217
Benþat, J. .....................13
Bittnar, P. ...................161
Bittnar, Z. ..........161, 271
Brol, J. .........................27
Brožovský, J. .....139, 227
Brzáþová, M. ...............17
Cybulski, R. .................21
DawczyĔski S. .......25, 27
Demjan, I. ....................31
Dický, J. .......................67
Fajman, P. ....................71
Fedorowicz, J. .............39
Fedorowicz, L. .............35
Ficker, T. ...............43, 45
Frýba, L. ....................235
Gilewski, W. ................47
Goga, V. ....................147
Górski, M. ...................51
Gremza, G. ............55, 59
Györgyi, J. ...........63, 231
Havran, J. ...................189
HoĐko, M. ....................67
Hubová, O. ................259
Hüttner, M. ..................71
Chomacki, L. ...............81
Ivánková, O. ..............105
Jendželovský, N. ...73, 77
Kadela, M. ...................81
Kantchev, V. ..............167
Kanty, P. ......................89
Kasprzak, A. ................93
Klabník, M. ...............117
Knoppik-Wróbel, A. ... 51
Koleková, Y. ............... 17
Koneþná, L. ............... 225
Kormaníková, E. 101, 179
Kotala, B. .................... 97
Kotrasová, K. ............ 101
Kováþiková, J. ........... 105
Kowolik, B. ....... 109, 113
Kozlowski, M. ............. 51
Králik, J. .................... 117
Krzywon, R. .............. 121
Kubošek, J. ................ 123
Kubzová, M. .............. 127
Kuchárová, D. ........... 131
Kutiš, V. .................... 147
Sedlár, T. ................... 147
Sekowski, J. ........ 89, 209
Siódmok, A. .............. 209
Skrzypczyk, J. ... 213, 217
Slowik, L. ................... 39
Sokol, M. .................. 225
Stehlíková, M. ............. 13
Sucharda, O. .... 123, 127,
................... 139, 227, 239
Sumec, J. ................... 243
Szabó, G. ................... 231
Lajþáková, G. ............ 135
Lobotka, P. ................ 259
Tomko, M. .................. 31
Šána, V. ............. 201, 205
Šmilauer, V. .............. 271
Šnirc, ď. .................... 221
Urushadze, S. ............ 235
Máca, J. ............... 71, 197
Magát, M. .................. 157
Mang, H. ................... 147
Medvecká, S. ............... 77
Melcer, J. ........... 131, 135
Mikolášek, D. ............ 139
Mistríková, Z. ............ 143
Murín, J. .................... 147
Niewiadomski, L. ..... 149,
............................ 153, 267
Olekšáková, I. ............ 157
Otcovská, T. .............. 165
PadevČt, P. ......... 161, 165
Partov, D. .......... 167, 171
Pastrav, M. ................ 175
Paulech, J. ................. 147
Petkov, M. ................. 171
Piovár, S. ................... 179
Pokorska-Silva, I. ........ 35
Polák, M. ................... 205
Prekop, ď. .................. 183
Psotný, M. ......... 185, 189
Ravinger, J. ....... 193, 221
Rokoš, O. .................. 197
~ 275 ~
Vašek, J. .................... 239
Véghová, I. ............... 243
Vráblová, K. ............. 247
Vrublová, S. .............. 227
Vyskoþ, E. ..................... 1
Weglorz, M. ................ 97
Wieczorek, M. .. 251, 255
Zacho, D. .................. 259
Zamorowski, J. ........ 153,
........................... 263, 267
Zobal, O. ................... 271
Download

slovak university of technology