Lista A - Grupa A. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
2157101
ATC
INN
A
A01
A01A
A01AB
A01AB09 mikonazol
A01AB09
mikonazol
Cena leka
Država
na veliko
Cena leka
=DãWLüHQRLPH
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
za
na veliko
leka
FO
leka
leka
leka
pakovanje
DDD
po DDD
$/,0(17$51,75$.7,0(7$%2/,=$0/(.29,=$/(ý(1-(%2/(67,',*(67,912*6,67(0$,0(7$%2/,=0$
STOMATOLOŠKI PREPARATI
Stomatološki preparati
Antiinfektivi i antiseptici za lokalno – oralnu primenu
DAKTANOL
oralni gel
tuba, 1 po 40 g 2%
Galenika a.d.
Republika Srbija
Participacija
osiguranog
lica
225,50
0,2 g
56,38
50,00
/(.29,=$325(0(û$-($&,',7(7$
/HNRYL]DOHþHQMHSHSWLþNRJXONXVDLJDVWURH]RIDJXVQRJUHIOXNVD
Inhibitori protonske pumpe
A02
A02B
A02BC
A02BC01 omeprazol
1122460
A02BC01
omeprazol
OMEPROL
gastrorezistentna
kapsula, tvrda
kontejner za tablete, 15
po 20 mg
Zdravlje a.d.
Republika Srbija
406,70
20 mg
27,11
50,00
1122858
A02BC01
omeprazol
ZEPROM
gastrorezistentna
kapsula, tvrda
blister, 14 po 20 mg
PharmaSwiss d.o.o.
Republika Srbija
379,60
20 mg
27,11
50,00
Republika Srbija
379,60
20 mg
27,11
50,00
Republika Srbija
379,60
20 mg
27,11
50,00
1122846
A02BC01
omeprazol
ORTANOL
gastrorezistentna
kapsula, tvrda
blister, 14 po 20 mg
Ufar d.o.o. u saradnji sa
Sandoz
Pharmaceuticals d.d.
1122857
A02BC01
omeprazol
OMEPRAZOL
gastrorezistentna
kapsula, tvrda
blister, 14 po 20 mg
Alvogen d.o.o.
INDIKACIJE
1. Zollinger Elisonov sindrom trajno (E16.8).
NAPOMENA
Lek se u terapiju uvodi na osnovu mišljenja gastroenterologa ili endokrinologa na osnovu patohistološkog nalaza.
A02BC02 pantoprazol
1122862
A02BC02
pantoprazol
GASTROLOC
gastrorezistentna
tableta
blister, 14 po 40 mg
Pharmanova d.o.o.
Republika Srbija
273,20
40 mg
19,51
50,00
1122863
A02BC02
pantoprazol
GASTROLOC
gastrorezistentna
tableta
blister, 28 po 40 mg
Pharmanova d.o.o.
Republika Srbija
546,40
40 mg
19,51
50,00
1122867
A02BC02
pantoprazol
PANRAZOL
gastrorezistentna
tableta
blister, 14 po 40 mg
Zdravlje a.d.
Republika Srbija
273,20
40 mg
19,51
50,00
1122774
A02BC02
pantoprazol
PANTOPRAZOL
PHARMAS
gastrorezistentna
tableta
blister, 14 po 40 mg
PharmaS d.o.o.
Republika Srbija
273,20
40 mg
19,51
50,00
Lista A - Grupa A. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1122775
ATC
A02BC02
INDIKACIJE
INN
pantoprazol
=DãWLüHQRLPH
leka
PANTOPRAZOL
PHARMAS
FO
gastrorezistentna
tableta
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
blister, 28 po 40 mg
PharmaS d.o.o.
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
Republika Srbija
546,40
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
40 mg
19,51
50,00
1. Zollinger Elisonov sindrom trajno ( E16.8 ).
NAPOMENA
Lek se u terapiju uvodi na osnovu mišljenja gastroenterologa ili endokrinologa na osnovu patohistološkog nalaza.
A02BC03 lansoprazol
1122160
A02BC03
lansoprazol
SABAX
1122161
A02BC03
lansoprazol
SABAX
INDIKACIJE
gastrorezistentna
kapsula, tvrda
gastrorezistentna
kapsula, tvrda
blister, 14 po 30 mg
Hemofarm a.d.
Republika Srbija
439,00
30 mg
31,36
50,00
blister, 28 po 15 mg
Hemofarm a.d.
Republika Srbija
520,60
30 mg
37,19
50,00
1. Zollinger Elisonov sindrom trajno ( E16.8 ).
Lek se u terapiju uvodi na osnovu mišljenja gastroenterologa ili endokrinologa na osnovu patohistološkog nalaza.
NAPOMENA
A02BC05 esomeprazol
1122859
1122882
1122881
1122883
1122864
1122865
1122831
1122833
1122876
1122854
1122875
A02BC05
A02BC05
A02BC05
A02BC05
A02BC05
A02BC05
A02BC05
A02BC05
A02BC05
A02BC05
A02BC05
EMANERA
gastrorezistentna
kapsula, tvrda
EMANERA
gastrorezistentna
kapsula, tvrda
EMANERA
gastrorezistentna
kapsula, tvrda
EMANERA
gastrorezistentna
kapsula, tvrda
EMANERA
gastrorezistentna
kapsula, tvrda
esomeprazol
EMANERA
gastrorezistentna
kapsula, tvrda
esomeprazol
ESOMEPRAZOL
SANDOZ
gastrorezistentna
tableta
esomeprazol
ESOMEPRAZOL
SANDOZ
gastrorezistentna
tableta
esomeprazol
ESOMEPRAZOL
PHARMAS
gastrorezistentna
tableta
esomeprazol
ESOMEPRAZOL
PHARMAS
gastrorezistentna
tableta
esomeprazol
ESOMEPRAZOL
PHARMAS
gastrorezistentna
tableta
esomeprazol
esomeprazol
esomeprazol
esomeprazol
esomeprazol
blister, 7 po 20 mg
Krka Tovarna Zdravil
d.d.
Slovenija
134,60
30 mg
28,84
50,00
blister, 14 po 20 mg
Krka Tovarna Zdravil
d.d.
Slovenija
269,20
30 mg
28,84
50,00
blister, 28 po 20 mg
Krka Tovarna Zdravil
d.d.
Slovenija
538,40
30 mg
28,84
50,00
blister, 7 po 40 mg
Krka Tovarna Zdravil
d.d.
Slovenija
181,30
30 mg
19,43
50,00
blister, 14 po 40 mg
Krka Tovarna Zdravil
d.d.
Slovenija
362,40
30 mg
19,41
50,00
blister, 28 po 40 mg
Krka Tovarna Zdravil
d.d.
Slovenija
724,80
30 mg
19,41
50,00
blister, 7 po 20 mg
Salutas Pharma GmbH
1HPDþND
134,60
30 mg
28,84
50,00
blister, 7 po 40 mg
Salutas Pharma GmbH
1HPDþND
181,30
30 mg
19,43
50,00
blister, 7 po 20 mg
PharmaS d.o.o.
Republika Srbija
134,60
30 mg
28,84
50,00
blister, 14 po 20 mg
PharmaS d.o.o.
Republika Srbija
269,20
30 mg
28,84
50,00
blister, 7 po 40 mg
PharmaS d.o.o.
Republika Srbija
181,30
30 mg
19,43
50,00
Lista A - Grupa A. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1122853
ATC
A02BC05
INDIKACIJE
NAPOMENA
A03
A03F
A03FA
A03FA01
1124301
3124300
1124303
A03FA01
A03FA01
A03FA01
INN
esomeprazol
=DãWLüHQRLPH
leka
ESOMEPRAZOL
PHARMAS
FO
gastrorezistentna
tableta
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
blister, 14 po 40 mg
PharmaS d.o.o.
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
Republika Srbija
362,40
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
30 mg
19,41
50,00
1. Zollinger Elisonov sindrom trajno ( E16.8 ).
Lek se u terapiju uvodi na osnovu mišljenja gastroenterologa ili endokrinologa na osnovu patohistološkog nalaza.
/(.29,.2-,5(*8/,â8)81.&,21$/1(*$6752,17(67,1$/1(325(0(û$-(
Propulzivi
Propulzivi
metoklopramid
metoklopramid
metoklopramid
metoklopramid
KLOMETOL
KLOMETOL
REGLAN
tableta
blister, 30 po 10 mg
Galenika a.d.
Republika Srbija
134,00
30 mg
13,40
50,00
oralni rastvor
ERþLFDRGWDPQRJ
stakla, 1 po 100 ml (5
mg/5 ml)
Galenika a.d.
Republika Srbija
79,80
30 mg
23,94
50,00
blister, 40 po 10 mg
Alkaloid a.d. u saradnji
sa Sanofi-Aventis,
Francuska
Republika
Makedonija
178,70
30 mg
13,40
50,00
tableta
A04
A04A
A04AA
A04AA01 ondansetron
ANTIEMETICI I SREDSTVA PROTIV NAUZEJE
Antiemetici i sredstva protiv nauzeje
Antagonisti serotonina (5HT3)
1124532
A04AA01
ondansetron
ONDASAN
film tableta
10 po 4 mg
Slaviamed d.o.o.
Republika Srbija
1.506,40
16 mg
602,56
50,00
1124534
A04AA01
ondansetron
ONDASAN
film tableta
10 po 8 mg
Slaviamed d.o.o.
Republika Srbija
3.013,00
16 mg
602,60
50,00
Actavis Ltd.
Malta
3.013,00
2 mg
602,60
50,00
INDIKACIJE
=DVX]ELMDQMHPXþQLQHLSRYUDüDQMDX]UDGLRLKHPLRWHUDSLMX.
A04AA02 granisetron
1124100
A04AA02
granisetron
RASETRON
film tableta
blister, 10 po 1 mg
1124104
A04AA02
granisetron
RASETRON
film tableta
blister, 5 po 2 mg
Actavis Ltd.
Malta
2.978,20
2 mg
595,64
50,00
10 po 1 mg
Roche S.P.A; F.
Hoffmann-La Roche
Ltd.
Italija; Švajcarska
3.013,00
2 mg
602,60
50,00
1124586
A04AA02
INDIKACIJE
granisetron
KYTRIL
film tableta
=DVX]ELMDQMHPXþQLQHLSRYUDüDQMDX]UDGLRLKHPLRWHUDSLMX
Lista A - Grupa A. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
Cena leka
Država
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
za
FO
leka
leka
leka
pakovanje
7(5$3,-$%2/(67,ä8ý1,+387(9$%,/,-$512*75$.7$,-(75(
7HUDSLMDEROHVWLåXþQLKSXWHYD
3UHSDUDWLåXþQLKNLVHOLQD
=DãWLüHQRLPH
leka
ATC
INN
A05
A05A
A05AA
A05AA02 ursodeoksiholna kiselina
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1127500
A05AA02
ursodeoksiholna
kiselina
URSOSAN
kapsula, tvrda
blister, 50 po 250 mg
Pro. Med. CS Praha
A.S.
ýHãND
1.307,00
0,75 g
78,42
50,00
1127501
A05AA02
ursodeoksiholna
kiselina
URSOSAN
kapsula, tvrda
blister, 100 po 250 mg
Pro. Med. CS Praha
A.S.
ýHãND
2.613,90
0,75 g
78,42
50,00
INDIKACIJE
1. Primarna bilijarna ciroza dijagnostikovana u zdravstvenoj ustanovi koja obavlja zdravstvenu delatnost na tercijarnom nivou zdravstvene zaštite (K74.3)
NAPOMENA
Lek se u terapiju uvodi na osnovu mišljenja gastroenterologa ili infektologa/hepatologa.
LAKSATIVI
A06
Laksativi
A06A
Osmotski laksativi
A06AD
A06AD11 laktuloza
3127050
A06AD11
laktuloza
PORTALAK
sirup
1 po 500 ml (66,7
g/100 ml) 96%
Belupo Lijekovi i
kozmetika d.d.
Hrvatska
402,30
6,7 g
8,08
50,00
3127426
A06AD11
laktuloza
LAKTULOZA
sirup
boca, 1 po 500 ml
(66,7 g/100 ml)
Hemofarm a.d.
Republika Srbija
402,30
6,7 g
8,08
50,00
600 mg
42,35
50,00
INDIKACIJE
1. Portosistemske encefalopatije ( K72 ).
NAPOMENA
A07
A07A
A07AX
A07AX03
Lek se u terapiju uvodi na osnovu mišljenja gastroenterologa ili infektologa/hepatologa.
ANTIDIJAROICI, INTESTINALNI ANTIINFLAMATORNI / ANTIINFEKTIVNI LEKOVI
Intestinalni antiinfektivi
Ostali intestinalni antiinfektivi
nifuroksazid
3126303
A07AX03
INDIKACIJE
NAPOMENA
nifuroksazid
ENTEROFURYL
oralna suspenzija
1. Akutna dijareja (A09) u trajanju terapije do 5 dana.
Samo za decu.
ERþLFDSRPO
(200 mg/5 ml)
Bosnalijek d.d.
Bosna i
Hercegovina
254,10
Lista A - Grupa A. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
A07D
A07DA
A07DA03 loperamid
=DãWLüHQRLPH
leka
1126401
A07DA03
loperamid
LOPERAMID
1126412
A07DA03
loperamid
LOPEDIUM AKUT
1129930
budesonid
A07EA06
budesonid
NAPOMENA
A07EC
A07EC01
1129490
Participacija
osiguranog
lica
tableta
blister, 20 po 2 mg
Zdravlje a.d.
Republika Srbija
111,40
10 mg
27,85
50,00
kapsula, tvrda
blister, 10 po 2 mg
Salutas Pharma GmbH
1HPDþND
55,70
10 mg
27,85
50,00
BUDOSAN
1HPDþND
8.663,20
9 mg
259,90
50,00
gastrorezistentna
kapsula, tvrda
blister, 100 po 3 mg
Dr Falk Pharma GmbH
Lek se u terapiju uvodi do tri meseca u toku 12 meseci na osnovu mišljenja gastroenterologa, a nastavak terapije još do tri meseca u toku 12 meseci na
osnovu mišljenja gastroenterologa zdravstvene ustanove koja obavlja zdravstvenu delatnost na tercijarnom nivou zdravstvene zaštite .
$PLQRVDOLFLOQDNLVHOLQDLVOLþQLOHNRYL
sulfasalazin
SALAZOPYRIN-EN
gastrorezistentna
tableta
ERFDSODVWLþQDSR
500 mg
Kemwell AB
Švedska
936,00
2g
37,44
50,00
mesalazin
5-ASA
gastrorezistentna
tableta
blister, 100 po 250 mg
Slaviamed d.o.o.
Republika Srbija
1.116,60
1,5 g
67,00
50,00
mesalazin
5-ASA
supozitorija
blister, 30 po 250 mg
Slaviamed d.o.o.
Republika Srbija
901,90
1,5 g
180,38
50,00
sulfasalazin
A07EC02
mesalazin
1129300
A07EC02
5129303
A07EC02
NAPOMENA
DDD
Cena leka
na veliko
po DDD
1. Crohnova bolest terminalnog ileuma ili ascedentnog kolona ( K50 ).
A07EC01
INDIKACIJE
Cena leka
na veliko
za
pakovanje
Intestinalni antiinflamatorni lekovi
Kortikosteroidi koji deluju lokalno
A07E
A07EA
A07EA06
INDIKACIJE
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Antipropulzivi
Antipropulzivi
Država
proizvodnje
leka
1. Crohnova bolest (K50),
2. Ulcerozni kolitis (K51).
=DLQGLNDFLMHSRGWDþNRPLOHNVHXWHUDSLMXXYRGLQDRVQRYXPLãOMHQMDJDVWURHQWHURORJD
Lista A - Grupa A. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
A09
A09A
A09AA
A09AA02 pankreatin
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
'LJHVWLYLXNOMXþXMXüLHQ]LPH
'LJHVWLYLXNOMXþXMXüLHQ]LPH
Enzimski preparati
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1121153
A09AA02
pankreatin
KREON 25 000
gastrorezistentna
kapsula, tvrda
NRQWHMQHUSODVWLþQL
po 300 mg
Abbott Products GMBH
1HPDþND
592,00
4 kapsule
118,40
50,00
1121154
A09AA02
pankreatin
KREON 25 000
gastrorezistentna
kapsula, tvrda
NRQWHMQHUSODVWLþQL
po 300 mg
Abbott Products GMBH
1HPDþND
1.480,00
4 kapsule
118,40
50,00
1121155
A09AA02
pankreatin
KREON 25 000
gastrorezistentna
kapsula, tvrda
NRQWHMQHUSODVWLþQL
po 300 mg
Abbott Products GMBH
1HPDþND
2.960,10
4 kapsule
118,40
50,00
INDIKACIJE
3RUHPHüDMHJ]RNULQHIXQNFLMHSDQNUHDVDX]URNRYDQFLVWLþQRPILEUR]RP(
6WHDWRUHMDGRND]DQDRGJRYDUDMXüLPGLMDJQRVWLþNLPWHVWRPX]URNRYDQDVWDQMHPQDNRQWRWDOQDSDQNUHDWHNWRPLMHWRWDOQHJDVWUHNWRPLMHLOLWHãNLKREOLND
SRUHPHüDMDHJ]RNULQHIXQNFLMHSDQNUHDVD.
=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDSHGLMDWUDLOLJDVWURHQWHURORJDLOLSXOPRORJD]GUDYVWYHQHXVWDQRYHNRMDREDYOMD
NAPOMENA
zdravstvenu delatnost na tercijarnom nivou zdravstvene zaštite, a za indikaciju pod taškom 2, lek se uvodi u terapiju na osnovu mišljenja gastroenterologa.
A10
LEKOVI KOJI SE UPOTREBLJAVAJU U DIJABETES MELITUSU ( ANTIDIJABETICI )
A10A
Insulini I analozi
A10AB
Insulini I analozi, kratkog dejstva
A10AB01 insulini kratkog dejstva, humani
Novo Nordisk A/S;
Novo Nordisk
Production S.A.S
Danska;
Francuska
2.183,80
40 i.j.
58,23
50,00
Lilly France S.A.S.; Eli
Lilly Italia S.P.A.
Francuska; Italija
2.183,80
40 i.j.
58,23
50,00
0041559
A10AB01
insulin humani
rastvor za injekciju u uložak, 5 po 3 ml (100
ACTRAPID PENFILL
ulošku
i.j./ml)
0041425
A10AB01
insulin humani
HUMULIN R
rastvor za injekciju u
ulošku
5 po 3 ml (100 i.j./ml)
0041533
A10AB01
insulin humani
INSUMAN RAPID
OPTISET
rastvor za injekciju,
pen sa uloškom
5 po 3 ml (100 i.j./ml )
Sanofi-Aventis
Deutschland GmbH
1HPDþND
2.183,80
40 i.j.
58,23
50,00
0041563
A10AB01
insulin humani
INSUMAN RAPID
SOLOSTAR
rastvor za injekciju,
pen sa uloškom
5 po 3 ml (100 i.j./ml )
Sanofi-Aventis
Deutschland GmbH
1HPDþND
2.183,80
40 i.j.
58,23
50,00
NAPOMENA
Lek se u terapiju uvodi na osnovu mišljenja endokrinologa ili interniste ili pedijatra.
Lista A - Grupa A. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
0041507
ATC
INN
A10AB04 insulin lispro
A10AB04
insulin lispro
=DãWLüHQRLPH
leka
HUMALOG
FO
rastvor za injekciju
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
uložak, 5 po 3 ml (100
i.j./ml)
Lilly France S.A.S.; Eli
Lilly Italia S.P.A.
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
Francuska; Italija
3.325,60
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
40 i.j.
88,68
50,00
6DPR]DSDFLMHQWHVDQH]DGRYROMDYDMXüRPNRQWURORPGLMDEHWHVDQDLQWHQ]LYLUDQRMWHUDSLMLKXPDQLPLQVXOLQLPDXWRNXSRVOHGQMLKPHVHFLJOLNR]LOLUDQL
KHPRJORELQYHüLRGWM+E$F!XNRMLKVHXYRGLLQWHQ]LYLUDQDWHUDSLMDLQVXOLQVNLPDQDOR]LPDGR]DGQHYQRNRPELQDFLMDNUDWNRGHOXMXüHJL
GXJRGHOXMXüHJRGQRVQRELID]QRJDQDORJDNRMLVXXYHGHQLXWHUDSLMXXVNODGXVDQMLPDSURSLVDQLPQDSRPHQDPDLOL]DSDFLMHQWHQDWHUDSLMLGXJRGHOXMXüLP
RGQRVQRELID]QLPDQDORJRPNDRGRGDWQDWHUDSLMDXVOXþDMXSHU]LVWLUDQMDSRQDYOMDQHSRVWSUDQGLMDOQHKLSHUJOLNHPLMHJOLNHPLMDYHüDRGPPROOKSRVOHREURND
i pored adekvatne korekcije doziranja insulina i komplijanse pacijenta u navedenom periodu od 6 meseci.
3RVWSUDQGLMDOQDKLSHUJOLNHPLMVNDHSL]RGDVHXWYUÿXMHQDMHGDQRGVOHGHüLKQDþLQD
SRGDWDNRQLYRXJOLNHPLMHXWRNXSRVWSUDQGLMDOQHKLSHUJOLNHPLMVNHHSL]RGHXWYUÿHQDSDUDWRP]DVDPRNRQWUROXJOLNHPLMHPHPRULMDOLþQRJDSDUDWDL
YHULILNRYDQQDOD]RPXNDUWRQXSDFLMHQWDRGQRVQRVSHFLMDOLVWLþNLPL]YHãWDMHPQDRVQRYXNRJDVHOHNXYRGLXWHUDSLMX
SRGDWDNRQLYRXJOLNHPLMHXWRNXSRVWSUDQGLMDOQHKLSHUJOLNHPLMVNHHSL]RGHXWYUÿHQX]GUDYVWYHQRMXVWDQRYLLYHULILNRYDQXNDUWRQXSDFLMHQWDRGQRVQR
VSHFLMDOLVWLþNRPL]YHãWDMXQDRVQRYXNRJDVHOHNXYRGLXWHUDSLMX
/HNVHXWHUDSLMXXYRGLQDRVQRYXPLãOMHQMDHQGRNULQRORJDLOLLQWHUQLVWHLOLSHGLMDWUDNRMLMHGXåDQGDXVSHFLMDOLVWLþNRPL]YHãWDMXXWYUGLLGRNXPHQWXMH
LVSXQMHQRVWQDSUHGSURSLVDQLKXVORYD]DXYRÿHQMHRYRJOHNDXWHUDSLMX
NAPOMENA
A10AB05 insulin aspart (analog humanom)
0041532
A10AB05
insulin aspart
NOVO RAPID
rastvor za injekciju
ERþLFDSRPO
(100 i.j./ml )
Novo Nordisk A/S
Danska
2.434,70
40 i.j.
97,39
50,00
NAPOMENA
3DFLMHQWLQDWHUDSLMLVXENXWDQRPLQVXOLQVNRPLQIX]LMRPSRPRüXLQVXOLQVNHSXPSHQDRVQRYXPLãOMHQMDHQGRNULQRORJDLOLLQWHUQLVWHLOLSHGLMDWUD
A10AB05 insulin aspart (analog humanom)
0041527
A10AB05
NAPOMENA
insulin aspart
NOVORAPID
FLEXPEN
pen sa uloškom, 5 po 3
rastvor za injekciju
ml (100 i.j./ml )
Novo Nordisk A/S;
Novo Nordisk
Production S.A.S
Danska;
Francuska
3.652,00
40 i.j.
97,39
50,00
6DPR]DSDFLMHQWHVDQH]DGRYROMDYDMXüRPNRQWURORPGLMDEHWHVDQDLQWHQ]LYLUDQRMWHUDSLMLKXPDQLPLQVXOLQLPDXWRNXSRVOHGQMLKPHVHFLJOLNR]LOLUDQL
KHPRJORELQYHüLRGWM+E$F!XNRMLKVHXYRGLLQWHQ]LYLUDQDWHUDSLMDLQVXOLQVNLPDQDOR]LPDGR]DGQHYQRNRPELQDFLMDNUDWNRGHOXMXüHJL
GXJRGHOXMXüHJRGQRVQRELID]QRJDQDORJDNRMLVXXYHGHQLXWHUDSLMXXVNODGXVDQMLPDSURSLVDQLPQDSRPHQDPDLOL]DSDFLMHQWHQDWHUDSLMLGXJRGHOXMXüLP
RGQRVQRELID]QLPDQDORJRPNDRGRGDWQDWHUDSLMDXVOXþDMXSHU]LVWLUDQMDSRQDYOMDQHSRVWSUDQGLMDOQHKLSHUJOLNHPLMHJOLNHPLMDYHüDRGPPROOKSRVOHREURND
i pored adekvatne korekcije doziranja insulina i komplijanse pacijenta u navedenom periodu od 6 meseci.
3RVWSUDQGLMDOQDKLSHUJOLNHPLMVNDHSL]RGDVHXWYUÿXMHQDMHGDQRGVOHGHüLKQDþLQD
SRGDWDNRQLYRXJOLNHPLMHXWRNXSRVWSUDQGLMDOQHKLSHUJOLNHPLMVNHHSL]RGHXWYUÿHQDSDUDWRP]DVDPRNRQWUROXJOLNHPLMHPHPRULMDOLþQRJDSDUDWDL
YHULILNRYDQQDOD]RPXNDUWRQXSDFLMHQWDRGQRVQRVSHFLMDOLVWLþNLPL]YHãWDMHPQDRVQRYXNRJDVHOHNXYRGLXWHUDSLMX
SRGDWDNRQLYRXJOLNHPLMHXWRNXSRVWSUDQGLMDOQHKLSHUJOLNHPLMVNHHSL]RGHXWYUÿHQX]GUDYVWYHQRMXVWDQRYLLYHULILNRYDQXNDUWRQXSDFLMHQWDRGQRVQR
VSHFLMDOLVWLþNRPL]YHãWDMXQDRVQRYXNRJDVHOHNXYRGLXWHUDSLMX
/HNVHXWHUDSLMXXYRGLQDRVQRYXPLãOMHQMDHQGRNULQRORJDLOLLQWHUQLVWHLOLSHGLMDWUDNRMLMHGXåDQGDXVSHFLMDOLVWLþNRPL]YHãWDMXXWYUGLLGRNXPHQWXMH
LVSXQMHQRVWQDSUHGSURSLVDQLKXVORYD]DXYRÿHQMHRYRJOHNDXWHUDSLMX
Lista A - Grupa A. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
0041549
ATC
INN
A10AB06 insulin glulizin
A10AB06
insulin glulizin
=DãWLüHQRLPH
leka
APIDRA
FO
rastvor za injekciju
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
ERþLFDSRPO
(100 i.j./ml)
Sanofi-Aventis
Deutschland GmbH
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
1HPDþND
2.168,20
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
40 i.j.
86,73
50,00
NAPOMENA
3DFLMHQWLQDWHUDSLMLVXENXWDQRPLQVXOLQVNRPLQIX]LMRPSRPRüXLQVXOLQVNHSXPSHQDRVQRYXPLãOMHQMDHQGRNULQRORJDLOLLQWHUQLVWHLOLSHGLMDWUD
A10AB06 insulin glulizin
0041548
A10AB06
insulin glulizin
APIDRA
0041556
A10AB06
insulin glulizin
APIDRA
SOLOSTAR
rastvor za injekciju u uložak, 5 po 3 ml (100
ulošku
i.j./ml)
Sanofi-Aventis
Deutschland GmbH
1HPDþND
3.252,30
40 i.j.
86,73
50,00
pen sa uloškom, 5 po 3
ml (100 i.j./ml)
Sanofi-Aventis
Deutschland GmbH
1HPDþND
3.252,30
40 i.j.
86,73
50,00
rastvor za injekciju
6DPR]DSDFLMHQWHVDQH]DGRYROMDYDMXüRPNRQWURORPGLMDEHWHVDQDLQWHQ]LYLUDQRMWHUDSLMLKXPDQLPLQVXOLQLPDXWRNXSRVOHGQMLKPHVHFLJOLNR]LOLUDQL
KHPRJORELQYHüLRGWM+E$F!XNRMLKVHXYRGLLQWHQ]LYLUDQDWHUDSLMDLQVXOLQVNLPDQDOR]LPDGR]DGQHYQRNRPELQDFLMDNUDWNRGHOXMXüHJL
GXJRGHOXMXüHJRGQRVQRELID]QRJDQDORJDNRMLVXXYHGHQLXWHUDSLMXXVNODGXVDQMLPDSURSLVDQLPQDSRPHQDPDLOL]DSDFLMHQWHQDWHUDSLMLGXJRGHOXMXüLP
RGQRVQRELID]QLPDQDORJRPNDRGRGDWQDWHUDSLMDXVOXþDMXSHU]LVWLUDQMDSRQDYOMDQHSRVWSUDQGLMDOQHKLSHUJOLNHPLMHJOLNHPLMDYHüDRGPPROOKSRVOHREURND
i pored adekvatne korekcije doziranja insulina i komplijanse pacijenta u navedenom periodu od 6 meseci.
3RVWSUDQGLMDOQDKLSHUJOLNHPLMVNDHSL]RGDVHXWYUÿXMHQDMHGDQRGVOHGHüLKQDþLQD
SRGDWDNRQLYRXJOLNHPLMHXWRNXSRVWSUDQGLMDOQHKLSHUJOLNHPLMVNHHSL]RGHXWYUÿHQDSDUDWRP]DVDPRNRQWUROXJOLNHPLMHPHPRULMDOLþQRJDSDUDWDL
YHULILNRYDQQDOD]RPXNDUWRQXSDFLMHQWDRGQRVQRVSHFLMDOLVWLþNLPL]YHãWDMHPQDRVQRYXNRJDVHOHNXYRGLXWHUDSLMX
SRGDWDNRQLYRXJOLNHPLMHXWRNXSRVWSUDQGLMDOQHKLSHUJOLNHPLMVNHHSL]RGHXWYUÿHQX]GUDYVWYHQRMXVWDQRYLLYHULILNRYDQXNDUWRQXSDFLMHQWDRGQRVQR
VSHFLMDOLVWLþNRPL]YHãWDMXQDRVQRYXNRJDVHOHNXYRGLXWHUDSLMX
/HNVHXWHUDSLMXXYRGLQDRVQRYXPLãOMHQMDHQGRNULQRORJDLOLLQWHUQLVWHLOLSHGLMDWUDNRMLMHGXåDQGDXVSHFLMDOLVWLþNRPL]YHãWDMXXWYUGLLGRNXPHQWXMH
NAPOMENA
LVSXQMHQRVWQDSUHGSURSLVDQLKXVORYD]DXYRÿHQMHRYRJOHNDXWHUDSLMX
Insulini i analozi, parenteralni, srednje dugog dejstva
A10AC
A10AC01 insulin srednje dugog dejstva, humani
0041557
A10AC01
insulin srednje
dugog dejstva,
humani (izofan)
0041428
A10AC01
insulin humani
0041515
A10AC01
insulin humani
INSULATARD
PENFILL
suspenzija za
injekciju u ulošku
(za Novopen) 5 po 3 ml
(100 i.j./ml)
Novo Nordisk A/S;
Novo Nordisk
Production S.A.S
Danska;
Francuska
2.348,20
40 i.j.
62,62
50,00
HUMULIN NPH
suspenzija za
injekciju u ulošku
5 po 3 ml (100 i.j./ml)
Lilly France S.A.S.; Eli
Lilly Italia S.P.A.
Francuska; Italija
2.348,20
40 i.j.
62,62
50,00
HUMULIN NPH
KwikPen
suspenzija za
injekciju u penu sa
uloškom
5 po 3 ml (100 i.j./ml)
Lilly France S.A.S.
Francuska
2.348,20
40 i.j.
62,62
50,00
Lista A - Grupa A. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
0041534
0041564
ATC
A10AC01
A10AC01
INN
=DãWLüHQRLPH
leka
rekombinantni
humani insulin
INSUMAN BAZAL
OPTISET
humani insulin
INSUMAN BAZAL
SOLOSTAR
FO
Cena leka
na veliko
za
pakovanje
Sanofi-Aventis
Deutschland GmbH
1HPDþND
Sanofi-Aventis
Deutschland GmbH
1HPDþND
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
injekcija, karpula sa
dozerom u pen
aplikatoru
5 po 3 ml (100 i.j./ml )
suspenzija za
injekciju, pen sa
uloškom
Država
proizvodnje
leka
5 po 3 ml (100 i.j./ml )
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
2.348,20
40 i.j.
62,62
50,00
2.348,20
40 i.j.
62,62
50,00
NAPOMENA
Lek se u terapiju uvodi na osnovu mišljenja endokrinologa ili interniste ili pedijatra.
Insulini i analozi, srednje dugog dejstva u kombinaciji sa insulinima kratkog dejstva
A10AD
A10AD01 insulin srednje dugog dejstva u kombinaciji sa insulinom kratkog dejstva, humani
0041558
0041535
MIXTARD 30
PENFILL
suspenzija za
injekciju u ulošku
(za Novopen) 5 po 3 ml
(100 i.j./ml)
Novo Nordisk A/S;
Novo Nordisk
Production S.A.S
Danska;
Francuska
2.348,20
40 i.j.
62,62
50,00
A10AD01
insulin humani
A10AD01
insulin srednje
dugog dejstva u
kombinaciji sa
insulinom kratkog INSUMAN COMB 25
dejstva, humani
OPTI SET
suspenzija za
injekciju, pen sa
uloškom
5 po 3 ml (100 i.j./ml )
Sanofi-Aventis
Deutschland GmbH
1HPDþND
2.348,20
40 i.j.
62,62
50,00
5 po 3 ml (100 i.j./ml )
Sanofi-Aventis
Deutschland GmbH
1HPDþND
2.348,20
40 i.j.
62,62
50,00
0041565
A10AD01
insulin humani
INSUMAN COMB 25
SOLOSTAR
suspenzija za
injekciju, pen sa
uloškom
0041427
A10AD01
insulin humani
HUMULIN M3
suspenzija za
injekciju u ulošku
5 po 3 ml (100 i.j./ml)
Lilly France S.A.S.; Eli
Lilly Italia S.P.A.
Francuska; Italija
2.348,20
40 i.j.
62,62
50,00
HUMULIN M3
KwikPen
suspenzija za
injekciju u penu sa
uloškom
5 po 3 ml (100 i.j./ml)
Lilly France S.A.S.
Francuska
2.348,20
40 i.j.
62,62
50,00
Francuska; Italija
3.367,80
40 i.j.
89,81
50,00
0041514
A10AD01
insulin humani
NAPOMENA
Lek se u terapiju uvodi na osnovu mišljenja endokrinologa ili interniste ili pedijatra.
A10AD04 insulin lispro
0041502
A10AD04
insulin lispro
HUMALOG MIX 25
suspenzija za
injekciju u ulošku
uložak, 5 po 3 ml (100
i.j/1 ml)
Lilly France S.A.S.; Eli
Lilly Italia S.P.A.
Lista A - Grupa A. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
0041503
A10AD04
insulin lispro
HUMALOG MIX 50
0041504
A10AD04
insulin lispro
HUMALOG MIX 25
KwikPen
suspenzija za
uložak, 5 po 3 ml (100 Lilly France S.A.S.; Eli
injekciju u ulošku
i.j/1 ml)
Lilly Italia S.P.A.
suspenzija za
injekciju u penu sa pen sa uloškom, 5 po 3
uloškom
ml (100 i.j./1 ml)
Lilly France S.A.S.
HUMALOG MIX 50
KwikPen
suspenzija za
injekciju u penu sa pen sa uloškom, 5 po 3
uloškom
ml (100 i.j./1 ml)
0041505
A10AD04
insulin lispro
Lilly France S.A.S.
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
Francuska; Italija
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
3.367,80
40 i.j.
89,81
50,00
Francuska
3.367,80
40 i.j.
89,81
50,00
Francuska
3.367,80
40 i.j.
89,81
50,00
6DPR]DSDFLMHQWHVDQH]DGRYROMDYDMXüRPNRQWURORPGLMDEHWHVDQDWHUDSLMLKXPDQLPLQVXOLQLPDXWRNXSRVOHGQMLKPHVHFLJOLNR]LOLUDQLKHPRJORELQYHüL
od 7%, tj. HbA1c>7%) u kojih perzistiraju ponavljane postprandijalne hiperglikemije (glikemija veca od 9mmol/l, 2h posle obroka) ili ponavljane hipoglikemije (
glikemija manja od 3,5mmol/l) i pored adekvatne korekcije doziranja insulina i komplijanse pacijenta u navedenom periodu od 6 meseci.
+LSRJOLNHPLMVNDRGQRVQRSRVWSUDQGLMDOQDKLSHUJOLNHPLMVNDHSL]RGDVHXWYUÿXMHQDMHGDQRGVOHGHüLKQDþLQD
SRGDWDNRQLYRXJOLNHPLMHXWRNXKLSRJOLNHPLMVNHRGQRVQRSRVWSUDQGLMDOQHKLSHUJOLNHPLMVNHHSL]RGHXWYUÿHQDSDUDWRP]DVDPRNRQWUROXJOLNHPLMH
PHPRULMDOLþQRJDSDUDWDLYHULILNRYDQQDOD]RPXNDUWRQXSDFLMHQWDRGQRVQRVSHFLMDOLVWLþNLPL]YHãWDMHPQDRVQRYXNRJDVHOHNXYRGLXWHUDSLMX
SRGDWDNRQLYRXJOLNHPLMHXWRNXKLSRJOLNHPLMVNHHSL]RGHXWYUÿHQDSDUDWRP]DVDPRNRQWUROXRGVWUDQHOHNDUDKLWQHSRPRüLKLWQHVOXåEHXþLMHPVH
prisustvu dogodila hipoglikemijska epizoda i verifikovan u njegovom izveštaju;
SRGDWDNRQLYRXJOLNHPLMHXWRNXKLSRJOLNHPLMVNHRGQRVQRSRVWSUDQGLMDOQHKLSHUJOLNHPLMVNHHSL]RGHXWYUÿHQX]GUDYVWYHQRMXVWDQRYLLYHULILNRYDQX
NDUWRQXSDFLMHQWDRGQRVQRVSHFLMDOLVWLþNRPL]YHãWDMXQDRVQRYXNRJDVHOHNXYRGLXWHUDSLMX
/HNVHXWHUDSLMXXYRGLQDRVQRYXPLãOMHQMDHQGRNULQRORJDLOLLQWHUQLVWHLOLSHGLMDWUDNRMLMHGXåDQGDXVSHFLMDOLVWLþNRPL]YHãWDMXXWYUGLLGRNXPHQWXMH
LVSXQMHQRVWQDSUHGSURSLVDQLKXVORYD]DXYRÿHQMHRYRJOHNDXWHUDSLMX
NAPOMENA
=DOHþHQMHGHFHX]UDVWDGRJRGLQDVDGLMDEHWHVRPWLS,OHNRYL+XPDORJ0L[L+XPDORJ0L[.ZLN3HQPRJXVHNRULVWLWLLNDRDOWHUQDWLYDKXPDQLP
insulinima u prvoj liniji terapije na osnovu mišljenja endokrinologa ili pedijatra.
Lista A - Grupa A. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
0041528
=DãWLüHQRLPH
ATC
INN
leka
A10AD05 insulin aspart (analog humanom)
A10AD05
insulin aspart
NOVOMIX 30
FLEXPEN
FO
suspenzija za
injekciju
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
pen sa uloskom, 5 po 3
ml (100 i.j./1 ml )
Novo Nordisk A/S;
Novo Nordisk
Production S.A.S
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
Danska;
Francuska
3.652,00
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
40 i.j.
97,39
50,00
6DPR]DSDFLMHQWHVDQH]DGRYROMDYDMXüRPNRQWURORPGLMDEHWHVDQDWHUDSLMLKXPDQLPLQVXOLQLPDXWRNXSRVOHGQMLKPHVHFLJOLNR]LOLUDQLKHPRJORELQYHüL
od 7%, tj. HbA1c>7%) u kojih perzistiraju ponavljane postprandijalne hiperglikemije (glikemija veca od 9mmol/l, 2h posle obroka) ili ponavljane hipoglikemije (
glikemija manja od 3,5mmol/l) i pored adekvatne korekcije doziranja insulina i komplijanse pacijenta u navedenom periodu od 6 meseci.
+LSRJOLNHPLMVNDRGQRVQRSRVWSUDQGLMDOQDKLSHUJOLNHPLMVNDHSL]RGDVHXWYUÿXMHQDMHGDQRGVOHGHüLKQDþLQD
SRGDWDNRQLYRXJOLNHPLMHXWRNXKLSRJOLNHPLMVNHRGQRVQRSRVWSUDQGLMDOQHKLSHUJOLNHPLMVNHHSL]RGHXWYUÿHQDSDUDWRP]DVDPRNRQWUROXJOLNHPLMH
PHPRULMDOLþQRJDSDUDWDLYHULILNRYDQQDOD]RPXNDUWRQXSDFLMHQWDRGQRVQRVSHFLMDOLVWLþNLPL]YHãWDMHPQDRVQRYXNRJDVHOHNXYRGLXWHUDSLMX
SRGDWDNRQLYRXJOLNHPLMHXWRNXKLSRJOLNHPLMVNHHSL]RGHXWYUÿHQDSDUDWRP]DVDPRNRQWUROXRGVWUDQHOHNDUDKLWQHSRPRüLKLWQHVOXåEHXþLMHPVH
prisustvu dogodila hipoglikemijska epizoda i verifikovan u njegovom izveštaju;
SRGDWDNRQLYRXJOLNHPLMHXWRNXKLSRJOLNHPLMVNHRGQRVQRSRVWSUDQGLMDOQHKLSHUJOLNHPLMVNHHSL]RGHXWYUÿHQX]GUDYVWYHQRMXVWDQRYLLYHULILNRYDQX
NDUWRQXSDFLMHQWDRGQRVQRVSHFLMDOLVWLþNRPL]YHãWDMXQDRVQRYXNRJDVHOHNXYRGLXWHUDSLMX
/HNVHXWHUDSLMXXYRGLQDRVQRYXPLãOMHQMDHQGRNULQRORJDLOLLQWHUQLVWHLOLSHGLMDWUDNRMLMHGXåDQGDXVSHFLMDOLVWLþNRPL]YHãWDMXXWYUGLLGRNXPHQWXMH
LVSXQMHQRVWQDSUHGSURSLVDQLKXVORYD]DXYRÿHQMHRYRJOHNDXWHUDSLMX
NAPOMENA
A10AE
A10AE04
=DOHþHQMHGHFHX]UDVWDGRJRGLQDVDGLMDEHWHVRPWLS,OHNVHPRåHNRULVWLWLLNDRDOWHUQDWLYDKXPDQLPLQVXOLQLPDXSUYRMOLQLMLWHUDSLMHQDRVQRYX
mišljenja endokrinologa ili pedijatra.
Insulini i analozi, dugog dejstva
insulin glargin
0041530
A10AE04
insulin glargin
LANTUS OPTIPEN
0041531
A10AE04
insulin glargin
LANTUS OPTISET
uložak, 5 po 3 ml (100
i.j./ml)
pen sa uloškom, 5 po 3
rastvor za injekciju
ml (100 i.j./ml )
rastvor za injekciju
Sanofi-Aventis
Deutschland GmbH
Sanofi-Aventis
Deutschland GmbH
1HPDþND
5.109,80
40 i.j.
136,26
50,00
1HPDþND
5.109,80
40 i.j.
136,26
50,00
Lista A - Grupa A. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
0041555
A10AE04
NAPOMENA
A10AE05
0041550
A10AE05
NAPOMENA
INN
insulin glargin
=DãWLüHQRLPH
leka
LANTUS
SOLOSTAR
FO
rastvor za injekciju
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
pen sa uloškom, 5 po 3
ml (100 i.j./ml)
Sanofi-Aventis
Deutschland GmbH
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
1HPDþND
5.109,80
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
40 i.j.
136,26
50,00
6DPR]DSDFLMHQWHVDQH]DGRYROMDYDMXüRPNRQWURORPGLMDEHWHVDQDWHUDSLMLKXPDQLPLQVXOLQLPDXWRNXSRVOHGQMLKPHVHFLJOLNR]LOLUDQLKHPRJORELQYHüL
od 7% tj. HbA1c>7%) u kojih perzistiraju ponavljane hipoglikemije ( glikemija manja od 3,5 mmola /l ) i pored adekvatne korekcije doziranja insulina i
komplijanse pacijenta u navedenom periodu od 6 meseci.
+LSRJOLNHPLMVNDHSL]RGDVHXWYUÿXMHQDMHGDQRGVOHGHüLKQDþLQD
SRGDWDNRQLYRXJOLNHPLMHXWRNXKLSRJOLNHPLMVNHHSL]RGHXWYUÿHQDSDUDWRP]DVDPRNRQWUROXJOLNHPLMHPHPRULMDOLþQRJDSDUDWDLYHULILNRYDQQDOD]RP
XNDUWRQXSDFLMHQWDRGQRVQRVSHFLMDOLVWLþNLPQDRVQRYXNRJDVHOHNXYRGLXWHUDSLMX
SRGDWDNRQLYRXJOLNHPLMHXWRNXKLSRJOLNHPLMVNHHSL]RGHXWYUÿHQDSDUDWRP]DVDPRNRQWUROXRGVWUDQHOHNDUDKLWQHSRPRüLKLWQHVOXåEHXþLMHPVH
prisustvu dogodila hipoglikemijska epizoda i verifikovan u njegovom izveštaju;
SRGDWDNRQLYRXJOLNHPLMHXWRNXKLSRJOLNHPLMVNHHSL]RGHXWYUÿHQX]GUDYVWYHQRMXVWDQRYLLYHULILNRYDQXNDUWRQXSDFLMHQWDRGQRVQRVSHFLMDOLVWLþNRP
izveštaju na osnovu koga se lek uvodi u terapiju.
/HNVHXWHUDSLMXXYRGLQDRVQRYXPLãOMHQMDHQGRNULQRORJDLOLLQWHUQLVWHLOLSHGLMDWUDNRMLMHGXåDQGDXVSHFLMDOLVWLþNRPL]YHãWDMXXWYUGLLGRNXPHQWXMH
LVSXQMHQRVWQDSUHGSURSLVDQLKXVORYD]DXYRÿHQMHRYRJOHNDXWHUDSLMX
insulin detemir
insulin detemir
LEVEMIR FLEXPEN
pen sa uloškom, 5 po 3
rastvor za injekciju
ml (100 i.j./1 ml )
Novo Nordisk A/S;
Novo Nordisk
Production S.A.S
Danska;
Francuska
5.465,90
40 i.j.
145,76
50,00
6DPR]DSDFLMHQWHVDQH]DGRYROMDYDMXüRPNRQWURORPGLMDEHWHVDQDWHUDSLMLKXPDQLPLQVXOLQLPDXWRNXSRVOHGQMLKPHVHFLJOLNR]LOLUDQLKHPRJORELQYHüL
od 7% tj. HbA1c>7%) u kojih perzistiraju ponavljane hipoglikemije ( glikemija manja od 3,5 mmola /l ) i pored adekvatne korekcije doziranja insulina i
komplijanse pacijenta u navedenom periodu od 6 meseci.
+LSRJOLNHPLMVNDHSL]RGDVHXWYUÿXMHQDMHGDQRGVOHGHüLKQDþLQD
SRGDWDNRQLYRXJOLNHPLMHXWRNXKLSRJOLNHPLMVNHHSL]RGHXWYUÿHQDSDUDWRP]DVDPRNRQWUROXJOLNHPLMHPHPRULMDOLþQRJDSDUDWDLYHULILNRYDQQDOD]RP
XNDUWRQXSDFLMHQWDRGQRVQRVSHFLMDOLVWLþNLPQDRVQRYXNRJDVHOHNXYRGLXWHUDSLMX
SRGDWDNRQLYRXJOLNHPLMHXWRNXKLSRJOLNHPLMVNHHSL]RGHXWYUÿHQDSDUDWRP]DVDPRNRQWUROXRGVWUDQHOHNDUDKLWQHSRPRüLKLWQHVOXåEHXþLMHPVH
prisustvu dogodila hipoglikemijska epizoda i verifikovan u njegovom izveštaju;
SRGDWDNRQLYRXJOLNHPLMHXWRNXKLSRJOLNHPLMVNHHSL]RGHXWYUÿHQX]GUDYVWYHQRMXVWDQRYLLYHULILNRYDQXNDUWRQXSDFLMHQWDRGQRVQRVSHFLMDOLVWLþNRP
izveštaju na osnovu koga se lek uvodi u terapiju.
/HNVHXWHUDSLMXXYRGLQDRVQRYXPLãOMHQMDHQGRNULQRORJDLOLLQWHUQLVWHLOLSHGLMDWUDNRMLMHGXåDQGDXVSHFLMDOLVWLþNRPL]YHãWDMXXWYUGLLGRNXPHQWXMH
LVSXQMHQRVWQDSUHGSURSLVDQLKXVORYD]DXYRÿHQMHRYRJOHNDXWHUDSLMX
Lista A - Grupa A. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
A10B
A10BA
A10BA02 metformin
=DãWLüHQRLPH
leka
FO
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
Oralni antidijabetici (lekovi koji snižavaju glukozu u krvi)
Bigvanidini
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1043060
A10BA02
metformin
GLUFORMIN
film tableta
blister, 30 po 500 mg
Hemofarm a.d.
Republika Srbija
74,70
2g
9,96
50,00
1043062
A10BA02
metformin
GLUFORMIN
film tableta
blister, 30 po 1000 mg
Hemofarm a.d.
Republika Srbija
115,00
2g
7,67
50,00
1043070
A10BA02
metformin
TEFOR
tableta
30 po 500 mg
Galenika a.d.
Republika Srbija
74,70
2g
9,96
50,00
1043071
A10BA02
metformin
TEFOR
film tableta
tegla, 30 po 850 mg
Galenika a.d.
Republika Srbija
89,20
2g
7,00
50,00
1HPDþND$XVWULMD
115,00
2g
7,67
50,00
1043107
A10BA02
metformin
GLUCOPHAGE
film tableta
30 po 1000 mg
Merck KGaA; Merck
KGaA & Co. WERK
SPITTAL
1043116
A10BA02
metformin
METFODIAB
film tableta
blister, 30 po 500 mg
Zdravlje a.d
Republika Srbija
74,70
2g
9,96
50,00
1043118
A10BA02
metformin
METFODIAB
film tableta
blister, 30 po 850 mg
Zdravlje a.d
Republika Srbija
89,20
2g
7,00
50,00
1043117
A10BA02
metformin
METFODIAB
film tableta
blister, 30 po 1000 mg
Zdravlje a.d
Republika Srbija
115,00
2g
7,67
50,00
Sulfonamidi, derivati sulfoniluree
A10BB
A10BB01 glibenklamid
1042332
A10BB01
glibenklamid
MANINIL 3,5
tableta
blister, 30 po 3,5 mg
Berlin-Chemie
(Menarini group)
1HPDþND
90,00
7 mg
6,00
50,00
A10BB09 gliklazid
1042076
A10BB09
gliklazid
GLIKOSAN
tableta
blister, 30 po 80 mg
Slaviamed d.o.o.
Republika Srbija
186,70
0,16 g
12,45
50,00
1042070
A10BB09
gliklazid
GLIORAL
tableta
blister, 30 po 80 mg
Galenika a.d.
Republika Srbija
186,70
0,16 g
12,45
50,00
Lista A - Grupa A. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1042065
ATC
A10BB09
INN
gliklazid
=DãWLüHQRLPH
leka
DIPRIAN
FO
tableta sa
modifikovanim
RVOREDÿDQMHP
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
blister, 30 po 80 mg
Hemofarm a.d.
Republika Srbija
186,70
0,16 g
12,45
50,00
blister, 30 po 2 mg
Sanofi Winthrop
Industrie; SanofiAventis S.P.A.
Francuska; Italija
147,40
2 mg
4,91
50,00
blister, 30 po 3 mg
Sanofi Winthrop
Industrie; SanofiAventis S.P.A.
Francuska; Italija
247,90
2 mg
5,51
50,00
A10BB12 glimepirid
1042311
A10BB12
glimepirid
AMARYL
1042312
A10BB12
glimepirid
1042313
1042830
A10BB12
glimepirid
AMARYL
tableta
blister, 30 po 4 mg
Sanofi-Aventis S.P.A.
Italija
247,90
2 mg
4,13
50,00
A10BB12
glimepirid
LIMERAL
tableta
blister, 30 po 1 mg
Zdravlje a.d.
Republika Srbija
119,00
2 mg
7,93
50,00
1042831
A10BB12
glimepirid
LIMERAL
tableta
blister, 30 po 2 mg
Zdravlje a.d.
Republika Srbija
147,40
2 mg
4,91
50,00
1042832
A10BB12
glimepirid
LIMERAL
tableta
blister, 30 po 3 mg
Zdravlje a.d.
Republika Srbija
247,90
2 mg
5,51
50,00
1042833
A10BB12
glimepirid
LIMERAL
tableta
blister, 30 po 4 mg
Zdravlje a.d.
Republika Srbija
247,90
2 mg
4,13
50,00
1042834
A10BB12
glimepirid
LIMERAL
tableta
blister, 30 po 6 mg
Zdravlje a.d.
Republika Srbija
360,50
2 mg
4,01
50,00
blister, 30 po 1 mg
Ufar d.o.o. u saradnji sa
Sandoz
Pharmaceuticals d.d.
Republika Srbija
119,00
2 mg
7,93
50,00
blister, 30 po 2 mg
Ufar d.o.o. u saradnji sa
Sandoz
Pharmaceuticals d.d.
Republika Srbija
147,40
2 mg
4,91
50,00
blister, 30 po 3 mg
Ufar d.o.o. u saradnji sa
Sandoz
Pharmaceuticals d.d.
Republika Srbija
247,90
2 mg
5,51
50,00
blister, 30 po 4 mg
Ufar d.o.o. u saradnji sa
Sandoz
Pharmaceuticals d.d.
Republika Srbija
247,90
2 mg
4,13
50,00
1042815
1042816
1042817
1042818
A10BB12
A10BB12
A10BB12
A10BB12
glimepirid
glimepirid
glimepirid
glimepirid
AMARYL
tableta
DIBIGLIM
DIBIGLIM
DIBIGLIM
DIBIGLIM
tableta
tableta
tableta
tableta
tableta
Lista A - Grupa A. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
2050087
=DãWLüHQRLPH
leka
ATC
INN
A11
A11C
A11CC
A11CC05 holekalciferol
A11CC05
holekalciferol
VIGANTOL ULJE
FO
oralne kapi
1053075
A12AA04
Cena leka
na veliko
za
pakovanje
1HPDþND
Republika
Makedonija
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
VITAMINI
9LWDPLQL$L'XNOMXþXMXüLQMLKRYHNRPELQDFLMH
Vitamin D i analozi
ERþLFDSRPO
(20000 i.j./ml)
A12
A12A
A12AA
A12AA04 kalcijum karbonat
KALCIJUM
KARBONAT
kalcijum karbonat ALKALOID
Država
proizvodnje
leka
Merck KGaA
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
167,10
-
-
50,00
282,10
3g
16,93
50,00
MINERALI
Kalcijum
Kalcijum
tableta
tegla, 50 po 1 g
Alkaloid a.d.
Lista A - Grupa B. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1063115
ATC
INN
B
B01
B01A
B01AA
B01AA03 varfarin
B01AA03
varfarin
Cena leka
na veliko
=DãWLüHQRLPH
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
Država
za
leka
FO
leka
leka
proizvodnje leka pakovanje
DDD
.59,.59279251,25*$1,/(.29,=$/(ý(1-(%2/(67,.59,,.59279251,+25*$1$
$17,7520%27,ý.$65('679$$17,.2$*8/$16,
$QWLWURPERWLþNDVUHGVWYDDQWLNRDJXODQVL
Antagonisti vitamina K
FARIN
tableta
B01AC05
tiklopidin
Galenika a.d.
Republika Srbija
134,40
7,5 mg
6,72
50,00
229,70
0.5 g
15,31
50,00
,QKLELWRULDJUHJDFLMHWURPERFLWDLVNOMXþXMXüLKHSDULQ
B01AC
B01AC05 tiklopidin
1068200
blister, 30 po 5 mg
Cena leka Participacija
na veliko osiguranog
po DDD
lica
TICLODIX
film tableta
blister, 30 po 250 mg
Hemofarm a.d.
Republika Srbija
1. Lek se uvodi u terapiju na osnovu mišljenja lekara zdravstvene ustanove koja vrši ugradnju stenta i/ili grafta, a obavlja zdravstvenu delatnost na sekundarnom
ili tercijarnom nivou zdravstvene zaštite, za period do 12 meseci neposredno posle ugradnje stenta i/ili grafta.
2. Kod pacijenata u sekundarnoj prevenciji infarkta miokarda i mozga kod osoba koje su rezistentne na acetilsalicilnu kiselinu, a na osnovu mišljenja kardiologa
NAPOMENA
ili interniste ili neurologa/neuropsihijatra.
B03
ANTIANEMICI
B03A
3UHSDUDWLJYRåÿD
B03AB
7URYDOHQWQRJYRåÿHRUDOQLSUHSDUDWL
B03AB05 JYRåÿH,,,KLGURNVLGSROLPDOWR]QLNRPSOHNV
3060073
3060072
3060074
sirup
1 po 100 ml (50 mg/5
ml)
Lek farmacevtska
družba d.d. u saradnji
sa Vifor Inc,
Švajcarska
B03AB05
JYRåÿH,,,KLGURNVLG
polimaltozni
kompleks
REFERUM
sirup
boca staklena, 100 ml
(50 mg/5 ml)
Slaviamed d.o.o.
Republika Srbija
222,10
90 mg
19,99
50,00
B03AB05
JYRåÿH,,,KLGURNVLG
polimaltozni
kompleks
REFERUM
sirup
boca staklena, 100 ml
(100 mg/5 ml)
Slaviamed d.o.o.
Republika Srbija
494,70
90 mg
22,26
50,00
B03AB05
JYRåÿH,,,KLGURNVLG
polimaltozni
kompleks
FERRUM SANDOZ
Slovenija
222,10
90 mg
19,99
50,00
Lista A - Grupa B. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
3060050
=DãWLüHQRLPH
ATC
INN
leka
B03AB09 JYRåÿHSURWHLQVXNFLQLODW
B03AB09
JYRåÿH,,,
proteinsukcinilat
LEGOFER
FO
oralni rastvor
B03B
B03BB
B03BB01 folna kiselina
Cena leka
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
Država
za
leka
leka
proizvodnje leka pakovanje
Alkaloid a.d. u saradnji
boca staklena, 1 po 150 sa Italfarmaco S.P.A,
ml (800 mg/15 ml)
Italija
Republika
Makedonija
265,70
-
-
50,00
Republika Srbija
135,90
0,4 mg
0,54
50,00
Hrvatska
135,90
0,4 mg
0,54
50,00
Vitamin B12 i folna kiselina
Folna kiselina i derivati
1061040
B03BB01
folna kiselina
FOLNAK
tableta
fiola, 20 po 5 mg
1061050
B03BB01
folna kiselina
FOLACIN
tableta
fiola, 20 po 5 mg
NAPOMENA
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
Lek se u terapiju uvodi na osnovu mišljenja interniste ili ginekologa.
M.D. Nini d.o.o.
Jadran Galenski
Laboratorij d.d.
Lista A - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1100252
ATC
INN
C
C01
C01A
C01AA
C01AA05 digoksin
C01AA05
digoksin
Cena leka
Država
na veliko
=DãWLüHQRLPH
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
za
leka
FO
leka
leka
leka
pakovanje
KARDIOVASKULARNI SISTEM (LEKOVI KOJI DELUJU NA KARDIOVASKULARNI SISTEM)
TERAPIJA BOLESTI SRCA
6UþDQLJOLNR]LGL
Glikozidi digitalisa
DILACOR
tableta
blister, 20 po 0,25 mg
C01B
C01BC
C01BC03 propafenon
1101421
C01BC03
propafenon
Zdravlje a.d.
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
Republika Srbija
73,40
0,25 mg
3,67
50,00
Republika Srbija
359,90
0,3 g
14,40
50,00
Antiaritmici, grupa I i III
Antiaritmici, grupa Ic
PROFENAN
film tableta
blister, 50 po 150 mg
Slaviamed d.o.o.
1101420
C01BC03
propafenon
PROFENAN
film tableta
blister, 50 po 300 mg
Slaviamed d.o.o.
Republika Srbija
648,00
0,3 g
12,96
50,00
1101130
C01BC03
propafenon
PROPAFEN
film tableta
blister, 50 po 150 mg
Hemofarm a.d.
Republika Srbija
359,90
0,3 g
14,40
50,00
1101131
C01BC03
propafenon
PROPAFEN
film tableta
blister, 50 po 300 mg
Hemofarm a.d.
Republika Srbija
648,00
0,3 g
12,96
50,00
NAPOMENA
Lek se u terapiju uvodi na osnovu mišljenja interniste ili kardiologa.
C01BD
C01BD01 amjodaron
Antiaritmici, grupa III
1101402
C01BD01
amjodaron
AMIODARON
tableta
blister, 60 po 200 mg
Zdravlje a.d.
Republika Srbija
833,60
0,2 g
13,89
50,00
1101440
C01BD01
amjodaron
SEDACORON
tableta
blister, 50 po 200 mg
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
694,70
0,2 g
13,89
50,00
1101354
C01BD01
amjodaron
CORDARONE
tableta
blister, 30 po 200 mg
Sanofi Winthrop
Industrie
Francuska
416,80
0,2 g
13,89
50,00
Republika Srbija
249,50
60 mg
12,48
50,00
NAPOMENA
Lek se u terapiju uvodi na osnovu mišljenja interniste ili kardiologa.
C01D
Vazodilatatori u terapiji bolesti srca
C01DA
Organski nitrati
C01DA08 izosorbid dinitrat
1102071
C01DA08
izosorbid dinitrat
DIFUTRAT
kapsula
60 po 20 mg
Srbolek a.d.
Lista A - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
249,50
60 mg
12,48
50,00
Republika Srbija
83,10
60 mg
12,47
50,00
=DãWLüHQRLPH
leka
FO
kapsula sa
produženim
RVOREDÿDQMHPWYUGD
blister, 60 po 20 mg
Zdravlje a.d.
Republika Srbija
tableta
blister, 20 po 20 mg
Galenika a.d.
1102060
C01DA08
izosorbid dinitrat
ISOSORB RETARD
1102082
C01DA08
izosorbid dinitrat
CORNILAT
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
C01DA14 izosorbid mononitrat
1102450
C01DA14
izosorbid mononitrat
MONIZOL
tableta
blister, 30 po 20 mg
Hemofarm a.d.
Republika Srbija
107,70
40 mg
7,18
50,00
1102452
C01DA14
izosorbid mononitrat
MONIZOL
tableta
blister, 30 po 40 mg
Hemofarm a.d.
Republika Srbija
175,00
40 mg
5,83
50,00
1102302
C01DA14
izosorbid mononitrat
MONOSAN
tableta
blister, 30 po 20 mg
Slaviamed d.o.o.
Republika Srbija
107,70
40 mg
7,18
50,00
1102300
C01DA14
izosorbid mononitrat
MONOSAN
tableta
blister, 30 po 40 mg
Slaviamed d.o.o.
Republika Srbija
175,00
40 mg
5,83
50,00
C01DX
C01DX12
molsidomin
1102520
C01DX12
molsidomin
LOPION
tableta
30 po 2 mg
Jugoremedija a.d.
Republika Srbija
156,90
50,00
1102521
C01DX12
molsidomin
LOPION RETARD
tableta
20 po 8 mg
Jugoremedija a.d.
Republika Srbija
241,40
50,00
1102295
C01DX12
molsidomin
MOLICOR
tableta
blister, 30 po 2 mg
Srbolek a.d.
Republika Srbija
156,90
50,00
C02
C02A
C02AB
C02AB02
Ostali vazodilatatori u terapiji bolesti srca
ANTIHIPERTENZIVI
Antiadrenergici centralnog delovanja
Metildopa
metildopa (racemat)
1103740
C02AB02
metildopa
METILDOPA
1103432
C02AB02
metildopa (racemat)
METHYLDOPA
INDIKACIJE
NAPOMENA
tableta
20 po 250 mg
Srbolek a.d.
Republika Srbija
118,60
2g
47,44
50,00
film tableta
20 po 250 mg
Hemofarm a.d.
Republika Srbija
158,90
2g
63,56
50,00
+LSHUWHQ]LMDXWUXGQRüL2222
Lek se u terapiju uvodi na osnovu mišljenja interniste ili kardiologa ili ginekologa.
Lista A - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1400410
ATC
INN
C03
C03A
C03AA
C03AA03 hidrohlortiazid
C03AA03
hidrohlortiazid
=DãWLüHQRLPH
leka
DIUNORM
FO
tableta
C03CA02
bumetanid
YURINEX
tableta
1400440
C03DA01
spironolakton
SPIRONOLAKTON
tableta
1400441
C03DA01
spironolakton
SPIRONOLAKTON
tableta
1400400
amilorid, metiklotiazid
C03EA..
amilorid, metiklotiazid LOMETAZID
C03EA01
C07
C07A
C07AA
C07AA05
1107183
C07AA05
Republika Srbija
Participacija
osiguranog
lica
97,10
25 mg
4,86
50,00
blister, 20 po 1 mg
Hemofarm a.d.
Republika Srbija
195,30
1 mg
9,77
50,00
blister, 40 po 25 mg
Galenika a.d.
Republika Srbija
276,30
75 mg
20,72
50,00
blister, 30 po 100 mg
Galenika a.d.
Republika Srbija
532,30
75 mg
13,31
50,00
Diuretici i diuretici koji štede kalijum u kombinaciji
Tiazidni diuretici i diuretici koji štede kalijum
C03E
C03EA
C03EA..
C03EA01
Slaviamed d.o.o.
DDD
Cena leka
na veliko
po DDD
Diuretici koji štede kalijum
Antagonisti aldosterona
C03D
C03DA
C03DA01 spironolakton
1401290
blister, 20 po 25 mg
Cena leka
na veliko
za
pakovanje
Snažni diuretici (Henleove petlje)
Sulfonamidski diuretici, monokomponentni
C03C
C03CA
C03CA02 bumetanid
1400041
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
DIURETICI
Slabi diuretici, tiazidi
Tiazidi, monokomponentni
Država
proizvodnje
leka
tableta
30 po (10 mg + 5 mg)
Galenika a.d.
Republika Srbija
138,20
1 tableta
4,61
50,00
tableta
blister, 40 po (50 mg +
5 mg)
Hemofarm a.d.
Republika Srbija
163,30
1 tableta
4,08
50,00
107,90
0,16 g
8,63
50,00
hidrohlortiazid, amilorid
hidrohlortiazid,
amilorid
HEMOPRES
%/2.$725,%(7$$'5(1(5*,ý.,+5(&(3725$
%HWDDGUHQHUJLþNLEORNDWRUL
%HWDDGUHQHUJLþNLEORNDWRULQHVHOHNWLYQL
propranolol
propranolol
PROPRANOLOL
tableta
50 po 40 mg
Galenika a.d.
Republika Srbija
Lista A - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
C07AB
C07AB02 metoprolol
=DãWLüHQRLPH
leka
FO
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
%HWDDGUHQHUJLþNLEORNDWRULVHOHNWLYQL
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1107496
C07AB02
metoprolol
PRESOLOL
film tableta
blister, 30 po 100 mg
Hemofarm a.d.
Republika Srbija
161,00
0,15 g
8,05
50,00
1107750
C07AB02
metoprolol
PRESOLOL
film tableta
blister, 28 po 50 mg
Hemofarm a.d.
Republika Srbija
77,70
0,15 g
8,33
50,00
1107751
C07AB02
metoprolol
PRESOLOL
film tableta
blister, 56 po 50 mg
Hemofarm a.d.
Republika Srbija
155,40
0,15 g
8,33
50,00
1107886
C07AB02
metoprolol
EGILOK
tableta
ERþLFDVWDNOHQDSR Egis Pharmaceuticals
50 mg
PLC
0DÿDUVND
166,50
0,15 g
8,33
50,00
1107885
C07AB02
metoprolol
EGILOK
tableta
ERþLFDVWDNOHQDSR Egis Pharmaceuticals
100 mg
PLC
0DÿDUVND
322,00
0,15 g
8,05
50,00
1107580
C07AB02
metoprolol
CORVITOL
tableta
blister, 30 po 50 mg
Berlin-Chemie AG
(Menarini Group)
1HPDþND
83,20
0,15 g
8,32
50,00
1107582
C07AB02
metoprolol
CORVITOL
tableta
blister, 30 po 100 mg
Berlin-Chemie AG
(Menarini Group)
1HPDþND
161,00
0,15 g
8,05
50,00
C07AB03 atenolol
1107170
C07AB03
atenolol
PRINORM
tableta
14 po 100 mg
Galenika a.d.
Republika Srbija
101,80
75 mg
5,45
50,00
1107550
C07AB03
atenolol
ATENOLOL
tableta
14 po 100 mg
Jugoremedija a.d.
Republika Srbija
101,80
75 mg
5,45
50,00
1107552
C07AB03
atenolol
ATENOLOL
tableta
blister, 20 po 50 mg
Jugoremedija a.d.
Republika Srbija
72,80
75 mg
5,46
50,00
1107500
C07AB03
atenolol
ATENOLOL
tableta
14 po 100 mg
Zdravlje a.d.
Republika Srbija
101,80
75 mg
5,45
50,00
bisoprolol
BISOPROLOL
PHARMAS
tableta
blister, 30 po 2,5 mg
PharmaS d.o.o.
Republika Srbija
117,00
10 mg
15,60
50,00
tableta
blister, 30 po 5 mg
PharmaS d.o.o.
Republika Srbija
149,80
10 mg
9,99
50,00
tableta
blister, 30 po 10 mg
PharmaS d.o.o.
Republika Srbija
271,90
10 mg
9,06
50,00
C07AB07 bisoprolol
1107042
C07AB07
1107020
C07AB07
bisoprolol
BISOPROLOL
PHARMAS
1107021
C07AB07
bisoprolol
BISOPROLOL
PHARMAS
Lista A - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPH
leka
FO
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
Hemofarm a.d.
Republika Srbija
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
149,80
10 mg
9,99
50,00
1107023
C07AB07
bisoprolol
TENSEC
film tableta
blister, 30 po 5 mg
1107022
C07AB07
bisoprolol
TENSEC
film tableta
blister, 30 po 10 mg
Hemofarm a.d.
Republika Srbija
271,90
10 mg
9,06
50,00
blister, 30 po 2,5 mg
Ufar d.o.o. u saradnji
sa Sandoz
Pharmaceuticals d.d.
Slovenija
Republika Srbija
117,00
10 mg
15,60
50,00
blister, 30 po 5 mg
Ufar d.o.o. u saradnji
sa Sandoz
Pharmaceuticals d.d.
Slovenija
Republika Srbija
149,80
10 mg
9,99
50,00
Republika Srbija
271,90
10 mg
9,06
50,00
1107026
1107027
C07AB07
C07AB07
bisoprolol
bisoprolol
BYOL
BYOL
film tableta
film tableta
1107025
C07AB07
bisoprolol
BYOL
film tableta
blister, 30 po 10 mg
Ufar d.o.o. u saradnji
sa Sandoz
Pharmaceuticals d.d.
Slovenija
1107035
C07AB07
bisoprolol
BIPREZ
film tableta
blister, 30 po 2,5 mg
Alkaloid d.o.o.
Republika Srbija
117,00
10 mg
15,60
50,00
1107036
C07AB07
bisoprolol
BIPREZ
film tableta
blister, 30 po 5 mg
Alkaloid d.o.o.
Republika Srbija
149,80
10 mg
9,99
50,00
1107037
C07AB07
bisoprolol
BIPREZ
film tableta
blister, 30 po 10 mg
Alkaloid d.o.o.
Republika Srbija
271,90
10 mg
9,06
50,00
1107041
C07AB07
bisoprolol
BILOKORD
tableta
blister, 30 po 5 mg
Zdravlje a.d.
Republika Srbija
149,80
10 mg
9,99
50,00
1107040
C07AB07
bisoprolol
BILOKORD
tableta
blister, 30 po 10 mg
Zdravlje a.d.
Republika Srbija
271,90
10 mg
9,06
50,00
Lista A - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
C07AG
C07AG02 karvedilol
=DãWLüHQRLPH
leka
FO
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
%ORNDWRULDOIDLEHWDDGUHQHUJLþNLKUHFHSWRUD
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1107625
C07AG02
karvedilol
KARVILEKS
tableta
blister, 30 po 12,5 mg
Zdravlje a.d.
Republika Srbija
279,40
37,5 mg
27,94
50,00
1107660
C07AG02
karvedilol
MILENOL
tableta
blister, 28 po 12,5 mg
Hemofarm a.d.
Republika Srbija
260,80
37,5 mg
27,94
50,00
1107661
C07AG02
karvedilol
MILENOL
tableta
28 po 25 mg
Republika Srbija
387,50
37,5 mg
20,76
50,00
1107620
C07AG02
karvedilol
DILATREND
tableta
Švajcarska
238,20
37,5 mg
51,04
50,00
1107621
C07AG02
karvedilol
DILATREND
tableta
Švajcarska
260,80
37,5 mg
27,94
50,00
1107622
C07AG02
karvedilol
DILATREND
tableta
Švajcarska
387,50
37,5 mg
20,76
50,00
blister, 28 po 6,25 mg
Slaviamed d.o.o. u
saradnji sa Krka
Tovarna Zdravil d.d,
Slovenija
Republika Srbija
238,20
37,5 mg
51,04
50,00
blister, 28 po 12,5 mg
Slaviamed d.o.o. u
saradnji sa Krka
Tovarna Zdravil d.d,
Slovenija
Republika Srbija
260,80
37,5 mg
27,94
50,00
194,60
1 tableta
6,49
50,00
1107673
1107676
C07AG02
C07AG02
INDIKACIJE
karvedilol
karvedilol
CORYOL
CORYOL
tableta
tableta
Hemofarm a.d.
F. Hoffmann-La Roche
blister, 28 po 6,25 mg
Ltd.
F. Hoffmann-La Roche
blister, 28 po 12,5 mg
Ltd.
F. Hoffmann-La Roche
blister, 28 po 25 mg
Ltd.
6UþDQDLQVXILFLMHQFLMD,
Lek se uvodi u terapiju na osnovu mišljenja kardiologa.
NAPOMENA
C07B
%HWDDGUHQHUJLþNLEORNDWRULLWLD]LGL
C07BB
%HWDDGUHQHUJLþNLEORNDWRULVHOHNWLYQLLWLD]LGL
C07BB07 bisoprolol, hidrohlortiazid
1107024
C07BB07
INDIKACIJE
bisoprolol,
hidrohlortiazid
TENSEC plus
film tableta
blister, 30 po (5 mg
+12,5 mg)
Hemofarm a.d.
Republika Srbija
=DOHþHQMHHVHQFLMDOQHDUWHULMVNHKLSHUWHQ]LMH,XNROLNRVHWURPHVHþQROHþHQMHSRMHGLQDþQLPOHNRYLPDNRMLVHNRULVWH]DOHþHQMHKLSHUWHQ]LMHXNOMXþXMXüLOHþHQMH
VDYLãHSRMHGLQDþQLKOHNRYDLVWRYUHPHQRSRND]DORQHGRYROMQRHILNDVQR
Lista A - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
C08
C08C
C08CA
C08CA01 amlodipin
=DãWLüHQRLPH
leka
Cena leka
Država
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
za
FO
leka
leka
leka
pakovanje
BLOKATORI KALCIJUMSKIH KANALA
Selektivni blokatori kalcijumskih kanala sa pretežno vaskularnim delovanjem
Derivati dihidropiridina
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1402860
C08CA01
amlodipin
AMLODIPIN
tableta
blister, 20 po 5 mg
PharmaSwiss d.o.o.
Republika Srbija
168,90
5 mg
8,45
50,00
1402861
C08CA01
amlodipin
AMLODIPIN
tableta
blister, 20 po 10 mg
PharmaSwiss d.o.o.
Republika Srbija
217,10
5 mg
5,43
50,00
1402830
C08CA01
amlodipin
ALOPRES
tableta
blister, 20 po 5 mg
Zdravlje a.d.
Republika Srbija
168,90
5 mg
8,45
50,00
1402831
C08CA01
amlodipin
ALOPRES
tableta
blister, 20 po 10 mg
Zdravlje a.d.
Republika Srbija
217,10
5 mg
5,43
50,00
1402865
C08CA01
amlodipin
VAZOTAL
tableta
blister, 20 po 5 mg
Hemofarm a.d.
Republika Srbija
168,90
5 mg
8,45
50,00
1402866
C08CA01
amlodipin
VAZOTAL
tableta
blister, 20 po 10 mg
Hemofarm a.d.
Republika Srbija
217,10
5 mg
5,43
50,00
1402735
C08CA01
amlodipin
NORVASC
tableta
blister, 30 po 5 mg
Pfizer Manufacturing
Deutschland GmbH
1HPDþND
253,50
5 mg
8,45
50,00
1402736
C08CA01
amlodipin
NORVASC
tableta
blister, 30 po 10 mg
Pfizer Manufacturing
Deutschland GmbH
1HPDþND
325,60
5 mg
5,43
50,00
1402140
C08CA01
amlodipin
AMLOGAL
tableta
blister, 20 po 5 mg
Galenika a.d.
Republika Srbija
168,90
5 mg
8,45
50,00
1402141
C08CA01
amlodipin
AMLOGAL
tableta
blister, 20 po 10 mg
Galenika a.d.
Republika Srbija
217,10
5 mg
5,43
50,00
1402146
C08CA01
amlodipin
AMLODIPIN
tableta
blister, 20 po 5 mg
Jugoremedija a.d.
Republika Srbija
168,90
5 mg
8,45
50,00
1402147
C08CA01
amlodipin
AMLODIPIN
tableta
blister, 20 po 10 mg
Jugoremedija a.d.
Republika Srbija
217,10
5 mg
5,43
50,00
1402142
C08CA01
amlodipin
AMLODIPIN
PHARMAS
tableta
blister, 20 po 5 mg
PharmaS d.o.o.
Republika Srbija
168,90
5 mg
8,45
50,00
1402143
C08CA01
amlodipin
AMLODIPIN
PHARMAS
tableta
blister, 20 po 10 mg
PharmaS d.o.o.
Republika Srbija
217,10
5 mg
5,43
50,00
1402857
C08CA01
amlodipin
AMLOPIN
tableta
blister, 20 po 5 mg
Ufar d.o.o.
Republika Srbija
168,90
5 mg
8,45
50,00
Lista A - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1402858
C08CA01
amlodipin
AMLOPIN
tableta
blister, 20 po 10 mg
Ufar d.o.o.
Republika Srbija
217,10
5 mg
5,43
50,00
1402850
C08CA01
amlodipin
AMLODIPIN
tableta
blister, 20 po 5 mg
M.D. Nini d.o.o.
Republika Srbija
92,90
5 mg
4,65
50,00
1402851
C08CA01
amlodipin
AMLODIPIN
tableta
blister, 20 po 10 mg
M.D. Nini d.o.o.
Republika Srbija
112,50
5 mg
2,81
50,00
1402835
C08CA01
amlodipin
ALOPRES
tableta
blister, 30 po 5 mg
Zdravlje a.d.
Republika Srbija
253,50
5 mg
8,45
50,00
1402836
C08CA01
amlodipin
ALOPRES
tableta
blister, 30 po 10 mg
Zdravlje a.d.
Republika Srbija
325,60
5 mg
5,43
50,00
1402862
C08CA01
amlodipin
MONODIPIN
tablete
blister, 20 po 5 mg
PharmaSwiss d.o.o.
Republika Srbija
168,90
5 mg
8,45
50,00
1402854
C08CA01
amlodipin
MONODIPIN
tablete
blister, 20 po 10 mg
PharmaSwiss d.o.o.
Republika Srbija
217,10
5 mg
5,43
50,00
tableta sa produženim
RVOREDÿDQMHP
blister, 30 po 20 mg
Zdravlje a.d.
Republika Srbija
157,20
30 mg
7,86
50,00
film tableta sa
modifikovanim
RVOREDÿDQMHP
blister, 30 po 20 mg
Hemofarm a.d.
Republika Srbija
157,20
30 mg
7,86
50,00
1. Angina pektoris (I20),
2. Arterijska hipertenzija ( I10; I11; I12; I13; I15 ).
INDIKACIJE
C08CA05 nifedipin
1402481
1402761
C08CA05
C08CA05
nifedipin
nifedipin
NIFELAT
NIFEDIPIN retard
C08D
C08DA
C08DA01 verapamil
Selektivni blokatori kalcijumskih kanala sa direktnim delovanjem na srce
Derivati fenilalkilamina
1402703
C08DA01
verapamil
VERAPAMIL
film tableta
blister, 30 po 40 mg
Hemofarm a.d.
Republika Srbija
64,20
0,24 g
12,84
50,00
1402704
C08DA01
verapamil
VERAPAMIL
film tableta
blister, 50 po 80 mg
Hemofarm a.d.
Republika Srbija
161,40
0,24 g
9,68
50,00
1402243
C08DA01
verapamil
VERAPAMIL
obložena tableta
50 po 80 mg
Srbolek a.d.
Republika Srbija
161,40
0,24 g
9,68
50,00
1402721
C08DA01
verapamil
IZOPAMIL
film tableta
blister, 45 po 80 mg
Galenika a.d.
Republika Srbija
145,30
0,24 g
9,69
50,00
1402120
C08DA01
verapamil
VERAPAMIL
ALKALOID
obložena tableta
blister, 30 po 40 mg
Alkaloid d.o.o.
Republika Srbija
64,20
0,24 g
12,84
50,00
Lista A - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1402121
ATC
C08DA01
INN
verapamil
=DãWLüHQRLPH
leka
VERAPAMIL
ALKALOID
FO
obložena tableta
C08DB
C08DB01 diltiazem
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
blister, 30 po 80 mg
Alkaloid d.o.o.
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
Republika Srbija
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
96,80
0,24 g
9,68
50,00
Derivati benzotiazepina
1402250
C08DB01
diltiazem
CORTIAZEM
RETARD
1402203
C08DB01
diltiazem
DILTIAZEM
ALKALOID
C09
C09A
C09AA
C09AA01 kaptopril
film tableta sa
modifikovanim
RVOREDÿDQMHP
blister, 30 po 90 mg
Hemofarm a.d.
Republika Srbija
222,50
0,24 g
19,78
50,00
tableta sa produženim
RVOREDÿDQMHP
blister, 30 po 90 mg
Alkaloid a.d.
Republika
Makedonija
222,50
0,24 g
19,78
50,00
LEKOVI KOJI DELUJU NA RENIN-ANGIOTENZIN SISTEM
,QKLELWRULDQJLRWHQ]LQNRQYHUWXMXüHJHQ]LPD$&(PRQRNRPSRQHQWQL
Inhibitori ACE, monokomponentni
1103632
C09AA01
kaptopril
ZORKAPTIL
tableta
1103630
C09AA01
kaptopril
ZORKAPTIL
tableta
1103631
C09AA01
kaptopril
ZORKAPTIL
1103220
C09AA01
kaptopril
1103222
C09AA01
kaptopril
ERþLFDSODVWLþQDSR
12,5 mg
Hemofarm a.d.
Republika Srbija
71,50
50 mg
7,15
50,00
Hemofarm a.d.
Republika Srbija
124,40
50 mg
6,22
50,00
tableta
blister, 40 po 25 mg
ERþLFDSODVWLþQD
po 50 mg
Hemofarm a.d.
Republika Srbija
248,90
50 mg
6,22
50,00
KATOPIL
tableta
40 po 25 mg
Galenika a.d.
Republika Srbija
124,40
50 mg
6,22
50,00
KATOPIL
tableta
40 po 50 mg
Galenika a.d.
Republika Srbija
248,90
50 mg
6,22
50,00
C09AA02 enalapril
1103571
C09AA02
enalapril
PRILENAP
tableta
blister, 20 po 10 mg
Hemofarm a.d.
Republika Srbija
124,40
10 mg
6,22
50,00
1103572
C09AA02
enalapril
PRILENAP
tableta
blister, 20 po 20 mg
Hemofarm a.d.
Republika Srbija
248,90
10 mg
6,22
50,00
1103870
C09AA02
enalapril
ENALAPRIL
tableta
blister, 20 po 5 mg
Jugoremedija a.d.
Republika Srbija
71,50
10 mg
7,15
50,00
1103871
C09AA02
enalapril
ENALAPRIL
tableta
blister, 20 po 10 mg
Jugoremedija a.d.
Republika Srbija
124,40
10 mg
6,22
50,00
1103872
C09AA02
enalapril
ENALAPRIL
tableta
blister, 20 po 20 mg
Jugoremedija a.d.
Republika Srbija
248,90
10 mg
6,22
50,00
enalapril
ENALAPRIL
ZDRAVLJE
ACTAVIS
tableta
blister, 20 po 10 mg
Zdravlje a.d.
Republika Srbija
124,40
10 mg
6,22
50,00
1103177
C09AA02
Lista A - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1103175
1103178
ATC
C09AA02
C09AA02
INN
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
enalapril
ENALAPRIL
ZDRAVLJE
ACTAVIS
tableta
blister, 20 po 20 mg
Zdravlje a.d.
Republika Srbija
248,90
10 mg
6,22
50,00
enalapril
ENALAPRIL
ZDRAVLJE
ACTAVIS
tableta
blister, 30 po 10 mg
Zdravlje a.d.
Republika Srbija
186,60
10 mg
6,22
50,00
tableta
blister, 30 po 20 mg
Zdravlje a.d.
Republika Srbija
373,30
10 mg
6,22
50,00
1103176
C09AA02
enalapril
ENALAPRIL
ZDRAVLJE
ACTAVIS
1103887
C09AA02
enalapril
ENATENS
tableta
blister, 20 po 10 mg
PharmaSwiss d.o.o.
Republika Srbija
124,40
10 mg
6,22
50,00
1103888
C09AA02
enalapril
ENATENS
tableta
blister, 20 po 20 mg
PharmaSwiss d.o.o.
Republika Srbija
248,90
10 mg
6,22
50,00
1103886
C09AA02
enalapril
ENALAPRIL
tableta
strip, 20 po 10 mg
Alvogen d.o.o.
Republika Srbija
124,40
10 mg
6,22
50,00
1103885
C09AA02
enalapril
ENALAPRIL
tableta
strip, 20 po 20 mg
Alvogen d.o.o.
Republika Srbija
248,90
10 mg
6,22
50,00
C09AA03 lizinopril
1103560
C09AA03
lizinopril
LORIL
tableta
blister, 20 po 5 mg
Srbolek a.d.
Republika Srbija
71,50
10 mg
7,15
50,00
1103561
C09AA03
lizinopril
LORIL
tableta
blister, 20 po 20 mg
Srbolek a.d.
Republika Srbija
248,90
10 mg
6,22
50,00
1103875
C09AA03
lizinopril
LIZINOPRIL
tableta
20 po 5 mg
Jugoremedija a.d.
Republika Srbija
71,50
10 mg
7,15
50,00
1103876
C09AA03
lizinopril
LIZINOPRIL
tableta
20 po 10 mg
Jugoremedija a.d.
Republika Srbija
124,40
10 mg
6,22
50,00
1103877
C09AA03
lizinopril
LIZINOPRIL
tableta
20 po 20 mg
Jugoremedija a.d.
Republika Srbija
248,90
10 mg
6,22
50,00
1103565
C09AA03
lizinopril
SKOPRYL
tableta
blister, 20 po 10 mg
Alkaloid d.o.o.
Republika Srbija
124,40
10 mg
6,22
50,00
1103566
C09AA03
lizinopril
SKOPRYL
tableta
blister, 20 po 20 mg
Alkaloid d.o.o.
Republika Srbija
248,90
10 mg
6,22
50,00
1103567
C09AA03
lizinopril
SKOPRYL
tableta
blister, 30 po 10 mg
Alkaloid d.o.o.
Republika Srbija
186,60
10 mg
6,22
50,00
1103568
C09AA03
lizinopril
SKOPRYL
tableta
blister, 30 po 20 mg
Alkaloid d.o.o.
Republika Srbija
373,30
10 mg
6,22
50,00
Lista A - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
C09AA05 ramipril
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1103071
C09AA05
ramipril
PRILINDA
tableta
blister, 28 po 2,5 mg
Hemofarm a.d.
Republika Srbija
200,20
2,5 mg
7,15
50,00
1103072
C09AA05
ramipril
PRILINDA
tableta
blister, 28 po 5 mg
Hemofarm a.d.
Republika Srbija
348,50
2,5 mg
6,22
50,00
tableta
blister, 28 po 2,5 mg
PharmaS d.o.o.
Republika Srbija
200,20
2,5 mg
7,15
50,00
1103080
C09AA05
ramipril
RAMIPRIL
PHARMAS
1103081
C09AA05
ramipril
RAMIPRIL
PHARMAS
tableta
blister, 28 po 5 mg
PharmaS d.o.o.
Republika Srbija
348,50
2,5 mg
6,22
50,00
1103011
C09AA05
ramipril
RAMITENS
tableta
blister, 28 po 2,5 mg
PharmaSwiss d.o.o.
Republika Srbija
200,20
2,5 mg
7,15
50,00
1103010
C09AA05
ramipril
RAMITENS
tableta
blister, 28 po 5 mg
PharmaSwiss d.o.o.
Republika Srbija
348,50
2,5 mg
6,22
50,00
1103024
C09AA05
ramipril
RAMITENS
tableta
blister, 30 po 2,5 mg
PharmaSwiss d.o.o.
Republika Srbija
214,50
2,5 mg
7,15
50,00
1103018
C09AA05
ramipril
RAMITENS
tableta
blister, 30 po 5 mg
PharmaSwiss d.o.o.
Republika Srbija
373,40
2,5 mg
6,22
50,00
1103722
C09AA05
ramipril
TRITACE
tableta
28 po 2, 5 mg
Sanofi-Aventis S.P.A.
Italija
200,20
2,5 mg
7,15
50,00
1103723
C09AA05
ramipril
TRITACE
tableta
28 po 5 mg
Sanofi-Aventis S.P.A.
Italija
348,50
2,5 mg
6,22
50,00
1103724
C09AA05
ramipril
TRITACE
tableta
28 po 10 mg
Sanofi-Aventis S.P.A.
Italija
449,70
2,5 mg
4,02
50,00
1103012
C09AA05
ramipril
VIVACE
tableta
blister, 28 po 1,25 mg
Zdravlje a.d.
Republika Srbija
119,00
2,5 mg
8,50
50,00
1103013
C09AA05
ramipril
VIVACE
tableta
blister, 28 po 2,5 mg
Zdravlje a.d.
Republika Srbija
200,20
2,5 mg
7,15
50,00
1103083
C09AA05
ramipril
VIVACE
tableta
blister, 28 po 5 mg
Zdravlje a.d.
Republika Srbija
348,50
2,5 mg
6,22
50,00
1103082
C09AA05
ramipril
VIVACE
tableta
blister, 28 po 10 mg
Zdravlje a.d.
Republika Srbija
449,70
2,5 mg
4,02
50,00
1103251
C09AA05
ramipril
AMPRIL
tableta
blister, 28 po 1,25 mg
Slaviamed d.o.o.
Republika Srbija
118,90
2,5 mg
8,49
50,00
Lista A - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1103255
C09AA05
ramipril
AMPRIL
tableta
blister, 28 po 2,5 mg
Slaviamed d.o.o.
Republika Srbija
200,20
2,5 mg
7,15
50,00
1103259
C09AA05
ramipril
AMPRIL
tableta
blister, 28 po 5 mg
Slaviamed d.o.o.
Republika Srbija
348,50
2,5 mg
6,22
50,00
1103263
C09AA05
ramipril
AMPRIL
tableta
blister, 28 po 10 mg
Slaviamed d.o.o.
Republika Srbija
449,70
2,5 mg
4,02
50,00
Hemofarm a.d.
Republika Srbija
184,20
1 tableta
9,21
50,00
Hemofarm a.d.
Republika Srbija
154,40
1 tableta
7,72
50,00
Zdravlje a.d.
Republika Srbija
263,20
1 tableta
13,16
50,00
Zdravlje a.d.
Republika Srbija
278,70
1 tableta
13,94
50,00
C09B
C09BA
C09BA02 enalapril, hidrohlortiazid
1401502
C09BA02
1401500
C09BA02
1401080
C09BA02
1401081
enalapril,
hidrohlortiazid
Inhibitori ACE, kombinacije
Inhibitori ACE i diuretici
PRILENAP H
tableta
PRILENAP HL
tableta
blister, 20 po (10 mg +
25 mg)
ENALAPRIL HCT
tableta
C09BA02
enalapril,
hidrohlortiazid
enalapril,
hidrohlortiazid
enalapril,
hidrohlortiazid
ENALAPRIL HCT
tableta
blister, 20 po (10 mg +
12.5 mg)
blister, 20 po (20 mg +
6 mg)
blister, 20 po (20 mg +
12,5 mg)
1401504
C09BA02
enalapril,
hidrohlortiazid
ENATENS PLUS
tableta
blister, 20 po (20 mg +
12,5 mg)
PharmaSwiss d.o.o.
Republika Srbija
278,70
1 tableta
13,94
50,00
1401505
C09BA02
enalapril,
hidrohlortiazid
ENATENS PLUS
tableta
blister, 30 po (20 mg +
12,5 mg)
PharmaSwiss d.o.o.
Republika Srbija
418,10
1 tableta
13,94
50,00
1401082
C09BA02
enalapril,
hidrohlortiazid
ENALAPRIL HCT
tableta
blister, 30 po (20 mg +
12,5 mg)
Zdravlje a.d.
Republika Srbija
418,10
1 tableta
13,94
50,00
1401083
C09BA02
enalapril,
hidrohlortiazid
ENALAPRIL HCT
tableta
blister, 30 po (20 mg +
6 mg)
Zdravlje a.d.
Republika Srbija
394,90
1 tableta
13,16
50,00
=DOHþHQMHDUWHULMVNHKLSHUWHQ]LMH,L,XNROLNRVHWURPHVHþQROHþHQMHSRMHGLQDþQLPOHNRYLPDNRMLVHNRULVWH]DOHþHQMHKLSHUWHQ]LMHXNOMXþXMXüLOHþHQMHVD
INDIKACIJE
YLãHSRMHGLQDþQLKOHNRYDLVWRYUHPHQRSRND]DORQHGRYROMQRHILNDVQR
C09BA03 lizinopril, hidrohlortiazid
1401171
C09BA03
lizinopril,
hidrohlortiazid
LIZOPRIL H
tableta
blister, 20 po (10 mg +
12,5 mg)
Bosnalijek d.d.
Bosna i
Hercegovina
154,40
1 tableta
7,72
50,00
1401172
C09BA03
lizinopril,
hidrohlortiazid
LIZOPRIL H
tableta
blister, 20 po (20 mg +
12,5 mg)
Bosnalijek d.d.
Bosna i
Hercegovina
278,80
1 tableta
13,94
50,00
Lista A - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1401182
C09BA03
lizinopril,
hidrohlortiazid
SKOPRYL PLUS
tableta
blister, 30 po (20 mg +
12,5 mg)
Alkaloid a.d.
Republika
Makedonija
418,10
1 tableta
13,94
50,00
1401922
C09BA03
lizinopril,
hidrohlortiazid
IRUZID
tableta
blister, 30 po (10 mg +
12,5 mg)
Belupo Lijekovi i
kozmetika d.d.
Hrvatska
231,50
1 tableta
7,72
50,00
1401923
C09BA03
lizinopril,
hidrohlortiazid
IRUZID
tableta
blister, 30 po (20 mg +
25 mg)
Belupo Lijekovi i
kozmetika d.d.
Hrvatska
463,00
1 tableta
15,43
50,00
=DOHþHQMHDUWHULMVNHKLSHUWHQ]LMH,L,XNROLNRVHWURPHVHþQROHþHQMHSRMHGLQDþQLPOHNRYLPDNRMLVHNRULVWH]DOHþHQMHKLSHUWHQ]LMHXNOMXþXMXüLOHþHQMHVD
INDIKACIJE
YLãHSRMHGLQDþQLKOHNRYDLVWRYUHPHQRSRND]DORQHGRYROMQRHILNDVQR
C09BA05 ramipril, hidrohlortiazid
1401130
C09BA05
ramipril,
hidrohlortiazid
AMPRIL HL
tableta
blister, 28 po (2,5 mg +
12.5mg)
Krka Tovarna Zdravil
d.d.
Slovenija
217,90
1 tableta
7,78
50,00
1401131
C09BA05
ramipril,
hidrohlortiazid
AMPRIL HD
tableta
28 po (5 mg + 25 mg)
Krka Tovarna Zdravil
d.d.
Slovenija
294,70
1 tableta
10,53
50,00
1401013
C09BA05
ramipril,
hidrohlortiazid
TRITACE COMP
tableta
28 po (5 mg + 25 mg)
Sanofi-Aventis S.P.A.
Italija
294,70
1 tableta
10,53
50,00
1401012
C09BA05
ramipril,
hidrohlortiazid
TRITACE COMP LS
tableta
blister, 28 po (2,5 mg +
12,5 mg)
Sanofi-Aventis S.P.A.
Italija
217,90
1 tableta
7,78
50,00
1401908
C09BA05
ramipril,
hidrohlortiazid
VIVACE PLUS L
tableta
blister, 28 po (2,5 mg +
12,5 mg)
Zdravlje a.d.
Republika Srbija
217,90
1 tableta
7,78
50,00
1401909
C09BA05
ramipril,
hidrohlortiazid
VIVACE PLUS
tableta
blister, 28 po (5 mg +
25 mg)
Zdravlje a.d.
Republika Srbija
294,70
1 tableta
10,53
50,00
=DOHþHQMHDUWHULMVNHKLSHUWHQ]LMH,L,XNROLNRVHWURPHVHþQROHþHQMHSRMHGLQDþQLPOHNRYLPDNRMLVHNRULVWH]DOHþHQMHKLSHUWHQ]LMHXNOMXþXMXüLOHþHQMHVD
INDIKACIJE
YLãHSRMHGLQDþQLKOHNRYDLVWRYUHPHQRSRND]DORQHGRYROMQRHILNDVQR
C10
SREDSTVA KOJA SMANJUJU LIPIDE U SERUMU ( HIPOLIPEMICI )
C10A
Lekovi koji smanjuju nivo holesterola i triglicerida
C10AA
Inhibitori HMG CoA reduktaze
C10AA01 simvastatin
1104510
C10AA01
simvastatin
CHOLIPAM
film tableta
blister, 20 po 10 mg
Hemofarm a.d.
Republika Srbija
162,10
30 mg
24,32
50,00
1104511
C10AA01
simvastatin
CHOLIPAM
film tableta
20 po 20 mg
Hemofarm a.d.
Republika Srbija
283,10
30 mg
21,23
50,00
Lista A - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1104440
C10AA01
simvastatin
ZOCOR
film tableta
28 po 10 mg
Merck Sharp & Dohme
Holandija
226,90
30 mg
24,31
50,00
1104441
C10AA01
simvastatin
ZOCOR
film tableta
28 po 20 mg
Merck Sharp & Dohme
Holandija
396,30
30 mg
21,23
50,00
1104445
C10AA01
simvastatin
ZOCOR
film tableta
28 po 40 mg
Merck Sharp & Dohme
Holandija
585,00
30 mg
15,67
50,00
1104490
C10AA01
simvastatin
VASILIP
film tableta
blister, 28 po 10 mg
Slaviamed d.o.o.
Republika Srbija
226,90
30 mg
24,31
50,00
1104491
C10AA01
simvastatin
VASILIP
film tableta
blister, 28 po 20 mg
Slaviamed d.o.o.
Republika Srbija
396,30
30 mg
21,23
50,00
1104492
C10AA01
simvastatin
VASILIP
film tableta
blister, 28 po 40 mg
Slaviamed d.o.o.
Republika Srbija
585,00
30 mg
15,67
50,00
1104610
C10AA01
simvastatin
HOLLESTA
film tableta
blister, 30 po 10 mg
Alkaloid d.o.o.
Republika Srbija
243,20
30 mg
24,32
50,00
1104611
C10AA01
simvastatin
HOLLESTA
film tableta
blister, 30 po 20 mg
Alkaloid d.o.o.
Republika Srbija
424,50
30 mg
21,23
50,00
1104612
C10AA01
simvastatin
HOLLESTA
film tableta
blister, 30 po 40 mg
Alkaloid d.o.o.
Republika Srbija
626,70
30 mg
15,67
50,00
simvastatin
SIMVASTATIN
PHARMAS
film tableta
blister 28 po 10 mg
PharmaS d.o.o.
Republika Srbija
226,90
30 mg
24,31
50,00
simvastatin
SIMVASTATIN
PHARMAS
film tableta
blister 28 po 20 mg
PharmaS d.o.o.
Republika Srbija
396,30
30 mg
21,23
50,00
1104613
1104614
C10AA01
C10AA01
3RURGLþQDIRUPDKLSHUOLSLGHPLMH(
INDIKACIJE
NAPOMENA
/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMD.OLQLNH]DHQGRNULQHEROHVWLGLMDEHWHVLEROHVWLPHWDEROL]PD.OLQLþNRJFHQWUD6UELMH
C10AA03 pravastatin
1104482
C10AA03
pravastatin
PRAVACOR
tableta
blister, 30 po 20 mg
PharmaSwiss d.o.o.
Republika Srbija
297,20
30 mg
14,86
50,00
1104483
C10AA03
pravastatin
PRAVACOR
tableta
blister, 30 po 40 mg
PharmaSwiss d.o.o.
Republika Srbija
982,90
30 mg
24,57
50,00
Lista A - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1104485
C10AA03
pravastatin
PRALIP
tableta
blister, 30 po 20 mg
Lek farmacevtska
družba d.d.
Slovenija
297,20
30 mg
14,86
50,00
1104486
C10AA03
pravastatin
PRALIP
tableta
blister, 30 po 40 mg
Lek farmacevtska
družba d.d.
Slovenija
982,90
30 mg
24,57
50,00
1104454
C10AA03
pravastatin
PRAVAPRES
tableta
blister, 30 po 20 mg
Sopharma PLC
Bugarska
297,20
30 mg
14,86
50,00
INDIKACIJE
3RURGLþQDIRUPDKLSHUOLSLGHPLMH(
NAPOMENA
/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMD.OLQLNH]DHQGRNULQHEROHVWLGLMDEHWHVLEROHVWLPHWDEROL]PD.OLQLþNRJFHQWUD6UELMH
C10AA05 atorvastatin
1104460
C10AA05
atorvastatin
SORTIS
film tableta
blister, 30 po 10 mg
Pfizer Manufacturing
Deutschland GmbH
1HPDþND
440,50
20 mg
29,37
50,00
1104462
C10AA05
atorvastatin
SORTIS
film tableta
blister, 30 po 20 mg
Pfizer Manufacturing
Deutschland GmbH
1HPDþND
778,00
20 mg
25,93
50,00
1104464
C10AA05
atorvastatin
SORTIS
film tableta
blister, 30 po 40 mg
Pfizer Manufacturing
Deutschland GmbH
1HPDþND
1.156,80
20 mg
19,28
50,00
1104465
C10AA05
atorvastatin
SORTIS
film tableta
blister, 30 po 80 mg
Pfizer Manufacturing
Deutschland GmbH
1HPDþND
2.405,20
20 mg
20,04
50,00
1104125
C10AA05
atorvastatin
ATACOR
film tableta
blister, 30 po 10 mg
Zdravlje a.d.
Republika Srbija
440,50
20 mg
29,37
50,00
1104126
C10AA05
atorvastatin
ATACOR
film tableta
blister, 30 po 20 mg
Zdravlje a.d.
Republika Srbija
778,00
20 mg
25,93
50,00
1104127
C10AA05
atorvastatin
ATACOR
film tableta
blister, 30 po 40 mg
Zdravlje a.d.
Republika Srbija
1.156,80
20 mg
19,28
50,00
1104520
C10AA05
atorvastatin
ATORIS
film tableta
blister, 30 po 10 mg
Slaviamed d.o.o.
Republika Srbija
440,50
20 mg
29,37
50,00
1104522
C10AA05
atorvastatin
ATORIS
film tableta
blister, 30 po 20 mg
Slaviamed d.o.o.
Republika Srbija
778,00
20 mg
25,93
50,00
1104759
C10AA05
atorvastatin
DISLIPAT
film tableta
blister, 30 po 10 mg
Medico Uno d.o.o.
Republika Srbija
440,50
20 mg
29,37
50,00
Lista A - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1104760
C10AA05
atorvastatin
DISLIPAT
film tableta
blister, 30 po 20 mg
Medico Uno d.o.o.
Republika Srbija
778,00
20 mg
25,93
50,00
1104551
C10AA05
atorvastatin
ATOLIP
film tableta
blister, 30 po 10 mg
Galenika a.d.
Republika Srbija
440,50
20 mg
29,37
50,00
1104552
C10AA05
atorvastatin
ATOLIP
film tableta
blister, 30 po 20 mg
Galenika a.d.
Republika Srbija
778,00
20 mg
25,93
50,00
blister, 30 po 10 mg
Ufar d.o.o. u saradnji
sa Sandoz
Pharmaceuticals d.d.
Slovenija
Republika Srbija
440,50
20 mg
29,37
50,00
Republika Srbija
778,00
20 mg
25,93
50,00
1104601
C10AA05
atorvastatin
TULIP
film tableta
1104600
C10AA05
atorvastatin
TULIP
film tableta
blister, 30 po 20 mg
Ufar d.o.o. u saradnji
sa Sandoz
Pharmaceuticals d.d.
Slovenija
1104555
C10AA05
atorvastatin
HIPOLIP
film tableta
blister, 30 po 10 mg
Hemofarm a.d.
Republika Srbija
440,50
20 mg
29,37
50,00
1104556
C10AA05
atorvastatin
HIPOLIP
film tableta
blister, 30 po 20 mg
Hemofarm a.d.
Republika Srbija
778,00
20 mg
25,93
50,00
1104557
C10AA05
atorvastatin
HIPOLIP
film tableta
blister, 30 po 40 mg
Hemofarm a.d.
Republika Srbija
1.156,80
20 mg
19,28
50,00
1104790
C10AA05
atorvastatin
HIPOLIP
film tableta
blister, 30 po 80 mg
Hemofarm a.d.
Republika Srbija
2.405,20
20 mg
20,04
50,00
atorvastatin
ATORVASTATIN
PHARMAS
film tableta
blister, 30 po 10 mg
PharmaS d.o.o.
Republika Srbija
440,50
20 mg
29,37
50,00
atorvastatin
ATORVASTATIN
PHARMAS
film tableta
blister, 30 po 20 mg
PharmaS d.o.o.
Republika Srbija
778,00
20 mg
25,93
50,00
atorvastatin
ATORVASTATIN
PHARMAS
film tableta
blister, 30 po 40 mg
PharmaS d.o.o.
Republika Srbija
1.156,80
20 mg
19,28
50,00
1104605
1104606
1104607
C10AA05
C10AA05
C10AA05
INDIKACIJE
3RURGLþQDIRUPDKLSHUOLSLGHPLMH(
NAPOMENA
/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMD.OLQLNH]DHQGRNULQHEROHVWLGLMDEHWHVLEROHVWLPHWDEROL]PD.OLQLþNRJFHQWUD6UELMH
C10AA07 rosuvastatin
1104727
C10AA07
rosuvastatin
ROXERA
film tableta
blister, 28 po 5 mg
Slaviamed d.o.o. u
saradnji sa Krka
Tovarna Zdravil d.d,
Slovenija
Republika Srbija
396,20
10 mg
28,30
50,00
Lista A - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1104725
1104728
ATC
C10AA07
C10AA07
INN
rosuvastatin
rosuvastatin
=DãWLüHQRLPH
leka
ROXERA
ROXERA
FO
film tableta
film tableta
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
blister, 28 po 10 mg
Slaviamed d.o.o. u
saradnji sa Krka
Tovarna Zdravil d.d,
Slovenija
Republika Srbija
blister, 28 po 20 mg
Slaviamed d.o.o. u
saradnji sa Krka
Tovarna Zdravil d.d,
Slovenija
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
738,60
10 mg
26,38
50,00
Republika Srbija
1.332,60
10 mg
23,80
50,00
Republika Srbija
1.910,40
10 mg
17,06
50,00
1104726
C10AA07
rosuvastatin
ROXERA
film tableta
blister, 28 po 40 mg
Slaviamed d.o.o. u
saradnji sa Krka
Tovarna Zdravil d.d,
Slovenija
1104771
C10AA07
rosuvastatin
ROSUHOL
film tableta
blister, 30 po 10 mg
PharmaSwiss d.o.o.
Republika Srbija
791,40
10 mg
26,38
50,00
1104772
C10AA07
rosuvastatin
ROSUHOL
film tableta
blister, 30 po 20 mg
PharmaSwiss d.o.o.
Republika Srbija
1.304,00
10 mg
21,73
50,00
1104720
C10AA07
rosuvastatin
ROVESTA
film tableta
blister, 28 po 10 mg
Pharmanova d.o.o.
Republika Srbija
738,60
10 mg
26,38
50,00
1104721
C10AA07
rosuvastatin
ROVESTA
film tableta
blister, 28 po 20 mg
Pharmanova d.o.o.
Republika Srbija
1.332,60
10 mg
23,80
50,00
1104722
C10AA07
rosuvastatin
ROVESTA
film tableta
blister, 28 po 40 mg
Pharmanova d.o.o.
Republika Srbija
1.910,40
10 mg
17,06
50,00
INDIKACIJE
3RURGLþQDIRUPDKLSHUOLSLGHPLMH(
NAPOMENA
/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMD.OLQLNH]DHQGRNULQHEROHVWLGLMDEHWHVLEROHVWLPHWDEROL]PD.OLQLþNRJFHQWUD6UELMH
Fibrati
C10AB
C10AB08 ciprofibrat
1104470
C10AB08
NAPOMENA
ciprofibrat
LIPANOR
kapsula, tvrda
blister, 30 po 100 mg
Sanofi-Synthelabo
Group
Francuska
403,60
/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDLQWHUQLVWHDNRQDNRQWURPHVHþQHGLMHWHWULJOLFHULGLXNUYLQLVXPDQMLRGPPROO
0,1 g
13,45
50,00
Lista A - Grupa D. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
4157100
4150023
Cena leka
Država
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
za
=DãWLüHQRLPHOHND
FO
leka
leka
leka
pakovanje
DDD
.2ä$,327.2ä127.,92/(.29,=$/(ý(1-(%2/(67,.2ä(,327.2ä12*7.,9$'(50$7,&,
ANTIMIKOTICI ZA DERMATOLOŠKU PRIMENU
Antimikotici za lokalnu primenu
Derivati imidazola i triazola
ATC
INN
D
D01
D01A
D01AC
D01AC02 mikonazol
D01AC02
mikonazol
DAKTANOL
krem
fusidinska kiselina
D06AX01
fusidinska kiselina
D06BA01
STANICID
mast
D07AA02
sulfadiazin srebro
SANADERM
krem
D07AC04
198,20
-
-
50,00
hidrkortizon (kortizol)
fluocinolonacetonid
tuba, 1 po 10 g (2%)
Hemofarm a.d.
Republika Srbija
248,50
-
-
50,00
HYDROCORTISON
SINODERM
tuba, 1 po 50 g 1%
Zdravlje a.d.
Republika Srbija
197,30
-
-
50,00
66,90
-
-
50,00
KORTIKOSTEROIDI, DERMATOLOŠKI PREPARATI
Kortikosteroidi, monokomponentni
Kortikosteroidi, slabog delovanja (grupa I)
mast
tuba,1 po 5 g 2,5%
Galenika a.d.
Republika Srbija
Kortikosteroidi jakog delovanja (grupa III)
D07AC
D07AC04 fluocinolonacetonid
4152192
Republika Srbija
Hemioterapeutici za lokalnu primenu
Sulfonamidi
D07
D07A
D07AA
D07AA02 hidrokortizon (kortizol)
4152075
Galenika a.d.
ANTIBIOTICI I HEMIOTERAPEUTICI ZA DERMATOLOŠKU PRIMENU
Antibiotici za lokalnu primenu
Ostali antibiotici za lokalnu primenu
D06
D06A
D06AX
D06AX01
D06B
D06BA
D06BA01 sulfadiazin srebro
4151050
tuba,1 po 30 g 2%
Cena leka Participacija
na veliko osiguranog
po DDD
lica
gel
tuba, 1 po 30 g (0,25
mg/g)
Galenika a.d.
Republika Srbija
120,40
-
-
50,00
Galenika a.d.
Republika Srbija
78,80
-
-
50,00
Galenika a.d.
Republika Srbija
78,80
-
-
50,00
4152190
D07AC04
fluocinolonacetonid
SINODERM
krem
tuba, 1 po 15 g (0,25
mg/g)
4152191
D07AC04
fluocinolonacetonid
SINODERM
mast
tuba,1 po 15 g (0,25
mg/g)
Lista A - Grupa D. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPHOHND
D07C
D07CC
D07CC02 fluocinolonacetonid, neomicin
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
FO
leka
leka
leka
Kortikosteroidi, kombinacije sa antibioticima
Kortikosteroidi jakog delovanja, kombinacije sa antibioticima
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
4153220
D07CC02
fluocinolonacetonid,
neomicin
SINODERM N
krem
tuba,1 po 15 g (0,25
mg/g + 3,3 mg/g)
Galenika a.d.
Republika Srbija
107,20
-
-
50,00
4153221
D07CC02
fluocinolonacetonid,
neomicin
SINODERM N
mast
tuba,1 po 15 g (0,25
mg/g + 3,3 mg/g)
Galenika a.d.
Republika Srbija
107,20
-
-
50,00
1.574,60
-
-
50,00
OSTALI DERMATOLOŠKI PREPARATI
Ostali dermatološki preparati
2VWDOLGHUPDWRORãNLSUHSDUDWLLVNOMXþXMXüLNRUWLNRVWHURLGH
D11
D11A
D11AH
D11AH02 pimekrolimus
4159350
D11AH02
pimekrolimus
ELIDEL
krem
tuba,1 po 15 g (1%)
Novartis Pharma
Produktions GmbH;
Meda Pharma GmbH &
Co. KG
1HPDþND
1HPDþND
INDIKACIJE
1. Atopijski dermatitis ( L20 ).
NAPOMENA
Samo za decu.
Lek se uvodi u terapiju na osnovu mišljenja dermatologa zdravstvene ustanove koja obavlja zdravstvenu delatnost na tercijarnom nivou.
Lista A - Grupa G. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
6137082
ATC
G
G01
G01A
G01AF
G01AF01
metronidazol
G01AF01
metronidazol
INDIKACIJE
NAPOMENA
G01AF04
6137225
G01AF04
INN
Cena leka
Država
na veliko
Cena leka Participacija
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
za
na veliko osiguranog
=DãWLüHQRLPHOHND
FO
leka
leka
leka
pakovanje
DDD
po DDD
lica
*(1,7285,1$51,6,67(0,32/1,+25021,/(.29,=$/(ý(1-(*(1,7285,1$512*6,67(0$,32/1,+25021,
GINEKOLOŠKI ANTIINFEKTIVI I ANTISEPTICI
$QWLLQIHNWLYLLDQWLVHSWLFLLVNOMXþXMXüLNRPELQDFLMDVDNRUWLNRVWHURLGLPD
Derivati imidazola
ORVAGIL
vagitorija
10 po 500 mg
Galenika a.d.
Republika Srbija
202,80
0,5 g
20,28
50,00
7 po 200 mg
Galenika a.d.
Republika Srbija
282,40
0,1 g
20,17
50,00
Republika Srbija
92,70
0,2 mg
7,42
50,00
598,40
-
-
50,00
1. Vaginalna infekcija (N76).
Lek se uvodi u terapiju na osnovu mišljenja ginekologa.
mikonazol
mikonazol
GINO DAKTANOL
vagitorija
INDIKACIJE
1. Vaginalna infekcija (N76).
Lek se uvodi u terapiju na osnovu mišljenja ginekologa.
NAPOMENA
G02
G02A
G02AB
G02AB01 metilergometrin
2141136
G02AB01
metilergometrin
METHYLERGOMETRI
N
oralne kapi, rastvor
OSTALI GINEKOLOŠKI LEKOVI
Preparati za kontrakciju uterusa
Ergot alkaloidi
ERþLFDVDNDSDOMNRPSR
10 ml (0,25 mg/1 ml)
Hemofarm a.d.
1HR]QDþHQSREDþDM2
INDIKACIJE
.UYDUHQMHSRVOHSRURÿDMD2
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja ginekologa.
G02C
Ostali ginekološki lekovi
G02CA
6LPSDWLNRPLPHWLFLNRGSUHYHUHPHQRJSRURÿDMD
G02CA03 fenoterol
1142100
G02CA03
INDIKACIJE
NAPOMENA
fenoterol
PARTUSISTEN
tableta
blister, 50 po 5 mg
3UHYHQFLMDSUHWHüHJSREDþDMDLSUHYUHPHQRJSRURÿDMD2
Lek se uvodi u terapiju na osnovu mišljenja ginekologa.
Boehringer Ingelheim
Ellas A.E.
*UþND
Lista A - Grupa G. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
G02C..
1142200
G02C..
INN
=DãWLüHQRLPHOHND
FO
Cena leka
na veliko
za
pakovanje
DDD
248,40
-
-
50,00
Republika Srbija
150,80
0,75 tabl.
5,39
50,00
Holandija
624,40
0,12 g
62,44
50,00
248,80
0,75 tabl.
8,89
50,00
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
ERþLFDSRPJ
Alkaloid a.d. u saradnji
sa Nycomed Austria
GmbH
Republika
Makedonija
Cena leka Participacija
na veliko osiguranog
po DDD
lica
heksoprenalin
heksoprenalin
GYNIPRAL
tableta
INDIKACIJE
3UHYHQFLMDSUHWHüHJSREDþDMDLSUHYUHPHQRJSRURÿDMD2
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja ginekologa.
POLNI HORMONI I MODULATORI GENITALNOG SISTEMA
G03
G03A
Hormonski kontraceptivi za sistemsku primenu
G03AA
Progestogeni i estrogeni, fiksne kombinacije
G03AA07 levonorgestrel, etinilestradiol
1135240
G03AA07
INDIKACIJE
levonorgestrel,
etinilestradiol
LEGRAVAN
film tableta
blister, 1 po 21 (0,15 mg +
0,03 mg)
Galenika a.d.
1. Hormonska kontracepcija (Z30).
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja ginekologa ili endokrinologa.
G03B
Androgeni
G03BA
Derivati 3-androst-4ona
G03BA03 testosteron
1048111
G03BA03
testosteron
ANDRIOL
TESTOCAPS
kapsula, meka
blister, 30 po 40 mg
N.V. Organon
INDIKACIJE
1. Muški sterilitet (N46);
2UJDQVNDSROQDQHPRüLPSRWHQFLMD1
3. Druge bolesti muških polnih organa (N50).
NAPOMENA
G03F
G03FB
G03FB01
Lek se uvodi u terapiju na osnovu mišljenja urologa ili endokrinologa.
Progestogeni i estrogeni u kombinaciji
Progestogeni i estrogeni, sekvencijalni preparati
norgestrel, estradiol
1048781
G03FB01
norgestrel, estradiol CYCLO-PROGYNOVA
obložena tableta
1 po 21 (11 belih + 10
VPHÿLK
INDIKACIJE
1. Primarna amenoreja (N91.0);
2. Sekundarna amenoreja (N91.1).
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja ginekologa ili endokrinologa.
Schering GmbH & Co.
Produktions KG
1HPDþND
Lista A - Grupa G. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
G03H
G03HA
G03HA01 ciproteron
=DãWLüHQRLPHOHND
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Antiandrogeni
Antiandrogeni, monokomponentni
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
1048331
G03HA01
ciproteron
ANDROCUR
tableta
50 po 50 mg
Delpharm Lille Sas;
Schering AG
Francuska;
1HPDþND
2.185,40
0,1 g
87,42
50,00
1048333
G03HA01
ciproteron
CYPROCUR
tableta
blister, 90 po 50 mg
PharmaSwiss d.o.o.
Republika Srbija
3.933,70
0,1 g
87,42
50,00
INDIKACIJE
1. Organski i izuzetno funkcionalni hiperandrogenizam (N91.4 i L68.0).
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja ginekologa ili urologa ili endokrinologa zdravstvene ustanove koja obavlja zdravstvenu delatnost na sekundarnom
nivou.
Lista A - Grupa H. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
H
H01
H01A
H01AC
H01AC01 somatropin
=DãWLüHQRLPHOHND
Cena leka
Država
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
za
FO
leka
leka
leka
pakovanje
+25021,=$6,67(06.835,0(18,6./-8ý8-8û,32/1(+25021(,,168/,1(
HORMONI HIPOFIZE I HIPOTALAMUSA I ANALOZI
Hormoni prednjeg režnja hipofize i analozi
Somatropin i analozi
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
0044308
H01AC01
somatropin
NORDITROPIN
NORDILET
rastvor za injekciju
pen sa uloškom, 1 po
30 i.j. (10 mg/1,5 ml)
Novo Nordisk A/S
Danska
28.525,40
2 i.j.
1.901,69
50,00
0044309
H01AC01
somatropin
NORDITROPIN
NORDILET
rastvor za injekciju
pen sa uloškom, 1 po
45 i.j. (15 mg/1,5 ml)
Novo Nordisk A/S
Danska
42.788,10
2 i.j.
1.901,69
50,00
1. Nizak rast prouzrokovan nedovoljnim luþenjem ili izostankom luþenja hormona rasta (E23.0), samo kod dece,
INDIKACIJE
2. Turnerov sindrom (Q96), samo kod dece,
3. Kao supstituciona terapija kod osoba sa uroÿenim ili steþenim deficitom hormona rasta (hipopituitarizam) (E23.0),
4. Deca roÿena mala za odreÿeno gestaciono doba (SGA), intrauterusni zastoj u rastenju (P05.1).
NAPOMENA
Lek se u terapiju uvodi na osnovu mišljenja endokrinologa.
H01AC01 somatropin
0044242
H01AC01
somatropin
GENOTROPIN
SUDãDNLUDVWYDUDþ]D
rastvor za injekciju
uložak, 1 po 1 ml (5,3
mg/ml)
Pfizer Manufacturing
Belgium NV
Belgija
8.740,50
2 i.j.
1.099,43
50,00
0044241
H01AC01
somatropin
GENOTROPIN
SUDãDNLUDVWYDUDþ]D
rastvor za injekciju
uložak, 5 po 1 ml (5,3
mg/ml)
Pfizer Manufacturing
Belgium NV
Belgija
43.702,70
2 i.j.
1.099,44
50,00
0044243
H01AC01
somatropin
GENOTROPIN
SUDãDNLUDVWYDUDþ]D
rastvor za injekciju
uložak,1 po 1 ml (12
mg/ml)
Pfizer Manufacturing
Belgium NV
Belgija
19.616,70
2 i.j.
1.089,82
50,00
0044244
H01AC01
somatropin
GENOTROPIN
SUDãDNLUDVWYDUDþ]D
rastvor za injekciju
uložak, 5 po 1 ml (12
mg/ml)
Pfizer Manufacturing
Belgium NV
Belgija
98.083,60
2 i.j.
1.089,82
50,00
INDIKACIJE
NAPOMENA
1. Nizak rast prouzrokovan nedovoljnim luþenjem ili izostankom luþenja hormona rasta (E23.0), samo kod dece,
2. Turnerov sindrom (Q96), samo kod dece,
3. Kao supstituciona terapija kod osoba sa uroÿenim ili steþenim deficitom hormona rasta (hipopituitarizam) (E23.0),
4. Deca roÿena mala za odreÿeno gestaciono doba (SGA), intrauterusni zastoj u rastenju (P05.1),
5. Prader-Willi sindrom (Q87.1).
Lek se u terapiju uvodi na osnovu mišljenja endokrinologa.
Lista A - Grupa H. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
7045080
1045081
=DãWLüHQRLPHOHND
ATC
INN
H01B
H01BA
H01BA02 dezmopresin
H01BA02
H01BA02
dezmopresin
dezmopresin
MINIRIN
MINIRIN
FO
sprej za nos, rastvor
tableta
H02
H02A
H02AB
H02AB02 deksametazon
1047143
H02AB02
deksametazon
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
Hormoni zadnjeg režnja hipofize
Vazopresin i analozi
ERþLFDVDVSUHM
pumpom, 1 po 5 ml
(100 mcg/ml)
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
Ferring AB; Ferring
International Center
SA
Švedska;
Švajcarska
3649,30
25 mcg
182,47
50,00
Ferring AB; Ferring
ERþLFDSODVWLþQDSR International Center
0,2 mg
SA
Švedska;
Švajcarska
3582,40
0,4 mg
238,83
50,00
KORTIKOSTEROIDI ZA SISTEMSKU PRIMENU
Kortikosteroidi za sistemsku primenu, monokomponentni
Glukokortikoidi
DEXASON
tableta
blister, 50 po 0,5 mg
Galenika a.d.
Republika Srbija
307,60
1,5 mg
18,46
50,00
H02AB04 metilprednizolon
1047177
H02AB04
metilprednizolon
NIRYPAN
tableta
blister, 20 po 4 mg
Jugoremedija a.d.
Republika Srbija
185,20
7,5 mg
17,36
50,00
1047180
H02AB04
metilprednizolon
NIRYPAN
tableta
blister, 20 po 8 mg
Jugoremedija a.d.
Republika Srbija
392,00
7,5 mg
18,38
50,00
PRONISON
tableta
20 po 20 mg
Galenika a.d.
Republika Srbija
281,80
10 mg
7,05
50,00
Bosnalijek d.d.
Bosna i
Hercegovina
55,90
10 mg
11,18
50,00
H02AB07 prednizon
1047632
1047511
H02AB07
H02AB07
prednizon
prednizon
PREDNIZON
tableta
H03
H03A
H03AA
H03AA01 levotiroksin natrijum
1040050
1040230
blister, 10 po 5 mg
TERAPIJA BOLESTI TIREOIDEE
Preparati tireoidee
Tireoidni hormoni
H03AA01
levotiroksin
natrijum
TIVORAL
tableta
blister, 50 po 100 mcg
Galenika a.d.
Republika Srbija
152,10
150 mcg
4,56
50,00
H03AA01
levotiroksin
natrijum
EUTHYROX
tableta
50 po 25 mcg
Merck KGaA
1HPDþND
96,10
150 mcg
11,53
50,00
Lista A - Grupa H. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1040190
1040192
ATC
INN
H03B
H03BA
H03BA02 propiltiouracil
H03BA02
H03BA02
propiltiouracil
propiltiouracil
=DãWLüHQRLPHOHND
PTU
PTU
FO
tableta
tableta
H03BB
H03BB02 tiamazol
Participacija
osiguranog
lica
Alkaloid a.d.
Republika
Makedonija
134,40
0,1 g
13,44
50,00
Alkaloid a.d.
Republika
Makedonija
651,50
0,1 g
14,48
50,00
20 po 20 mg
Bosnalijek d.d.
Bosna i
Hercegovina
203,10
10 mg
5,08
50,00
THYROZOL
film tableta
blister, 20 po 5 mg
Merck KGaA
1HPDþND
70,60
10 mg
7,06
50,00
THYROZOL
film tableta
blister, 20 po 10 mg
Merck KGaA
1HPDþND
141,60
10 mg
7,08
50,00
Danska
1.626,60
1 mg
1.626,60
50,00
tiamazol
TIASTAT
1040252
H03BB02
tiamazol
1040250
H03BB02
tiamazol
PANKREASNI HORMONI
*OLNRJHQROLWLþNLKRUPRQL
*OLNRJHQROLWLþNLKRUPRQL
H04
H04A
H04AA
H04AA01 glukagon
glukagon
45 po 100 mg
DDD
Cena leka
na veliko
po DDD
tableta
H03BB02
H04AA01
20 po 50 mg
Cena leka
na veliko
za
pakovanje
Derivati imidazola sa sumporom
1040120
0341340
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
Antitireoidni preparati
Tiouracili
GLUCAGEN HYPOKIT
SUDãDNLUDVWYDUDþ]D
rastvor za injekciju
napunjen injekcioni
špric, 1 po 1 mg/1 ml
Novo Nordisk A/S
Lista A - Grupa J. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
=DãWLüHQRLPHOHND
ATC
J
J01
J01A
J01AA
J01AA02
doksiciklin
1022510
J01AA02
doksiciklin
DOVICIN
1022515
J01AA02
doksiciklin
DOKSICIKLIN
1022500
J01AA02
doksiciklin
DOKSICIKLIN **
1021145
1021148
INN
FO
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
ANTIINFEKTIVNI LEKOVI ZA SISTEMSKU PRIMENU
ANTIBAKTERIJSKI LEKOVI ZA SISTEMSKU PRIMENU
Tetraciklini
Tetraciklini
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
kapsula
5 po 100 mg
Galenika a.d.
Republika Srbija
69,80
0,1 g
13,96
50,00
kapsula, tvrda
blister, 5 po 100 mg
Hemofarm a.d.
Republika Srbija
69,80
0,1 g
13,96
50,00
5 po 100 mg
Jugoremedija a.d.
Republika Srbija
55,50
0,1 g
11,10
50,00
tableta
J01C
J01CA
J01CA04
Beta-laktam antibakterijski lekovi, penicilini
Penicilini širokog spektra dejstva
amoksicilin
J01CA04
amoksicilin
SINACILIN
kapsula, tvrda
blister, 16 po 250 mg
J01CA04
amoksicilin
SINACILIN
kapsula, tvrda
Galenika a.d.
Republika Srbija
96,80
1g
24,20
50,00
blister, 16 po 500 mg
Galenika a.d.
Republika Srbija
138,60
1g
17,33
50,00
prašak za oralnu
suspenziju
ERþLFDRGWDPQRJ
stakla, 1 po 100 ml
(250 mg/5 ml)
Galenika a.d.
Republika Srbija
123,80
1g
24,76
50,00
3021146
J01CA04
amoksicilin
SINACILIN
1021961
J01CA04
amoksicilin
AMOKSICILIN
kapsula, tvrda
blister, 16 po 250 mg
Hemofarm a.d.
Republika Srbija
96,80
1g
24,20
50,00
1021965
J01CA04
amoksicilin
AMOKSICILIN
kapsula, tvrda
blister, 16 po 500 mg
Hemofarm a.d.
Republika Srbija
138,60
1g
17,33
50,00
1021007
J01CA04
amoksicilin
OSPAMOX DT
tableta za oralnu
suspenziju
14 po 1000 mg
Sandoz GmbH
Austrija
240,40
1g
17,17
50,00
3021001
J01CA04
amoksicilin
OSPAMOX
prašak za oralnu
suspenziju
1 po 60 ml (500 mg/5
ml)
Sandoz GmbH
Austrija
121,70
1g
20,28
50,00
1021008
J01CA04
amoksicilin
OSPAMOX DT
tableta za oralnu
suspenziju
14 po 500 mg
Sandoz GmbH
Austrija
119,60
1g
17,09
50,00
263,90
3000000 i.j.
87,97
50,00
3020185
J01CE
J01CE02
fenoksimetilpenicilin
J01CE02
fenoksimetilpenicilin
Penicilini sa spektrom delovanja benzilpenicilina
CLIACIL
prašak za sirup
ERþLFDSRPO
(60000 i.j./ml)
Jugoremedija a.d.
Republika Srbija
Lista A - Grupa J. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
=DãWLüHQRLPHOHND
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
ATC
1020183
J01CE02
fenoksimetilpenicilin
CLIACIL
tableta
blister, 20 po 600000
i.j
Jugoremedija a.d.
Republika Srbija
163,00
3000000 i.j.
40,75
50,00
1020184
J01CE02
fenoksimetilpenicilin
CLIACIL
tableta
blister, 20 po 1200000
i.j.
Jugoremedija a.d.
Republika Srbija
394,00
3000000 i.j.
49,25
50,00
3021606
3021608
3021609
3021568
FO
Cena leka
na veliko
za
pakovanje
JKL
3021602
INN
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
.RPELQDFLMHSHQLFLOLQDXNOMXþXMXüLLNRPELQDFLMHVDLQKLELWRULPDEHWDODNWDPD]H
J01CR
J01CR02
amoksicilin, klavulanska kiselina
J01CR02
amoksicilin,
klavulanska kiselina
J01CR02
amoksicilin,
klavulanska kiselina
J01CR02
amoksicilin,
klavulanska kiselina
J01CR02
amoksicilin,
klavulanska kiselina
J01CR02
amoksicilin,
klavulanska kiselina
PANKLAV
prašak za oralnu
suspenziju
ERþLFDVWDNOHQDSR
100 ml (125 mg/5 ml +
31,25 mg/5 ml)
Hemofarm a.d.
Republika Srbija
269,90
1g
107,96
50,00
PANKLAV FORTE
prašak za oralnu
suspenziju
ERþLFDVWDNOHQDSR
100ml (250 mg/5 ml +
62,5 mg/5 ml)
Hemofarm a.d.
Republika Srbija
448,80
1g
89,76
50,00
PANKLAV 2X
prašak za oralnu
suspenziju
ERþLFDVWDNOHQDSR
70 ml (400 mg/5 ml +
57 mg/5 ml)
Hemofarm a.d.
Republika Srbija
332,10
1g
59,30
50,00
PANKLAV 2X
prašak za oralnu
suspenziju
ERþLFDVWDNOHQDSR
140 ml (400 mg/5 ml +
57 mg/5 ml)
Hemofarm a.d.
Republika Srbija
664,20
1g
59,30
50,00
AMOKSIKLAV 2X
prašak za oralnu
suspenziju
ERþLFDVWDNOHQDSR
70 ml (400 mg+57
mg)/5 ml
Lek farmacevtska
družba d.d.
Slovenija
332,10
1g
59,30
50,00
INDIKACIJE
1. Infekcije gornjeg i donjeg respiratornog trakta ( J00- J06.8; J20; J32; J40; J41; J42 ),
2. Infekcije urogenitalnog trakta ( N30, N34; N36; N37; N39 ),
3. Infekcije srednjeg uha ( H65; H66 ).
NAPOMENA
Sirup samo za decu.
6LUXSVDPR]DRVREHVDSRUHPHüHQLPDNWRPJXWDQMDãWRMHSRWUHEQRQD]QDþLWLQDSROHÿLQLUHFHSWD
Lista A - Grupa J. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
INN
=DãWLüHQRLPHOHND
FO
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
Ostali beta-laktam antibakterijski lekovi
Cefalosporini, I generacija
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
ATC
J01D
J01DB
J01DB01
cefaleksin
3321875
J01DB01
cefaleksin
PALITREX
prašak za oralnu
suspenziju
ERþLFDSRPO
(250 mg/5 ml)
Galenika a.d.
Republika Srbija
173,20
2g
69,28
50,00
1321870
J01DB01
cefaleksin
PALITREX
kapsula, tvrda
blister, 16 po 250 mg
Galenika a.d.
Republika Srbija
135,80
2g
67,90
50,00
1321872
J01DB01
cefaleksin
PALITREX
kapsula, tvrda
blister, 16 po 500 mg
Galenika a.d.
Republika Srbija
253,20
2g
63,30
50,00
ERþLFDVWDNOHQDSR
100 ml (250 mg/5 ml)
Hemofarm a.d.
Republika Srbija
173,20
2g
69,28
50,00
3321719
J01DB01
cefaleksin
CEFALEKSIN
granule za oralnu
suspenziju
1321710
J01DB01
cefaleksin
CEFALEKSIN
kapsula, tvrda
blister, 16 po 250 mg
Hemofarm a.d.
Republika Srbija
135,80
2g
67,90
50,00
1321711
J01DB01
cefaleksin
CEFALEKSIN
kapsula, tvrda
blister, 16 po 500 mg
Hemofarm a.d.
Republika Srbija
253,20
2g
63,30
50,00
347,30
0,5 g
99,23
50,00
INDIKACIJE
1. Infekcije gornjeg i donjeg respiratornog trakta (J00-J06.8; J20; J32; J40; J41; J42),
2. Infekcije urinarnog takta (N30; N34; N36; N37; N39),
,QIHNFLMHX]URNRYDQHX]URþQLFLPDNRMLQHUHDJXMXQDSROXVLQWHWVNHSHQLFLOLQH(&ROL+LQIOXHQ]DH3URWHXV
NAPOMENA
J01DC
J01DC02
=DLQGLNDFLMXSRGWDþNRPSRWUHEQRMHQD]QDþLWLQDSROHÿLQLUHFHSWD
Sirup samo za decu.
6LUXSVDPR]DRVREHVDSRUHPHüHQLPDNWRPJXWDQMDãWRMHSRWUHEQRQD]QDþLWLQDSROHÿLQLUHFHSWD
Cefalosporini, II generacija
cefuroksim
3321644
J01DC02
cefuroksim
XORIMAX
prašak za oralnu
suspenziju
boca staklena, 1 po 70
ml (125 mg/5 ml),
32,90 g
Sandoz GmbH
INDIKACIJE
1. Infekcije donjeg respiratornog trakta (J13; J14; J15; J20; J32; J40; J41; J42),
2. Infekcije kože i i mekog tkiva ( L00-L08 ),
,QIHNFLMHPRNUDüQHEHãLNHLPRNUDüQLKSXWHYD11
4. Lajmska bolest (A69.2).
NAPOMENA
Sirup samo za decu.
6LUXSVDPR]DRVREHVDSRUHPHüHQLPDNWRPJXWDQMDãWRMHSRWUHEQRQD]QDþLWLQDSROHÿLQLUHFHSWD
Austrija
Lista A - Grupa J. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
3321951
ATC
J01DC10
INN
=DãWLüHQRLPHOHND
cefprozil monohidrat
J01DC10
cefprozil monohidrat
CEFZIL
FO
granule za oralnu
suspenziju
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
ERþLFDSRPO
(250 mg/5 ml)
Corden Pharma Latina
S.P.A.
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Italija
780,60
1g
INDIKACIJE
1. Infekcije donjeg respiratornog trakta (J13; J14; J15; J20; J32; J40; J41; J42),
2. Infekcije kože i i mekog tkiva ( L00-L08 ),
,QIHNFLMHPRNUDüQHEHãLNHLPRNUDüQLKSXWHYD11
4. Zapaljenje srednjeg uha ( H66 ).
NAPOMENA
J01DD
J01DD08
Sirup samo za decu.
6LUXSVDPR]DRVREHVDSRUHPHüHQLPDNWRPJXWDQMDRVLPLQGLNDFLMHSRGWDþNRPãWRMHSRWUHEQRQD]QDþLWLQDSROHÿLQLUHFHSWD
Cefalosporini, III generacija
cefiksim
3321621
3321623
J01DD08
J01DD08
INDIKACIJE
NAPOMENA
J01DD13
3321525
J01DD13
INDIKACIJE
NAPOMENA
cefiksim
cefiksim
PANCEF
prašak za oralnu
suspenziju
ERþLFDSRPO
(100 mg/5 ml)
PANCEF
granule za oralnu
suspenziju
ERþLFDSRPO
(100 mg/5 ml)
Cena leka Participacija
na veliko osiguranog
po DDD
lica
260,20
50,00
Alkaloid a.d.
Republika
Makedonija
916,50
0,4 g
183,30
50,00
Alkaloid a.d.
Republika
Makedonija
549,90
0,4 g
183,30
50,00
520,40
0,4 g
260,20
50,00
1. Infekcije donjeg respiratornog trakta (J13; J14; J15; J20; J32; J40; J41; J42);
2. Zapaljenje srednjeg uha (H66);
3. Urinarne infekcije (N00; N10; N30; N34).
6LUXSVDPR]DGHFXLRVREHVDSRUHPHüHQLPDNWRPJXWDQMDãWRMHSRWUHEQRQD]QDþLWLQDSROHÿLQLUHFHSWD
cefpodoksim
cefpodoksim
TRIDOX
prašak za oralnu
suspenziju
ERþLFDSRJ
mg/5 ml)
Alkaloid a.d.
Republika
Makedonija
1. Infekcije donjeg respiratornog trakta (J13; J14; J15; J20; J32; J40; J41; J42);
2. Zapaljenje srednjeg uha (H66);
3. Urinarne infekcije (N00; N10; N30; N34).
6LUXSVDPR]DGHFXLRVREHVDSRUHPHüHQLPDNWRPJXWDQMDãWRMHSRWUHEQRQD]QDþLWLQDSROHÿLQLUHFHSWD
Lista A - Grupa J. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
INN
=DãWLüHQRLPHOHND
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
FO
leka
leka
Sulfonamidi i trimetoprim
.RPELQDFLMHVXOIRQDPLGDVDWULPHWRSULPRPXNOMXþXMXüLGHULYDWH
Cena leka Participacija
na veliko osiguranog
po DDD
lica
ATC
J01E
J01EE
J01EE01
sulfametoksazol, trimetoprim
3026210
J01EE01
sulfametoksazol,
trimetoprim
BACTRIM
sirup
ERþLFDSRPO
(200 mg + 40 mg)/5 ml
Galenika a.d.
Republika Srbija
144,90
1,92 g
57,96
50,00
1026211
J01EE01
sulfametoksazol,
trimetoprim
BACTRIM
tableta
blister, 20 po (400 mg
+ 80 mg)
Galenika a.d.
Republika Srbija
158,60
1,92 g
31,72
50,00
J01F
J01FA
J01FA01
eritromicin
1325152
J01FA01
eritromicin
ERITROMICIN
film tableta
blister, 20 po 250 mg
Hemofarm a.d.
Republika Srbija
225,50
1g
45,10
50,00
1325153
J01FA01
eritromicin
ERITROMICIN
tableta
20 po 500 mg
Hemofarm a.d.
Republika Srbija
372,50
1g
37,25
50,00
1325550
J01FA01
eritromicin
ERITROMICIN
film tableta
blister, 16 po 250 mg
Jugoremedija a.d.
Republika Srbija
180,40
1g
45,10
50,00
1325551
J01FA01
eritromicin
ERITROMICIN
film tableta
blister, 16 po 500 mg
Jugoremedija a.d.
Republika Srbija
298,00
1g
37,25
50,00
3325552
J01FA01
eritromicin
ERITROMICIN
granule za oralnu
suspenziju
ERþLFDSRPO
(125 mg/5 ml)
Jugoremedija a.d.
Republika Srbija
377,30
1g
150,92
50,00
3325553
J01FA01
eritromicin
ERITROMICIN
granule za oralnu
suspenziju
ERþLFDSRPO
(250 mg/5 ml)
Jugoremedija a.d.
Republika Srbija
631,60
1g
126,32
50,00
Makrolidi, linkozamidi i streptogramini
Makrolidi
INDIKACIJE
1. Infekcije respiratornog trakta ( J00-J06; J15.7; J16.0; J20-J32; J40; J41-J42 ),
=DUD]QHEROHVWLFUHYDL]D]YDQHX]URþQLNRP&DPS\OREDFWHU$
3. Bolest legionara ( A48.1; A48.2 ),
4. Infekcije kože i i mekog tkiva ( L00-L08 ),
,QIHNFLMHPRNUDüQLKSXWHYD1
,QIHNFLMHVDJUDPSR]LWLYQLPX]URþQLFLPDNRGEROHVQLNDDOHUJLþQLKQDSHQLFLOLQ<
NAPOMENA
=DLQGLNDFLMXSRGWDþNRPSRWUHEQRMHQD]QDþLWLQDSROHÿLQLUHFHSWD
Sirup samo za decu.
6LUXS]DRVREHVDSRUHPHüHQLPDNWRPJXWDQMDãWRMHSRWUHEQRQD]QDþLWLQDSROHÿLQLUHFHSWD
Lista A - Grupa J. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
ATC
J01FA03
INN
midekamicin
=DãWLüHQRLPHOHND
1325095
J01FA03
midekamicin
MACROPEN
3325096
J01FA03
midekamicin
MACROPEN
JKL
FO
film tableta
granule za oralnu
suspenziju
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
blister, 16 po 400 mg
ERþLFDPOSR
mg/5 ml
Krka Tovarna Zdravil
d.d.
Krka Tovarna Zdravil
d.d.
INDIKACIJE
1. Infekcije respiratornog trakta ( J00-J06; J15.7; J16.0; J20-J32; J40;J41-J42 ),
=DUD]QHEROHVWLFUHYDL]D]YDQHX]URþQLNRP&DPS\OREDFWHU$
3. Bolest legionara ( A48.1; A48.2 ),
4. Infekcije kože i i mekog tkiva ( L00-L08 ),
,QIHNFLMHPRNUDüQLKSXWHYD1
,QIHNFLMHVDJUDPSR]LWLYQLPX]URþQLFLPDNRGEROHVQLNDDOHUJLþQLKQDSHQLFLOLQ<
NAPOMENA
J01FA10
=DLQGLNDFLMXSRGWDþNRPSRWUHEQRMHQD]QDþLWLQDSROHÿLQLUHFHSWD
Sirup samo za decu.
6LUXS]DRVREHVDSRUHPHüHQLPDNWRPJXWDQMDãWRMHSRWUHEQRQD]QDþLWLQDSROHÿLQLUHFHSWD
azitromicin
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Slovenija
240,80
1g
37,63
50,00
Slovenija
391,60
1g
97,29
50,00
Cena leka Participacija
na veliko osiguranog
po DDD
lica
3325483
J01FA10
azitromicin
HEMOMYCIN
prašak za oralnu
suspenziju
ERþLFDVWDNOHQDSR
20 ml (100 mg/5 ml)
Hemofarm a.d.
Republika Srbija
199,60
0,3 g
149,70
50,00
3325481
J01FA10
azitromicin
HEMOMYCIN
prašak za oralnu
suspenziju
ERþLFDSRPO
(200 mg/5 ml)
Hemofarm a.d.
Republika Srbija
238,80
0,3 g
89,55
50,00
3325482
J01FA10
azitromicin
HEMOMYCIN
prašak za oralnu
suspenziju
ERþLFDVWDNOHQDSR
30 ml (200 mg/5 ml)
Hemofarm a.d.
Republika Srbija
358,10
0,3 g
89,53
50,00
3325572
J01FA10
azitromicin
AZITROMICIN
SANDOZ
prašak za oralnu
suspenziju
ERþLFDSODVWLþQDSR
30 ml (200 mg/5 ml)
Sandoz S.R.L.
Rumunija
358,10
0,3 g
89,53
50,00
3325571
J01FA10
azitromicin
AZITROMICIN
SANDOZ
prašak za oralnu
suspenziju
ERþLFDSODVWLþQDSR
20 ml (200 mg/5 ml)
Sandoz S.R.L.
Rumunija
238,80
0,3 g
89,55
50,00
3325570
J01FA10
azitromicin
AZITROMICIN
SANDOZ
prašak za oralnu
suspenziju
ERþLFDSODVWLþQDSR
20 ml (100 mg/5 ml)
Sandoz S.R.L.
Rumunija
199,60
0,3 g
149,70
50,00
3325473
J01FA10
azitromicin
SUMAMED SIRUP
prašak za oralnu
suspenziju
ERþLFDSODVWLþQDSR
20 ml ( 100 mg/5 ml)
Pliva Hrvatska d.o.o.
Hrvatska
199,60
0,3 g
149,70
50,00
Lista A - Grupa J. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
=DãWLüHQRLPHOHND
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
ATC
3325474
J01FA10
azitromicin
SUMAMED FORTE
SIRUP
prašak za oralnu
suspenziju
ERþLFDSODVWLþQDSR
15 ml ( 200 mg/5 ml)
Pliva Hrvatska d.o.o.
Hrvatska
179,10
0,3 g
89,55
50,00
3325475
J01FA10
azitromicin
SUMAMED SIRUP
1200
prašak za oralnu
suspenziju
ERþLFDSODVWLþQDSR
30 ml ( 200 mg/5 ml)
Pliva Hrvatska d.o.o.
Hrvatska
358,10
0,3 g
89,53
50,00
3325477
J01FA10
azitromicin
SUMAMED SIRUP
1200 XL
prašak za oralnu
suspenziju
ERþLFDSODVWLþQDSR
37,5 ml ( 200 mg/5 ml)
Pliva Hrvatska d.o.o.
Hrvatska
447,70
0,3 g
89,54
50,00
1325471
J01FA10
azitromicin
SUMAMED
TABLETE 125
film tableta
blister, 6 po 125 mg
Pliva Hrvatska d.o.o.
Hrvatska
367,80
0,3 g
147,12
50,00
NAPOMENA
J01M
J01MA
J01MA02
FO
Cena leka
na veliko
za
pakovanje
JKL
INDIKACIJE
INN
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
1. Infekcije respiratornog trakta (J00-J06; J15.7; J16.0; J20-J32; J40; J41-J42),
2. Infekcije srednjeg uha (H65; H66),
3. Infekcije kože i i mekog tkiva (L00-L08),
4. Infekcije izazvane Chlamydia-ma (A55; A56),
5. Negonokokni uretritis (N34.1),
6. Cervicitis (N72).
Sirup i tablete samo za decu.
6LUXSVDPR]DRVREHVDSRUHPHüHQLPDNWRPJXWDQMD
Hinolonski antibakterijski lekovi
Fluorohinoloni
ciprofloksacin
1329450
J01MA02
ciprofloksacin
CIPROFLOKSACIN
tableta
10 po 250 mg
Jugoremedija a.d.
Republika Srbija
175,10
1g
70,04
50,00
1329452
J01MA02
ciprofloksacin
CIPROFLOKSACIN
tableta
10 po 500 mg
Jugoremedija a.d.
Republika Srbija
317,40
1g
63,48
50,00
1329451
J01MA02
ciprofloksacin
CIPROFLOKSACIN
tableta
20 po 250 mg
Jugoremedija a.d.
Republika Srbija
350,20
1g
70,04
50,00
1329453
J01MA02
ciprofloksacin
CIPROFLOKSACIN
tableta
20 po 500 mg
Jugoremedija a.d.
Republika Srbija
634,80
1g
63,48
50,00
1329190
J01MA02
ciprofloksacin
CIPROCINAL
film tableta
blister, 10 po 250 mg
Zdravlje a.d.
Republika Srbija
175,10
1g
70,04
50,00
1329192
J01MA02
ciprofloksacin
CIPROCINAL
film tableta
blister, 10 po 500 mg
Zdravlje a.d.
Republika Srbija
317,40
1g
63,48
50,00
1329410
J01MA02
ciprofloksacin
MAROCEN
film tableta
blister, 10 po 250 mg
Hemofarm a.d.
Republika Srbija
175,10
1g
70,04
50,00
1329411
J01MA02
ciprofloksacin
MAROCEN
film tableta
blister, 10 po 500 mg
Hemofarm a.d.
Republika Srbija
317,40
1g
63,48
50,00
Lista A - Grupa J. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
=DãWLüHQRLPHOHND
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
JKL
ATC
INN
1329808
J01MA02
ciprofloksacin
CIPROFLOKSACIN
film tableta
blister, 10 po 250 mg
Srbolek a.d.
Republika Srbija
175,10
1g
70,04
50,00
1329809
J01MA02
ciprofloksacin
CIPROFLOKSACIN
film tableta
blister, 10 po 500 mg
Srbolek a.d.
Republika Srbija
317,40
1g
63,48
50,00
1329400
J01MA02
ciprofloksacin
CITERAL
film tableta
blister, 10 po 250 mg
Alkaloid d.o.o.
Republika Srbija
175,10
1g
70,04
50,00
1329401
J01MA02
ciprofloksacin
CITERAL
film tableta
blister, 10 po 500 mg
Alkaloid d.o.o.
Republika Srbija
317,40
1g
63,48
50,00
1329511
J01MA02
ciprofloksacin
CIPROFLOXACIN
film tableta
blister, 10 po 250 mg
Alvogen d.o.o.
Republika Srbija
175,10
1g
70,04
50,00
1329510
J01MA02
ciprofloksacin
CIPROFLOXACIN
film tableta
blister, 10 po 500 mg
Alvogen d.o.o.
Republika Srbija
317,40
1g
63,48
50,00
INDIKACIJE
J01MA06
=DUD]QHEROHVWLFUHYDL]D]YDQHX]URþQLNRP6DOPRQHOODH$6KLJHOODH$
,QIHNFLMHL]D]YDQHX]URþQLNRP0\FREDFWHULXPWXEHUFXORVLV$$
,QIHNFLMDUHVSLUDWRUQRJWUDNWDL]D]YDQDX]URþQLNRP0\FRSODVPDSQHXPRQLDH-
4. Infekcije urogenitalnog trakta (N30; N34; N36; N37; N39; N72),
5. Zapaljenje srednjeg uha (H66).
norfloksacin
1132310
J01MA06
norfloksacin
NOFOCIN
1132350
J01MA06
norfloksacin
URICIN
1327130
1025859
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
J02
J02A
J02AB
J02AB02
ketokonazol
J02AB02
ketokonazol
tableta
blister, 20 po 400 mg
Srbolek a.d.
Republika Srbija
438,60
0,8 g
43,86
50,00
film tableta
ERþLFDSODVWLþQDSR
400 mg
Slaviamed d.o.o.
Republika Srbija
438,60
0,8 g
43,86
50,00
Republika Srbija
513,10
0,2 g
25,66
50,00
Republika Srbija
339,90
0,6 g
42,49
50,00
ANTIMIKOTICI ZA SISTEMSKU PRIMENU
Antimikotici za sistemsku primenu
Derivati imidazola
J02AC
J04
J04A
J04AB
J04AB02
rifampicin
J04AB02
rifampicin
MYCOSEB
tableta
20 po 200 mg
Hemofarm a.d.
Derivati triazola
ANTITUBERKULOTICI
Lekovi za terapiju tuberkuloze
Antibiotici
RIFAMOR
kapsula, tvrda
blister, 16 po 300 mg
Galenika a.d.
Lista A - Grupa J. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1328230
ATC
J05
J05A
J05AB
J05AB01
aciklovir
J05AB01
aciklovir
INDIKACIJE
NAPOMENA
J05AE
J05AE01
1328372
J05AE01
INN
=DãWLüHQRLPHOHND
ACIKLOVIR
Cena leka
Država
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
za
FO
leka
leka
leka
pakovanje
ANTIVIRUSNI LEKOVI ZA SISTEMSKU PRIMENU
Lekovi sa direktnim delovanjem na viruse
1XNOHR]LGLLQXNOHRWLGLLVNOMLþXMXüLLQKLELWRUHUHYHU]QHWUDQVNULSWD]H
tableta
blister, 25 po 200 mg
672,50
4g
538,00
50,00
/HNVHXYRGLXWHUDSLMXSRGWDþNRPQDRVQRYXPLãOMHQMDGHUPDWRORJDLRIWDOPRORJDSRGWDþNRPQDRVQRYXPLãOMHQMD]GUDYVWYHQHXVWDQRYHNRMDREDYOMD
]GUDYVWYHQXGHODWQRVWQDWHUFLMDUQRPQLYRXDSRGWDþNRPQDRVQRYXPLãOMHQMDLQIHNWRORJD
Inhibitori proteaze
sakvinavir
sakvinavir
INVIRASE
film tableta
120 po 500 mg
1. HIV infekcija ( B20; B21; B22; B23; B24 )
NAPOMENA
J05AE..
Lek se uvodi u terapiju na osnovu mišljenja:
.OLQLNH]DLQIHNWLYQHLWURSVNHEROHVWL.OLQLþNRJFHQWUD6UELMH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD1Lã
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD9RMYRGLQH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD.UDJXMHYDF
lopinavir, ritonavir
J05AE..
Republika Srbija
1. Bolesti oka izazvane virusom Herpes zoster ( B02.3 ),
2. U pripremi bolesnika za transplantaciju bubrega ili drugih organa ( Z94 ),
3. Infekcije uzrokovane virusima Herpes simplex (B00), Herpes zoster (B02) i Varicella (B01).
INDIKACIJE
1328621
Zdravlje a.d.
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
lopinavir, ritonavir
ALUVIA
film tableta
ERþLFDSR
mg + 50 mg)
Roche Pharma S.A.;
F. Hoffmann-La Roche
Ltd.
Švajcarska
30.124,50
1,8 g
903,74
50,00
Abbott GmbH & Co.
KG
1HPDþND
7.322,10
-
-
50,00
Lista A - Grupa J. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1328622
ATC
J05AE..
INDIKACIJE
NAPOMENA
J05AE03
1328615
J05AE03
INDIKACIJE
NAPOMENA
J05AE07
1328120
J05AE07
INDIKACIJE
NAPOMENA
INN
lopinavir, ritonavir
=DãWLüHQRLPHOHND
ALUVIA
FO
film tableta
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Abbott GmbH & Co.
KG
1HPDþND
3.689,00
-
-
50,00
Aesica Queenborough
Ltd
Švajcarska
29.043,90
1,2 g
1.037,28
50,00
Glaxo Wellcome
Operations; Glaxo
Wellcome S.A.
Velika Britanija;
Španija
32.202,50
1,4 g
1.073,42
50,00
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
ERþLFDSRPJ
+ 25 mg)
Cena leka Participacija
na veliko osiguranog
po DDD
lica
1. HIV infekcija ( B20; B21; B22; B23; B24 )
Lek se uvodi u terapiju na osnovu mišljenja:
.OLQLNH]DLQIHNWLYQHLWURSVNHEROHVWL.OLQLþNRJFHQWUD6UELMH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD1Lã
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD9RMYRGLQH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD.UDJXMHYDF
ritonavir
ritonavir
NORVIR
kapsula
336 po 100 mg
1. HIV infekcija ( B20; B21; B22; B23; B24 )
Lek se uvodi u terapiju na osnovu mišljenja:
.OLQLNH]DLQIHNWLYQHLWURSVNHEROHVWL.OLQLþNRJFHQWUD6UELMH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD1Lã
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD9RMYRGLQH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD.UDJXMHYDF
fosamprenavir
fosamprenavir
TELZIR
film tableta
ERþLFDSODVWLþQDSR
700 mg
1. HIV infekcija ( B20; B21; B22; B23; B24 )
Lek se uvodi u terapiju na osnovu mišljenja:
.OLQLNH]DLQIHNWLYQHLWURSVNHEROHVWL.OLQLþNRJFHQWUD6UELMH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD1Lã
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD9RMYRGLQH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD.UDJXMHYDF
Lista A - Grupa J. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1328411
ATC
J05AF
J05AF01
zidovudin
J05AF01
zidovudin
INDIKACIJE
NAPOMENA
J05AF02
1328505
J05AF02
INDIKACIJE
NAPOMENA
J05AF04
1328512
J05AF04
INDIKACIJE
NAPOMENA
INN
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
FO
leka
leka
leka
Inhibitori nukleozidne i nukleotidne reversne transkriptaze
=DãWLüHQRLPHOHND
ZIDOSAN
kapsula, tvrda
ERþLFDSODVWLþQD
po 100 mg
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
Slaviamed d.o.o.
Republika Srbija
7.766,10
0,6 g
465,97
50,00
Bristol Myers-Squibb
Francuska
16.521,20
0,4 g
550,71
50,00
Bristol Myers-Squibb
Švajcarska
12.884,40
80 mg
613,54
50,00
1. HIV infekcija ( B20; B21; B22; B23; B24 )
Lek se uvodi u terapiju na osnovu mišljenja:
.OLQLNH]DLQIHNWLYQHLWURSVNHEROHVWL.OLQLþNRJFHQWUD6UELMH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD1Lã
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD9RMYRGLQH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD.UDJXMHYDF
didanozin
didanozin
VIDEX EC
kapsula
30 po 400 mg
1. HIV infekcija ( B20; B21; B22; B23; B24 )
Lek se uvodi u terapiju na osnovu mišljenja:
.OLQLNH]DLQIHNWLYQHLWURSVNHEROHVWL.OLQLþNRJFHQWUD6UELMH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD1Lã
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD9RMYRGLQH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD.UDJXMHYDF
stavudin
stavudin
ZERIT
kapsula
1. HIV infekcija ( B20; B21; B22; B23; B24 )
Lek se uvodi u terapiju na osnovu mišljenja:
.OLQLNH]DLQIHNWLYQHLWURSVNHEROHVWL.OLQLþNRJFHQWUD6UELMH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD1Lã
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD9RMYRGLQH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD.UDJXMHYDF
56 po 30 mg
Lista A - Grupa J. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1328376
ATC
J05AF05
J05AF05
INN
lamivudin
lamivudin
=DãWLüHQRLPHOHND
ZEFFIX
FO
film tableta
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
28 po 100 mg
GlaxoSmithKline
Pharmaceuticals S.A;
Glaxo Wellcome
Operations
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Poljska; Velika
Britanija
5.741,40
0,3 g
Cena leka Participacija
na veliko osiguranog
po DDD
lica
615,15
50,00
INDIKACIJE
1. Hepatitis acuta B ( B16.2; B16.9 ), teške forme akutnog hepatitisa B (fulminantni, subakutni).
+HSDWLWLVYLUDOLVFKURQLFD%%KURQLþQLKHSDWLWLVNRPSHQ]RYDQD.LGHNRPSHQ]RYDQDFLUR]DMHWUH.
3. Prevencija HBV infekcije kod bolesnika HBsAg pozitivnih na hemioterapiji i sa transplantiranim organima i tkivima
VYLREOLFLKURQLþQLKREROMHQMDMHWUHL]D]YDQLKYLUXVRPKHSDWLWLVD%+%9L+%V$JL
+%V$JĀKURQLþQLKHSDWLWLVNRPSHQ]RYDQDLGHNRPSHQ]RYDQDFLUR]DMHWUHSUHYHQFLMD+%9LQIHNFLMHNRGEROHVQLNDVDWUDQVSODQWLUDQLPRUJDQLPD+%V$J
+URQLþQD+%9LQIHNFLMD
a) HBsAg pozitivan u serumu > 6 meseci
b) prisutna replikacija virusa (HBV DNK-PCR u titru >10 000 kopija/ml seruma)
c) biohemijski povišena aktivnost transaminaza (ALT)>2x iznad normalne vrednosti
d) jedina kontraindikacija je preosetljivost na Zeffix
NAPOMENA
J05AF05
Lek se uvodi u terapiju na osnovu mišljenja infektologa ili hepatologa ili gastroenterologa.
lamivudin
1328375
J05AF05
INDIKACIJE
NAPOMENA
lamivudin
EPIVIR
film tableta
GlaxoSmithKline
Pharmaceuticals S.A;
ERþLFDSODVWLþQDSR
Glaxo Wellcome
150 mg
Operations
1. HIV infekcija ( B20; B21; B22; B23; B24 )
Lek se uvodi u terapiju na osnovu mišljenja:
.OLQLNH]DLQIHNWLYQHLWURSVNHEROHVWL.OLQLþNRJFHQWUD6UELMH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD1Lã
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD9RMYRGLQH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD.UDJXMHYDF
Poljska; Velika
Britanija
10.199,50
0,3 g
339,98
50,00
Lista A - Grupa J. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1328530
ATC
J05AF06
J05AF06
INDIKACIJE
INN
abakavir
abakavir
=DãWLüHQRLPHOHND
FO
ZIAGEN
film tableta
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Glaxo Wellcome
Operations
Velika Britanija
23.461,10
0,6 g
782,04
50,00
Gilead Sciences Ltd.
Irska
29.850,47
0,245 g
995,02
50,00
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
blister, 60 po 300 mg
Cena leka Participacija
na veliko osiguranog
po DDD
lica
1. HIV infekcija ( B20; B21; B22; B23; B24 )
Lek se uvodi u terapiju na osnovu mišljenja:
.OLQLNH]DLQIHNWLYQHLWURSVNHEROHVWL.OLQLþNRJFHQWUD6UELMH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD1Lã
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD9RMYRGLQH
NAPOMENA
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD.UDJXMHYDF
J05AF07 tenofovir
1328500
J05AF07
tenofovir
VIREAD
film tableta
boca, 30 po 245 mg
INDIKACIJE
+URQLþQLKHSDWLWLV%%%%
NAPOMENA
J05AG
J05AG01
Lek se uvodi u terapiju na osnovu mišljenja:
.OLQLNH]DLQIHNWLYQHLWURSVNHEROHVWL.OLQLþNRJFHQWUD6UELMH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD1Lã
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD9RMYRGLQH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD.UDJXMHYDF
5. Vojnomedicinske akademije (VMA).
Inhibitori nenunkleozidne reverzne transkriptaze
nevirapin
3328381
J05AG01
nevirapin
VIRAMUNE
oralna suspenzija
ERþLFDSRPO
(50 mg/5 ml)
Boehringer Ingelheim
Pharma GmbH
1HPDþND
1.696,50
0,4 g
282,75
50,00
1328380
J05AG01
nevirapin
VIRAMUNE
tableta
blister, 60 po 200 mg
Boehringer Ingelheim
Pharma GmbH
1HPDþND
3.461,80
0,4 g
115,39
50,00
INDIKACIJE
NAPOMENA
1. HIV infekcija ( B20; B21; B22; B23; B24 )
Lek se uvodi u terapiju na osnovu mišljenja:
.OLQLNH]DLQIHNWLYQHLWURSVNHEROHVWL.OLQLþNRJFHQWUD6UELMH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD1Lã
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD9RMYRGLQH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD.UDJXMHYDF
Lista A - Grupa J. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1328393
ATC
J05AG03
INN
efavirenz
=DãWLüHQRLPHOHND
J05AG03
efavirenz
STOCRIN
INDIKACIJE
NAPOMENA
J05AR
J05AR01
1328640
J05AR01
INDIKACIJE
NAPOMENA
J05AR02
1328601
J05AR02
INDIKACIJE
NAPOMENA
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
film tableta
ERþLFDSODVWLþQDSR
600 mg
Merck Sharp & Dohme
Holandija
30.070,00
600 mg
1.002,33
50,00
Cena leka Participacija
na veliko osiguranog
po DDD
lica
1. HIV infekcija ( B20; B21; B22; B23; B24 )
Lek se uvodi u terapiju na osnovu mišljenja:
.OLQLNH]DLQIHNWLYQHLWURSVNHEROHVWL.OLQLþNRJFHQWUD6UELMH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD1Lã
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD9RMYRGLQH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD.UDJXMHYDF
Antivirusni lekovi za terapiju HIV infekcija, kombinacije
zidovudin, lamivudin
zidovudin, lamivudin
COMBIVIR
film tableta
blister, 60 po (300 mg
+ 150 mg)
GlaxoSmithKline
Pharmaceuticals S.A.
Poljska
20.758,30
2 tablete
691,94
50,00
Glaxo Wellcome
Operations; Glaxo
Wellcome S.A.
Velika Britanija;
Španija
33.818,10
1 tableta
1.127,27
50,00
1. HIV infekcija ( B20; B21; B22; B23; B24 )
Lek se uvodi u terapiju na osnovu mišljenja:
.OLQLNH]DLQIHNWLYQHLWURSVNHEROHVWL.OLQLþNRJFHQWUD6UELMH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD1Lã
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD9RMYRGLQH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD.UDJXMHYDF
abakavir, lamivudin
abakavir, lamivudin
KIVEXA
film tableta
blister, 30 po (600 mg
+ 300 mg)
1. HIV infekcija ( B20; B21; B22; B23; B24 )
Lek se uvodi u terapiju na osnovu mišljenja:
.OLQLNH]DLQIHNWLYQHLWURSVNHEROHVWL.OLQLþNRJFHQWUD6UELMH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD1Lã
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD9RMYRGLQH
.OLQLNH]DLQIHNWLYQHEROHVWL.OLQLþNRJFHQWUD.UDJXMHYDF
** Lek se briše sa Liste lekova 04. oktobra 2013. godine
Lista A - Grupa L. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
=DãWLüHQRLPHOHND
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
etopozid
1030223
L01CB01
etopozid
LASTET CAP.25
kapsula
blister, 40 po 25 mg
Nippon Kayaku Co. Ltd.
Japan
11.361,80
-
-
50,00
1030222
L01CB01
etopozid
LASTET CAP.50
kapsula
blister, 20 po 50 mg
Nippon Kayaku Co. Ltd.
Japan
9.425,30
-
-
50,00
1030221
L01CB01
etopozid
LASTET CAP.100
kapsula
blister, 10 po 100 mg
Nippon Kayaku Co. Ltd.
Japan
11.361,80
-
-
50,00
Italija
4.238,40
-
-
50,00
Ostali antineoplastici
Ostali antineoplastici
L01X
L01XX
L01XX05
hidroksikarbamid
L01XX05
hidroksikarbamid
INDIKACIJE
NAPOMENA
FO
Cena leka
na veliko
za
pakovanje
ATC
L
L01
L01C
L01CB
L01CB01
1039285
INN
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
ANTINEOPLASTICI I IMUNOMODULATORI
ANTINEOPLASTICI
Biljni alkaloidi i drugi prirodni proizvodi
Derivati podofilotoksina
LITALIR ¸
kapsula
ERþLFDSRPJ
Corden Pharma Latina
S.P.A
+URQLþQHPLMHORSUROLIHUDWLYQHEROHVWLKURQLþQDJUDQXORFLWQDOHXNHPLMDHVHQFLMDOQDWURPERFLWHPLMDSULPDUQDPLMHORILEUR]DSUDYDSROLFLWHPLMD
/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
Institut za onkologiju i radiologiju Srbije,
Klinika za hematologiju KC Srbije,
KBC Bežanijska Kosa,
8QLYHU]LWHWVNDGHþMDNOLQLND
Klinika za hematologiju KC Vojvodine,
.OLQLND]DKHPDWRORJLMXLNOLQLþNXLPXQRORJLMX.&1Lã
KC Kragujevac,
,QVWLWXW]D]GUDYVWYHQX]DãWLWXPDMNHLGHWHWD6UELMHÄ'U9XNDQýXSLü´
Institut za zdravstvenu zaštitu dece i omladine Vojvodine,
.OLQLND]DGHþMHLQWHUQHEROHVWL.&1Lã
Lista A - Grupa L. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1031043
ATC
L01XX11
INN
estramustin
L01XX11
estramustin
=DãWLüHQRLPHOHND
ESTRACYT ¸
FO
kapsula
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
100 po 140 mg
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Italija
11.598,80
-
-
50,00
Pfizer Italia S.R.L.
INDIKACIJE
.DUFLQRPSURVWDWHKRUPRQUHIUDNWRUQLXVOXþDMXNRQWUDLQGLNDFLMD]DSULPHQXGRFHWDNVHOD36LOL
NAPOMENA
L02
L02A
L02AB
L02AB01
/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
Institut za onkologiju i radiologiju Srbije,
Klinika za urologiju KC Srbije,
KBC Bežanijska Kosa,
Institut za onkologiju Vojvodine,
Klinika za urologiju KC Vojvodine,
Klinika za onkologiju KC Niš,
KC Kragujevac.
ENDOKRINOLOŠKA TERAPIJA
Hormoni I srodni lekovi
Progestogeni
megestrol
Cena leka Participacija
na veliko osiguranog
po DDD
lica
3048912
L02AB01
megestrol
MEGACE
oralna suspenzija
ERFDSODVWLþQDSR
240 ml (40 mg/ml)
Bristol Myers-Squibb
Francuska
8.864,60
160 mg
147,74
50,00
1048911
L02AB01
megestrol
MEGACE
tableta
ERþLFDSRPJ
Bristol Myers-Squibb
Francuska
14.455,40
160 mg
144,55
50,00
1048913
L02AB01
megestrol
MEGACE
tableta
ERþLFDSRPJ
Bristol Myers-Squibb
Francuska
4.336,60
160 mg
144,55
50,00
oralna suspenzija
ERFDSODVWLþQDSR
240 ml (40 mg/ml)
Vipharm S.A.
Poljska
8.864,60
160 mg
147,74
50,00
oralna suspenzija
ERFDSODVWLþQDSR
240 ml (40 mg/ml)
PharmaSwiss d.o.o.
Republika Srbija
8.864,60
160 mg
147,74
50,00
3048814
3048951
L02AB01
L02AB01
INDIKACIJE
NAPOMENA
megestrol
megestrol
O' TENTIKA
MEGOXI
7HUDSLMDQHYROMQRJ]QDþDMQRJJXELWNDWHOHVQHWHåLQHNRGSDFLMHQDWDVDQHKHPDWRORãNLPPDOLJQLWHWLPDVROLGQLPWXPRULPD
3DFLMHQWLPRUDMXLPDWLRGPDNOXPDOLJQXEROHVWLWRKRUPRQQH]DYLVQXEROHVWLOLKRUPRQ]DYLVQXDOLXKRUPRQUHIUDNWDUQRMID]LRþHNLYDQRSUHåLYOMDYDQMHSUHNR
PHVHFD36NDRL]QDþDMDQJXELWDNDSHWLWDLLOL]QDþDMDQQHYROMQLJXELWDNWHOHVQHPDVHYHüLRG]DSRVOHGQMLKPHVHFL
Lek se uvodi u terapiju na osnovu mišljenja zdravstvene ustanove koja obavlja zdravstvenu delatnost na sekundarnom ili tercijarnom nivou.
Lista A - Grupa L. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
INN
=DãWLüHQRLPHOHND
FO
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
Hormonski antagonisti i srodni lekovi
Anti-estrogeni
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
ATC
L02B
L02BA
L02BA01
tamoksifen
1039010
L02BA01
tamoksifen
NOLVADEX
film tableta
blister, 30 po 10 mg
AstraZeneca UK Limited
Velika Britanija
323,90
20 mg
21,59
50,00
1039395
L02BA01
tamoksifen
TAMOXIFEN
tableta
30 po 10 mg
Alvogen d.o.o.
Republika Srbija
323,90
20 mg
21,59
50,00
1039396
L02BA01
tamoksifen
TAMOXIFEN
tableta
30 po 20 mg
Alvogen d.o.o.
Republika Srbija
482,70
20 mg
16,09
50,00
L02BB
L02BB03
bikalutamid
1037076
L02BB03
bikalutamid
BICADEX
film tableta
blister, 28 po 50 mg
PharmaSwiss d.o.o.
Republika Srbija
2.096,00
50 mg
74,86
50,00
1037350
L02BB03
bikalutamid
BIKALUTAMID PLIVA
film tableta
blister, 28 po 50 mg
Pliva Hrvatska d.o.o.
Hrvatska
2.096,00
50 mg
74,86
50,00
Antiandrogeni
INDIKACIJE
Lek se primenjuje u kompletnoj androgenoj blokadi uz medikamentoznu (LH-RH analozima) ili hiruršku kastraciju (C61).
NAPOMENA
L02BG
L02BG03
Lek se uvodi u terapiju na osnovu mišljenja tri lekara - urologa zdravstvene ustanove koja obavlja zdravstvenu delatnost na tercijarnom nivou.
Inhibitori enzima aromataze
anastrozol
1039325
L02BG03
anastrozol
ARIMIDEX
film tableta
28 po 1 mg
AstraZeneca UK Limited
Velika Britanija
2.515,60
1 mg
89,84
50,00
1039326
L02BG03
anastrozol
TRASOLETTE
film tableta
blister, 28 po 1 mg
PharmaSwiss d.o.o.
Republika Srbija
2.515,60
1 mg
89,84
50,00
1039720
L02BG03
anastrozol
AREMED
film tableta
blister, 28 po 1 mg
Alvogen d.o.o.
Republika Srbija
2.515,60
1 mg
89,84
50,00
Lista A - Grupa L. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
1039328
L02BG03
INN
anastrozol
=DãWLüHQRLPHOHND
ANASTROZOLE
MEDICO UNO
FO
film tableta
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
blister, 28 po 1 mg
Medico Uno d.o.o.
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Republika Srbija
2.515,60
1 mg
Cena leka Participacija
na veliko osiguranog
po DDD
lica
89,84
50,00
Karcinom dojke:
1. Rani steroid-receptor pozitivni karcinom dojke u postmenopauznih bolesnica, PS 0 ili 1, sekvencijalno, posle tri godine primene adjuvantne hormonske terapije
WDPRNVLIHQRPNDRQDVWDYDNDGMXYDQWQRJOHþHQMDGRXNXSQRJRGLQD2GRYRJDVHL]X]LPDMXEROHVQLFHVD
DUDQLPVWHURLGUHFHSWRUSR]LWLYQLPNDUFLQRPRPGRMNHNRGSRVWPHQRSDX]QLKåHQDVDQLVNLPUL]LNRP]DUHODSVEROHVWLNRGNRMLKüHVHVSURYRGLWLWHUDSLMD
tamoksifenom do 5 godina;
b) ranim steroid-receptor pozitivnim karcinomom dojke u postmenopauznih bolesnica, sa visokim rizikom od relapsa bolesti, kod bolesnica koje nisu podobne za
SULPHQXDGMXYDWQHKHPLRWHUDSLMHLELORãNHWHUDSLMH.RGRYLKEROHVQLFDüHVHSULPHQMLYDWLLQKLELWRULDURPDWD]HRGSRþHWNDDGMXYDQWQRJKRUPRQVNRJOHþHQMDX
trajanju do 5 godina;
INDIKACIJE
2. Postmenopauzne bolesnice sa steroid-receptor pozitivnim metastatskim karcinomom dojke, pri pojavi prvog relapsa bolesti na adjuvantno ili sistemski
primenjen tamoksifen;
3. Kao prva linija sistemske ili adjuvantne terapije kod bolesnica koje imaju kontraindikacije za primenu tamoksifena (glaukom, duboka venska tromboza, CVI ili
embolija u anamnezi) ili pojavu neželjenih reakcija na tamoksifen (dokazana medikamentna alergija, hiperplazija i/ili polip endometrijuma dokazani histopatološki,
ponavaljanje metroragije.
NAPOMENA
L02BG04
Lek se uvodi u terapiju na osnovu mišljenja tri lekara zdravstvene ustanove koja obavlja zdravstvenu delatnost na tercijarnom nivou zdravstvene zaštite, a
nastavak terapije na osnovu mišljenja lekara specijaliste zdravstvene ustanove koja obavlja zdravstvenu delatnost na sekundarnom ili tercijarnom nivou
zdravstvene zaštite.
letrozol
1039331
L02BG04
letrozol
FEMOZOL
film tableta
blister, 30 po 2,5 mg
PharmaSwiss d.o.o.
Republika Srbija
2.695,30
2,5 mg
89,84
50,00
Lista A - Grupa L. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
1039333
L02BG04
INN
letrozol
=DãWLüHQRLPHOHND
FO
LETROZOLE MEDICO
UNO
film tableta
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
blister, 28 po 2,5 mg
Medico Uno d.o.o.
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Republika Srbija
2.515,60
2,5 mg
Cena leka Participacija
na veliko osiguranog
po DDD
lica
89,84
50,00
Karcinom dojke:
1. Rani steroid-receptor pozitivni karcinom dojke u postmenopauznih bolesnica, PS 0 ili 1, sekvencijalno, posle tri godine primene adjuvantne hormonske terapije
WDPRNVLIHQRPNDRQDVWDYDNDGMXYDQWQRJOHþHQMDGRXNXSQRJRGLQD2GRYRJDVHL]X]LPDMXEROHVQLFHVD
DUDQLPVWHURLGUHFHSWRUSR]LWLYQLPNDUFLQRPRPGRMNHNRGSRVWPHQRSDX]QLKåHQDVDQLVNLPUL]LNRP]DUHODSVEROHVWLNRGNRMLKüHVHVSURYRGLWLWHUDSLMD
tamoksifenom do 5 godina;
b) ranim steroid-receptor pozitivnim karcinomom dojke u postmenopauznih bolesnica, sa visokim rizikom od relapsa bolesti, kod bolesnica koje nisu podobne za
SULPHQXDGMXYDWQHKHPLRWHUDSLMHLELORãNHWHUDSLMH.RGRYLKEROHVQLFDüHVHSULPHQMLYDWLLQKLELWRULDURPDWD]HRGSRþHWNDDGMXYDQWQRJKRUPRQVNRJOHþHQMDX
trajanju do 5 godina;
INDIKACIJE
NAPOMENA
L02BG06
1039390
L02BG06
2. Postmenopauzne bolesnice sa steroid-receptor pozitivnim metastatskim karcinomom dojke, pri pojavi prvog relapsa bolesti na adjuvantno ili sistemski
primenjen tamoksifen;
3. Kao prva linija sistemske ili adjuvantne terapije kod bolesnica koje imaju kontraindikacije za primenu tamoksifena (glaukom, duboka venska tromboza, CVI ili
embolija u anamnezi) ili pojavu neželjenih reakcija na tamoksifen (dokazana medikamentna alergija, hiperplazija i/ili polip endometrijuma dokazani histopatološki,
ponavaljanje metroragije.
Lek se uvodi u terapiju na osnovu mišljenja tri lekara zdravstvene ustanove koja obavlja zdravstvenu delatnost na tercijarnom nivou zdravstvene zaštite, a
nastavak terapije na osnovu mišljenja lekara specijaliste zdravstvene ustanove koja obavlja zdravstvenu delatnost na sekundarnom ili tercijarnom nivou
zdravstvene zaštite.
eksemestan
eksemestan
AROMASIN
tableta
30 po 25 mg
Pfizer Italia S.R.L.
Italija
2.695,40
25 mg
89,85
50,00
Lista A - Grupa L. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
1039391
L02BG06
eksemestan
=DãWLüHQRLPHOHND
EXEMESTANE
ALVOGEN
FO
film tableta
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
blister, 30 po 25 mg
Eirgen Pharma Ltd.
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Irska
2.695,40
25 mg
Cena leka Participacija
na veliko osiguranog
po DDD
lica
89,85
50,00
INDIKACIJE
Karcinom dojke:
1. Rani steroid-receptor pozitivni karcinom dojke u postmenopauznih bolesnica, PS 0 ili 1, sekvencijalno, posle tri godine primene adjuvantne hormonske terapije
WDPRNVLIHQRPNDRQDVWDYDNDGMXYDQWQRJOHþHQMDGRXNXSQRJRGLQD2GRYRJDVHL]X]LPDMXEROHVQLFHVD
DUDQLPVWHURLGUHFHSWRUSR]LWLYQLPNDUFLQRPRPGRMNHNRGSRVWPHQRSDX]QLKåHQDVDQLVNLPUL]LNRP]DUHODSVEROHVWLNRGNRMLKüHVHVSURYRGLWLWHUDSLMD
tamoksifenom do 5 godina;
b) ranim steroid-receptor pozitivnim karcinomom dojke u postmenopauznih bolesnica, sa visokim rizikom od relapsa bolesti, kod bolesnica koje nisu podobne za
SULPHQXDGMXYDWQHKHPLRWHUDSLMHLELORãNHWHUDSLMH.RGRYLKEROHVQLFDüHVHSULPHQMLYDWLLQKLELWRULDURPDWD]HRGSRþHWNDDGMXYDQWQRJKRUPRQVNRJOHþHQMDX
trajanju do 5 godina;
2. Postmenopauzne bolesnice sa steroid-receptor pozitivnim metastatskim karcinomom dojke, pri pojavi prvog relapsa bolesti na adjuvantno ili sistemski
primenjen tamoksifen;
3. Kao prva linija sistemske ili adjuvantne terapije kod bolesnica koje imaju kontraindikacije za primenu tamoksifena (glaukom, duboka venska tromboza, CVI ili
embolija u anamnezi) ili pojavu neželjenih reakcija na tamoksifen (dokazana medikamentna alergija, hiperplazija i/ili polip endometrijuma dokazani histopatološki,
ponavaljanje metroragije.
NAPOMENA
L04
L04A
L04AA
L04AA06
Lek se uvodi u terapiju na osnovu mišljenja tri lekara zdravstvene ustanove koja obavlja zdravstvenu delatnost na tercijarnom nivou zdravstvene zaštite, a
nastavak terapije na osnovu mišljenja lekara specijaliste zdravstvene ustanove koja obavlja zdravstvenu delatnost na sekundarnom ili tercijarnom nivou
zdravstvene zaštite.
IMUNOSUPRESIVNA SREDSTVA
Imunosupresivi
Selektivni imunosupresivi
mikofenolna kiselina
1014081
L04AA06
mikofenolna
kiselina
CELLCEPT
kapsula
blister, 300 po 250 mg
F. Hoffmann-La Roche
Ltd.
Švajcarska
23.759,30
2g
633,58
50,00
1014083
L04AA06
mikofenolna
kiselina
CELLCEPT
film tableta
blister, 150 po 500 mg
F. Hoffmann-La Roche
Ltd.
Švajcarska
24.925,30
2g
664,67
50,00
1014094
L04AA06
mikofenolna
kiselina
MICOLAT
kapsula, tvrda
blister, 300 po 250 mg
Lek farmacevtska
družba d.d.
Slovenija
15.584,70
2g
415,59
50,00
1014095
L04AA06
mikofenolna
kiselina
TRIXIN
kapsula, tvrda
blister, 100 po 250 mg
Pliva Hrvatska d.o.o.
Hrvatska
5.194,90
2g
415,59
50,00
INDIKACIJE
Lek se koristi kod transplantacije bubrega, srca ili jetre (Z94.0; Z94.1 ili Z94.4).
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja tri lekara zdravstvene ustanove koja obavlja zdravstvenu delatnost na tercijarnom nivou.
Lista A - Grupa L. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1014260
1014261
ATC
L04AA06
INN
=DãWLüHQRLPHOHND
mikofenolat natrijum
L04AA06
mikofenolat
natrijum
L04AA06
mikofenolat
natrijum
FO
MYFORTIC
gastrorezistentna
tableta
MYFORTIC
gastrorezistentna
tableta
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
blister, 120 po 180 mg
Novartis Pharma Stein
AG
Švajcarska
12.912,80
2g
860,85
50,00
blister, 120 po 360 mg
Novartis Pharma Stein
AG
Švajcarska
25.807,80
2g
860,26
50,00
1.148,06
50,00
INDIKACIJE
Lek se koristi kod transplantacije bubrega (Z94.0).
NAPOMENA
L04AA10
Lek se uvodi u terapiju na osnovu mišljenja tri lekara zdravstvene ustanove koja obavlja zdravstvenu delatnost na tercijarnom nivou.
sirolimus
1014270
L04AA10
sirolimus
RAPAMUNE
obložena tableta
Cena leka Participacija
na veliko osiguranog
po DDD
lica
blister, 30 po 1 mg
Wyeth Pharmaceuticals;
Pfizer Ireland
Pharmaceuticals
Velika Britanija;
Irska
11.480,60
3 mg
INDIKACIJE
.RGEROHVQLNDVDSRJRUãDQRPEXEUHåQRPIXQNFLMRPNDOHPDNRGSRMDYHL]UDåHQHILEUR]HGRND]DQHQDELRSWLþNRPPDWHULMDOXLOLHKRVRQRJUDIVNLVDFLOMHP
XVSRUHQMDSURJUHVLMHKURQLþQHDORJUDIWQHIURSDWLMH=
NAPOMENA
L04AA18
/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVXEVSHFLMDOLVWHRGJRYDUDMXüHJUDQHPHGLFLQH]GUDYVWYHQHXVWDQRYHWHUFLMDUQRJQLYRD]GUDYVWYHQH]DãWLWH
everolimus
1014051
L04AA18
everolimus
CERTICAN
tableta
blister, 60 po 0,25 mg
1014052
L04AA18
everolimus
CERTICAN
tableta
blister, 60 po 0,5 mg
Novartis Pharma Stein
AG
Novartis Pharma Stein
AG
Švajcarska
9.946,10
1,5 mg
994,61
50,00
Švajcarska
18.313,20
1,5 mg
915,66
50,00
INDIKACIJE
Profilaksa odbacivanja organa kod odraslih pacijenata sa malim ili umerenim imunološkim rizikom koji su dobili alogeni transplantat bubrega ili srca (Z94.0;
Z94.1).
NAPOMENA
L04AD
L04AD01
/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVXEVSHFLMDOLVWHRGJRYDUDMXüHJUDQHPHGLFLQH]GUDYVWYHQHXVWDQRYHWHUFLMDUQRJQLYRD]GUDYVWYHQH]DãWLWH
Inhibitori kalcineurina
ciklosporin
1014990
L04AD01
ciklosporin
SANDIMMUN NEORAL
kapsula, meka
blister, 50 po 25 mg
1014992
L04AD01
ciklosporin
SANDIMMUN NEORAL
kapsula, meka
blister, 50 po 50 mg
1014991
L04AD01
ciklosporin
SANDIMMUN NEORAL
kapsula, meka
blister, 50 po 100 mg
Novartis Pharma Stein
AG
Novartis Pharma Stein
AG
Novartis Pharma Stein
AG
Švajcarska
3.740,90
0,25 g
748,18
50,00
Švajcarska
7.201,20
0,25 g
720,12
50,00
Švajcarska
13.441,10
0,25 g
672,06
50,00
Lista A - Grupa L. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
3014999
ATC
L04AD01
INDIKACIJE
NAPOMENA
L04AD02
INN
ciklosporin
=DãWLüHQRLPHOHND
SANDIMMUN NEORAL
FO
oralni rastvor
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
ERþLFDSRPO
(100 mg/1 ml)
Novartis Pharma GMBH
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
1HPDþND
13.042,10
0,25 g
Cena leka Participacija
na veliko osiguranog
po DDD
lica
652,11
50,00
1. Samo za bolesnike nakon transplantacije pojedinih organa ( Z94 ),
,VNOMXþLYR]DQDMWHåHDXWRLPXQHEROHVWLXNROLNRSRVWRMLUH]LVWHQFLMDQDGUXJHLPXQRVXSUHVLYQHOHNRYH
Lek se uvodi u terapiju na osnovu mišljenja tri lekara zdravstvene ustanove koja obavlja zdravstvenu delatnost na tercijarnom nivou.
takrolimus
1014255
L04AD02
takrolimus
PANALIMUS
kapsula, tvrda
blister, 60 po 0,5 mg
Panacea Biotec Ltd.
Indija
1.800,00
5 mg
300,00
50,00
1014256
L04AD02
takrolimus
PANALIMUS
kapsula, tvrda
blister, 60 po 1 mg
Panacea Biotec Ltd.
Indija
3.500,00
5 mg
291,67
50,00
1014257
L04AD02
takrolimus
PANALIMUS
kapsula, tvrda
blister, 100 po 5 mg
Panacea Biotec Ltd.
Indija
65.134,10
5 mg
651,34
50,00
1014250
L04AD02
takrolimus
PROGRAF
kapsula
60 po 1 mg
Astellas
,UVND
8.430,00
5 mg
702,50
50,00
1014251
L04AD02
takrolimus
PROGRAF
kapsula
30 po 5 mg
Astellas
,UVND
19.540,20
5 mg
651,34
50,00
1014252
L04AD02
takrolimus
PROGRAF
kapsula
30 po 0,5 mg
Astellas
,UVND
2.300,50
5 mg
766,83
50,00
INDIKACIJE
/HNVHNRULVWLNRGWUDQVSODQWDFLMHEXEUHJDVUFDLOLMHWUHLOHþHQMDRGEDFLYDQMDDORJHQLKWUDQVSODQWDWDSULSRVWRMDQMXUH]LVWHQFLMHQDSULPHQXGUXJLK
imunosupresivnih lekova (Z94).
NAPOMENA
L04AX
L04AX01
Lek se uvodi u terapiju na osnovu mišljenja tri lekara zdravstvene ustanove koja obavlja zdravstvenu delatnost na tercijarnom nivou.
Ostali imunosupresivi
azatioprin
L04AX01
azatioprin
L04AX03
metotreksat
1034330
L04AX03
metotreksat
1034331
L04AX03
metotreksat
1014020
film tableta
100 po 50 mg
Excella GmbH
1HPDþND
1.926,40
0,15 g
57,79
50,00
METHOTREXAT
"EBEWE"
tableta
kontejner za tablete,
50 po 2,5 mg
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
701,30
2,5 mg
14,03
50,00
METHOTREXAT
"EBEWE"
tableta
kontejner za tablete, 50
po 5 mg
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
1.250,10
2,5 mg
12,50
50,00
IMURAN
Lista A - Grupa M. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
=DãWLüHQRLPHOHND
Cena leka Participacija
na veliko osiguranog
po DDD
lica
ATC
M
M01
M01A
M01AE
M01AE01
ibuprofen
3162033
M01AE01
ibuprofen
BRUFEN
sirup
SODVWLþQDERþLFDSR
100 ml (100 mg/5 ml)
Abbott S.R.L.
Italija
205,30
1,2 g
123,18
50,00
3162533
M01AE01
ibuprofen
IBUPROFEN
sirup
ERþLFDSRPO
(100 mg/5 ml)
Jugoremedija a.d.
Republika Srbija
171,10
1,2 g
102,66
50,00
589,50
12 mg
58,95
50,00
NAPOMENA
M03
M03B
M03BX
M03BX02
1165122
M03BX02
INN
Cena leka
Država
na veliko
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
za
FO
leka
SURL]YRÿDþDOHND
leka
pakovanje
0,â,û12.2671,6,67(0/(.29,=$%2/(67,0,â,û12.26712*6,67(0$
ANTIINFLAMATORNI I ANTIREUMATSKI LEKOVI
Nesteroidni antiinflamatorni i antireumatski proizvodi
Derivati propionske kiseline
DDD
6LUXSVDPRNRGGHFHLRVREDVDSRUHPHüHQLPDNWRPJXWDQMD
0,â,û1,5(/$.6$16,0,25(/$.6$16,
Miorelaksansi sa centralnim delovanjem
Ostali miorelaksansi sa centralnim delovanjem
tizanidin
tizanidin
SIRDALUD
tableta
blister, 30 po 4 mg
Novartis Urunleri
Turska
INDIKACIJE
/HþHQMHSDWRORãNLSRYLãHQRJWRQXVDVNHOHWQLKPLãLüDXRNYLUXRUJDQVNLKQHXURORãNLKSRUHPHüDMDRãWHüHQMHSLUDPLGQRJWUDNWDPXOWLSODVNOHUR]D
FHUHEURYDVNXODUQLSRUHPHüDMPLHORSDWLMDHQFHIDORPLMHOLWLVLWG
NAPOMENA
M04
M04A
M04AA
M04AA01
Lek se uvodi na osnovu mišljenja neurologa ili neuropsihijatra ili fizijatra.
35(3$5$7,=$/(ý(1-(*,+7$
3UHSDUDWL]DOHþHQMHJLKWD
,QKLELWRULVLQWH]HPRNUDüQHNLVHOLQH
alopurinol
1168089
M04AA01
alopurinol
ALOPURINOL
tableta
blister, 40 po 100 mg
Hemofarm a.d.
Republika Srbija
107,70
0,4 g
10,77
50,00
Lista A - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
3087306
3087302
3087303
3087301
3087304
ATC
INN
N
N02
N02A
N02AA
N02AA01 morfin
N02AA01
N02AA01
N02AA01
N02AA01
N02AA01
morfin-hidrohlorid
morfin-sulfat
morfin-sulfat
morfin-sulfat
morfin-sulfat
=DãWLüHQRLPHOHND
MORPHIN MERCK 2%
ORAMORPH
ORAMORPH
ORAMORPH
ORAMORPH
FO
Država
Cena leka na
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
veliko za
leka
leka
leka
pakovanje
NERVNI SISTEM (LEKOVI KOJI DELUJU NA NERVNI SISTEM)
ANALGETICI
Opioidi
Prirodni alkaloidi opijuma
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
oralne kapi, rastvor
ERþLFDVDNDSDOMNRP
po 50 ml (2%)
Merck KGaA
1HPDþND
1.408,30
0,1 g
140,83
50,00
oralni rastvor
kontejner jednodozni,
20 po 5 ml (10 mg/5
ml)
L. Molteni & C. Dei F.
LLI Alitti Societa Di
Esercizio S.P.A.
Italija
1.222,70
0,1 g
611,35
50,00
oralni rastvor
kontejner jednodozni,
20 po 5 ml (30 mg/5
ml)
L. Molteni & C. Dei F.
LLI Alitti Societa Di
Esercizio S.P.A.
Italija
1.222,70
0,1 g
203,78
50,00
L. Molteni & C. Dei F.
LLI Alitti Societa Di
Esercizio S.P.A.
Italija
551,50
0,1 g
137,88
50,00
L. Molteni & C. Dei F.
LLI Alitti Societa Di
Esercizio S.P.A.
Italija
310,40
0,1 g
155,20
50,00
ERþLFDVDNDSDOMNRP
oralne kapi, rastvor po 20 ml (20 mg/ml)
sirup
ERþLFDVWDNOHQDSR
100 ml (10 mg/5ml)
=DOHþHQMHXPHUHQRMDNRJGRMDNRJKURQLþQRJEROD•QD156RGNRGEROHVQLNDVDPDOLJQLPREROMHQMHP
INDIKACIJE
N02AA03 hidromorfon
1087711
1087710
1087715
N02AA03
N02AA03
N02AA03
INDIKACIJE
hidromorfon
hidromorfon
hidromorfon
JURNISTA
tableta sa
produženim
RVOREDÿDQMHP
blister, 14 po 8 mg
Janssen
Pharmaceutica N.V.
Belgija
2.585,20
20 mg
461,64
50,00
JURNISTA
tableta sa
produženim
RVOREDÿDQMHP
14 po 16 mg
Janssen
Pharmaceutica N.V.
Belgija
4.552,60
20 mg
406,48
50,00
JURNISTA
tableta sa
produženim
RVOREDÿDQMHP
28 po 32 mg
Janssen
Pharmaceutica N.V.
Belgija
17.236,30
20 mg
384,74
50,00
=DOHþHQMHXPHUHQRMDNRJGRMDNRJKURQLþQRJEROD•QD156RGNRGEROHVQLNDVDPDOLJQLPREROMHQMHP
Lista A - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
N02AB
N02AB03 fentanil
=DãWLüHQRLPHOHND
9087565
N02AB03
fentanil
DUROGESIC
9087566
N02AB03
fentanil
DUROGESIC
9087568
N02AB03
fentanil
DUROGESIC
9087567
N02AB03
fentanil
DUROGESIC
9087805
9087808
9087802
N02AB03
N02AB03
N02AB03
fentanil
fentanil
fentanil
FENTANYL SANDOZ
MAT
FENTANYL SANDOZ
MAT
FENTANYL SANDOZ
MAT
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Derivafi fenilpiperidina
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Belgija
1.093,90
1,2 mg
62,51
50,00
Belgija
2.187,90
1,2 mg
62,51
50,00
Belgija
3.428,10
1,2 mg
65,30
50,00
Belgija
3.666,30
1,2 mg
52,38
50,00
Cena leka Participacija
na veliko osiguranog
po DDD
lica
transdermalni
flaster
transdermalni
flaster
transdermalni
flaster
transdermalni
flaster
5 po 25 mcg/h ( 5 po
4,2 mg )
5 po 50 mcg/h ( 5 po
8,4 mg )
5 po 75 mcg/h (5 po
12,6 mg)
5 po 100 mcg/h ( 5 po
16,8 mg )
Janssen
Pharmaceutica N.V.
Janssen
Pharmaceutica N.V.
Janssen
Pharmaceutica N.V.
Janssen
Pharmaceutica N.V.
transedermalni
flaster
kesica, 5 po 25 mcg/h
(5 po 5,78 mg/10,5
cm²)
Hexal AG
1HPDþND
1.084,40
1,2 mg
45,03
50,00
transedermalni
flaster
kesica, 5 po 50 mcg/h
(5 po 11,56 mg/21
cm²)
Hexal AG
1HPDþND
2.168,80
1,2 mg
45,03
50,00
transedermalni
flaster
kesica, 5 po 100 mcg/h
(5 po 23,12 mg/42
cm²)
Hexal AG
1HPDþND
3.634,20
1,2 mg
37,73
50,00
Actavis Nordic A/S
Danska
1.084,40
1,2 mg
63,09
50,00
9087201
N02AB03
fentanil
VICTANYL
transdermalni
flaster
kesica, 5 po 25 mcg/h
(5 po 4,125 mg/7,5
cm²)
9087202
N02AB03
fentanil
VICTANYL
transdermalni
flaster
kesica, 5 po 50 mcg/h
(5 po 8,25 mg/15 cm²)
Actavis Nordic A/S
Danska
2.168,80
1,2 mg
63,09
50,00
transdermalni
flaster
kesica, 5 po 75 mcg/h
(5 po 12,375 mg/22,5
cm²)
Actavis Nordic A/S
Danska
3.311,40
1,2 mg
64,22
50,00
9087203
N02AB03
fentanil
VICTANYL
Lista A - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
9087200
ATC
N02AB03
INN
fentanil
=DãWLüHQRLPHOHND
VICTANYL
FO
transdermalni
flaster
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
kesica, 5 po 100 mcg/h
(5 po 16,5 mg/30 cm²)
Actavis Nordic A/S
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Danska
3.634,20
1,2 mg
Cena leka Participacija
na veliko osiguranog
po DDD
lica
52,86
50,00
INDIKACIJE
=DOHþHQMHKURQLþQRJXPHUHQRMDNRJGRMDNRJNDQFHUVNRJERODQDW]YWUHüRMDQDOJHWLþNRMVWHSHQLFL&&
QHVPHVHNRULVWLWLXDNXWQLPSRJRUãDQMLPDKURQLþQRJNDQFHUVNRJERODLWR
NDRRSLRLGGUXJHOLQLMHNRGEROHVQLNDNRGNRMLKVXVHXWRNXOHþHQMDRUDOQLPPRUILQRPUD]YLODQHåHOMHQDGHMVWYDNRMDVHWHãNRNRQWUROLãX
i nisu prihvatljiva za bolesnika;
NDRRSLRLGSUYHOLQLMHNRGEROHVQLNDVDVLPSWRPLPDLNRPSOLNDFLMDPDPDOLJQHEROHVWLNRMHRQHPRJXüDYDMXRUDOQXSULPHQXPRUILQD
þHVWRSRYUDüDQMHNRPSOHWQDPHKDQLþNDRSVWUXNFLMDFUHYDGLVIDJLMD
NDRRSLRLGSUYHOLQLMHNRGEROHVQLNDVDVLPSWRPLPDLNRPSOLNDFLMDPDPDOLJQHEROHVWLNRMHVSUHþDYDMXSULPHQXPRUILQD
LRWHåDYDMXQMHJRYRWLWULUDQMHGRRSWLPDOQHGR]HPXþQLQDSRYUDüDQMHRSVWLSDFLMDQHNRPSOHWQDPHKDQLþNDRSVWUXNFLMDFUHYD
NDRRSLRLGSUYHOLQLMHNRGEROHVQLNDVDRãWHüHQMHPEXEUHåQHIXQNFLMH
NAPOMENA
N02AX
N02AX02
3ULSULPHQLWUDQVGHUPDOQRJIODVWHUDVDIHQWDQLORP]DNRQWUROXSURERMDERODSRYUHPHQRMHQHRSKRGQDWHUDSLMDOHNRYLPDVDVDGUåDMHPPRUILQDNRMLVHEU]RRVOREDÿD
Ostali opioidi
tramadol
1087530
1087650
N02AX02
N02AX02
tramadol
tramadol
TRODON
kapsula, tvrda
blister, 20 po 50 mg
Hemofarm a.d.
Republika Srbija
172,10
0,3 g
51,63
50,00
TRAMAFORT
tableta sa
produženim
RVOREDÿDQMHP
blister, 20 po 100 mg
PharmaSwiss d.o.o.
Republika Srbija
307,00
0,3 g
46,05
50,00
blister, 20 po 150 mg
PharmaSwiss d.o.o.
Republika Srbija
495,10
0,3 g
49,51
50,00
1087651
N02AX02
tramadol
TRAMAFORT
tableta sa
produženim
RVOREDÿDQMHP
1087700
N02AX02
tramadol
TRAMAFLASH
oralna disperzibilna
tableta
blister, 20 po 50 mg
PharmaSwiss d.o.o.
Republika Srbija
172,10
0,3 g
51,63
50,00
TRODON
tableta sa
produženim
RVOREDÿDQMHP
blister, 10 po 100 mg
Hemofarm a.d.
Republika Srbija
153,50
0,3 g
46,05
50,00
TRODON
tableta sa
produženim
RVOREDÿDQMHP
blister, 10 po 200 mg
Hemofarm a.d.
Republika Srbija
307,10
0,3 g
46,07
50,00
1087553
1087550
N02AX02
N02AX02
tramadol
tramadol
Lista A - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
INN
=DãWLüHQRLPHOHND
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Ostali analgetici i antipiretici
Anilidi
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
ATC
N02B
N02BE
N02BE01
paracetamol
3086695
N02BE01
paracetamol
PARACETAMOL
sirup
ERþLFDSRPO
(120 mg/5 ml)
Galenika a.d.
Republika Srbija
150,00
3g
187,50
50,00
3086742
N02BE01
paracetamol
PANATERM
sirup
ERþLFDSODVWLþQDSR
125 ml (120 mg/5 ml)
Sopharma PLC
Bugarska
187,50
3g
187,50
50,00
6LUXSVDPRNRGGHFHLRVREDVDSRUHPHüHQLPDNWRPJXWDQMD
NAPOMENA
N03
N03A
N03AA
N03AA02 fenobarbital (fenobarbiton)
ANTIEPILEPTICI
Antiepileptici
Barbiturati i derivati
1084600
N03AA02
fenobarbital
(fenobarbiton)
FENOBARBITON
tableta
blister, 30 po 100 mg
Galenika a.d.
Republika Srbija
158,10
0,1 g
5,27
50,00
1084210
N03AA02
fenobarbital
(fenobarbiton)
PHENOBARBITON
tableta
blister, 30 po 15 mg
Hemofarm a.d.
Republika Srbija
71,00
0,1 g
15,78
50,00
1084521
N03AA02
fenobarbital
(fenobarbiton)
PHENOBARBITON
tableta
blister, 30 po 100 mg
Hemofarm a.d.
Republika Srbija
158,10
0,1 g
5,27
50,00
Francuska
356,70
1,25 g
44,59
50,00
Republika Srbija
148,90
8 mg
19,85
50,00
Derivati sukcinimida
N03AD
N03AD01 etosuksimid
3084513
N03AD01
INDIKACIJE
NAPOMENA
N03AE
N03AE01
1084402
N03AE01
etosuksimid
SUXINUTIN
sirup
ERþLFDRGWDPQRJ
stakla, 1 po 200 ml
(250 mg/5 ml)
Famar Orleans
1. Epilepsija ( G40-G41 ).
Lek se uvodi u terapiju na osnovu mišljenja neurologa/neuropsihijatra.
Derivati benzodiazepina
klonazepam
klonazepam
RIVOTRIL
tableta
fiola, 30 po 2 mg
Galenika a.d.
Lista A - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1084403
ATC
N03AE01
INN
klonazepam
=DãWLüHQRLPHOHND
RIVOTRIL
FO
tableta
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
ERþLFDSRPJ
Roche Farma S.A; F.
Hoffmann-La Roche
Ltd.
Španija;
Švajcarska
158,70
8 mg
50,78
50,00
Španija;
Švajcarska
148,90
8 mg
19,85
50,00
Kipar
148,90
8 mg
19,85
50,00
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
1084404
N03AE01
klonazepam
RIVOTRIL
tableta
ERþLFDSRPJ
Roche Farma S.A; F.
Hoffmann-La Roche
Ltd.
1084255
N03AE01
klonazepam
KLONAZEPAM
tableta
blister, 30 po 2 mg
Remedica Ltd.
Cena leka Participacija
na veliko osiguranog
po DDD
lica
N03AF
N03AF01
karbamazepin
1084070
N03AF01
karbamazepin
GALEPSIN
tableta
blister, 50 po 200 mg
Galenika a.d.
Republika Srbija
257,10
1g
25,71
50,00
1084060
N03AF01
karbamazepin
KARBAPIN
tableta
blister, 50 po 200 mg
Hemofarm a.d.
Republika Srbija
257,10
1g
25,71
50,00
3084532
N03AF01
karbamazepin
TEGRETOL
oralna suspenzija
1 po 250 ml (2 g/100
ml)
Novartis Pharma S.A.S.
Francuska
388,80
1g
77,76
50,00
1084530
1084351
N03AF01
N03AF01
Derivati karboksamida
karbamazepin
TEGRETOL CR
film tableta sa
modifikovanim
RVOREDÿDQMHP
karbamazepin
CARBAMAZEPINERETARD
tableta sa
modifikovanim
RVOREDÿDQMHP
NAPOMENA
Sirup samo za decu.
N03AG
N03AG01 valproinska kiselina (natrijum valproat)
3084501
1084500
N03AG01
N03AG01
natrijum valproat
EFTIL
natrijum valproat,
valproinska kiselina EFTIL
blister, 30 po 400 mg
Novartis Pharma Stein
AG
Švajcarska
454,60
1g
37,88
50,00
blister, 30 po 400 mg
Alvogen d.o.o.
Republika Srbija
454,60
1g
37,88
50,00
ERþLFDSRPO
(50 mg/ml)
Hemofarm a.d. u
saradnji sa Sanofi
Winthrop Industrie,
Francuska
Republika Srbija
376,30
1,5 g
75,26
50,00
fiola, 30 po (333 mg +
145 mg)
Hemofarm a.d. u
saradnji sa Sanofi
Winthrop Industrie,
Francuska
Republika Srbija
330,80
1,5 g
34,60
50,00
Derivati masnih kiselina
sirup
tableta sa
produženim
RVOREDÿDQMHP
Lista A - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1084817
ATC
N03AG01
INN
valproinska
kiselina, natrijum
valproat
=DãWLüHQRLPHOHND
VALPROIX
FO
tableta sa
produženim
RVOREDÿDQMHP
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
blister, 30 po (145 mg
+ 333 mg)
PharmaSwiss d.o.o.
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Republika Srbija
330,80
1,5 g
34,60
50,00
Cena leka Participacija
na veliko osiguranog
po DDD
lica
N03AX
N03AX09
Ostali antiepileptici
lamotrigin
1084780
N03AX09
lamotrigin
LAMECT
tableta
blister, 30 po 25 mg
PharmaSwiss d.o.o.
Republika Srbija
265,00
0,3 g
106,00
50,00
1084781
N03AX09
lamotrigin
LAMECT
tableta
blister, 30 po 50 mg
PharmaSwiss d.o.o.
Republika Srbija
566,10
0,3 g
113,22
50,00
1084782
N03AX09
lamotrigin
LAMECT
tableta
blister, 30 po 100 mg
Republika Srbija
1.044,10
0,3 g
104,41
50,00
1084550
N03AX09
lamotrigin
LAMICTAL
tableta
blister, 30 po 25 mg
Poljska
265,00
0,3 g
106,00
50,00
1084551
N03AX09
lamotrigin
LAMICTAL
tableta
blister, 30 po 50 mg
Poljska
566,10
0,3 g
113,22
50,00
1084552
N03AX09
lamotrigin
LAMICTAL
blister, 30 po 100 mg
Poljska
1.044,10
0,3 g
104,41
50,00
1084786
N03AX09
lamotrigin
SOLABAN
blister, 30 po 25 mg
Hemofarm a.d.
Republika Srbija
265,00
0,3 g
106,00
50,00
1084788
N03AX09
lamotrigin
SOLABAN
blister, 30 po 50 mg
Hemofarm a.d.
Republika Srbija
566,10
0,3 g
113,22
50,00
1084785
1084827
1084826
1084825
N03AX09
N03AX09
N03AX09
N03AX09
lamotrigin
lamotrigin
lamotrigin
lamotrigin
SOLABAN
LAMOTRAL
LAMOTRAL
LAMOTRAL
tableta
tableta za oralnu
suspenziju
tableta za oralnu
suspenziju
tableta za oralnu
suspenziju
tableta
tableta
tableta
PharmaSwiss d.o.o.
GlaxoSmithKline
Pharmaceuticals S.A.
GlaxoSmithKline
Pharmaceuticals S.A.
GlaxoSmithKline
Pharmaceuticals S.A.
blister, 30 po 100 mg
blister, 30 po 25 mg
blister, 30 po 50 mg
blister, 30 po 100 mg
Hemofarm a.d.
Galenika a.d.
Galenika a.d.
Galenika a.d.
Republika Srbija
Republika Srbija
Republika Srbija
Republika Srbija
1.044,10
265,00
566,10
1.044,10
0,3 g
0,3 g
0,3 g
0,3 g
104,41
106,00
113,22
104,41
50,00
50,00
50,00
50,00
1084080
N03AX09
lamotrigin
LAMAL
tableta
blister, 30 po 25 mg
Alkaloid d.o.o.
Republika Srbija
265,00
0,3 g
106,00
50,00
1084081
N03AX09
lamotrigin
LAMAL
tableta
blister, 30 po 50 mg
Alkaloid d.o.o.
Republika Srbija
566,10
0,3 g
113,22
50,00
1084082
N03AX09
lamotrigin
LAMAL
tableta
blister, 30 po 100 mg
Alkaloid d.o.o.
Republika Srbija
1.044,10
0,3 g
104,41
50,00
1084083
N03AX09
lamotrigin
LAMAL
tableta
blister, 30 po 200 mg
Alkaloid d.o.o.
Republika Srbija
1.730,50
0,3 g
86,53
50,00
1084126
N03AX09
lamotrigin
EPITRIGINE
tableta
30 po 25 mg
Zdravlje a.d.
Republika Srbija
265,00
0,3 g
106,00
50,00
1084127
N03AX09
lamotrigin
EPITRIGINE
tableta
30 po 50 mg
Zdravlje a.d.
Republika Srbija
566,10
0,3 g
113,22
50,00
1084125
N03AX09
lamotrigin
EPITRIGINE
tableta
30 po 100 mg
Zdravlje a.d.
Republika Srbija
1.044,10
0,3 g
104,41
50,00
Lista A - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPHOHND
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
1084121
N03AX09
lamotrigin
EPITRIGINE
oralna disperzibilna
tableta
30 po 2 mg
Zdravlje a.d.
Republika Srbija
103,20
0,3 g
516,00
50,00
1084123
N03AX09
lamotrigin
EPITRIGINE
oralna disperzibilna
tableta
30 po 5 mg
Zdravlje a.d.
Republika Srbija
87,10
0,3 g
174,20
50,00
1084122
N03AX09
lamotrigin
EPITRIGINE
oralna disperzibilna
tableta
30 po 25 mg
Zdravlje a.d.
Republika Srbija
265,00
0,3 g
106,00
50,00
1084124
N03AX09
lamotrigin
EPITRIGINE
oralna disperzibilna
tableta
30 po 50 mg
Zdravlje a.d.
Republika Srbija
566,10
0,3 g
113,22
50,00
1084120
N03AX09
lamotrigin
EPITRIGINE
oralna disperzibilna
tableta
30 po 100 mg
Zdravlje a.d.
Republika Srbija
1.044,10
0,3 g
104,41
50,00
INDIKACIJE
NAPOMENA
N03AX11
1. Epilepsija (G40-G41);
%LSRODUQLSRUHPHüDM)
=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLXWHUDSLMX]DEROHVQLNHVDHSLOHSVLMRPQDRVQRYXPLãOMHQMDQHXURORJDLOLQHXURSVLKLMDWUDLOLSHGLMDWUD
=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDSVLKLMDWUDLOLQHXURORJDLOLQHXURSVLKLMDWUD
topiramat
1084700
N03AX11
topiramat
TOPAMAX
film tableta
blister, 28 po 25 mg
Cilag AG
Švajcarska
306,50
0,3 g
131,36
50,00
1084701
N03AX11
topiramat
TOPAMAX
film tableta
blister, 28 po 50 mg
Cilag AG
Švajcarska
620,40
0,3 g
132,94
50,00
1084702
N03AX11
topiramat
TOPAMAX
film tableta
blister, 28 po 100 mg
Švajcarska
1.226,00
0,3 g
131,36
50,00
1084716
N03AX11
topiramat
TIRAMAT
film tableta
blister, 60 po 25 mg
Hrvatska
562,70
0,3 g
112,54
50,00
1084717
N03AX11
topiramat
TIRAMAT
film tableta
blister, 60 po 50 mg
Hrvatska
1.329,40
0,3 g
132,94
50,00
1084715
N03AX11
topiramat
TIRAMAT
film tableta
blister, 60 po 100 mg
Cilag AG
Belupo Lijekovi i
kozmetika d.d.
Belupo Lijekovi i
kozmetika d.d.
Belupo Lijekovi i
kozmetika d.d.
Hrvatska
2.627,20
0,3 g
131,36
50,00
INDIKACIJE
1. Epilepsija ( G40-G41 ).
NAPOMENA
Samo za bolesnike sa epilepsijom refraktarnom na druge antiepileptike na osnovu mišljenja neurologa/neuropsihijatra ili pedijatra.
Lista A - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
=DãWLüHQRLPHOHND
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
ATC
N03AX12
INN
gabapentin
1084750
N03AX12
gabapentin
KATENA
kapsula, tvrda
blister, 50 po 300 mg
Belupo Lijekovi i
kozmetika d.d.
Hrvatska
1.031,20
1,8 g
123,74
50,00
1084612
N03AX12
gabapentin
NEURONTIN
kapsula, tvrda
blister, 50 po 300 mg
Pfizer Manufacturing
Deutschland GmbH
1HPDþND
1.031,20
1,8 g
123,74
50,00
INDIKACIJE
NAPOMENA
N03AX14
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
1. Epilepsija ( G40).
Lek se uvodi u terapiju na osnovu mišljenja neurologa/neuropsihijatra zdravstvene ustanove koja obavlja zdravstvenu delatnost na tercijarnom nivou.
levetiracetam
1084821
N03AX14
levetiracetam
KEPPRA
film tableta
blister, 60 po 250 mg
UCB Pharma SA
Belgija
1.837,20
1,5 g
183,72
50,00
1084820
N03AX14
levetiracetam
KEPPRA
film tableta
blister, 60 po 500 mg
UCB Pharma SA
Belgija
2.546,40
1,5 g
127,32
50,00
1084822
N03AX14
levetiracetam
KEPPRA
film tableta
UCB Pharma SA
Belgija
4.924,10
1,5 g
123,10
50,00
3084823
N03AX14
levetiracetam
KEPPRA
oralni rastvor
blister, 60 po 1000 mg
ERþLFDVWDNOHQDSR
300 ml (100 mg/ml)
Nextpharma SAS
Francuska
6.241,50
1,5 g
312,08
50,00
1084831
N03AX14
levetiracetam
EPILEV
film tableta
blister, 60 po 250 mg
PharmaSwiss d.o.o.
Republika Srbija
1.837,20
1,5 g
183,72
50,00
1084832
N03AX14
levetiracetam
EPILEV
film tableta
blister, 60 po 500 mg
PharmaSwiss d.o.o.
Republika Srbija
2.546,40
1,5 g
127,32
50,00
1084833
N03AX14
levetiracetam
EPILEV
film tableta
blister, 60 po 1000 mg
PharmaSwiss d.o.o.
Republika Srbija
4.924,10
1,5 g
123,10
50,00
INDIKACIJE
1. Epilepsija - kao monoterapija za bolesnike starije od 16 godina sa refrakternim parcijalnim napadima sa ili bez sekundarne generalizacije (G40);
2. Epilepsija - kao dodatna terapija za bolesnike sa rezistentnom parcijalnom epilepsijom kod odraslih i dece iznad 4 godine starosti (G40);
3. Epilepsija - kao dodatna terapija za bolesnike sa rezistentnomPLRNORQLþQRPHSLOHSVLMRPNRGRGUDVOLKLDGROHVFHQDWDL]QDGJRGLQDVWDURVWLVDMXYHQLOQRP
PLRNORQLþQRPHSLOHSVLMRP*
4. Epilepsija - kao dodatna terapija za bolesnike sa primarnim generalizovanim rezistentnimWRQLþQRNORQLþQLPQDSDGLPDNRGRGUDVOLKLDGROHVFHQDWDL]QDG
godina starosti sa idiopatskom generalizovanom epilepsijom (G40).
NAPOMENA
N03AX16
=DLQGLNDFLMXSRGWDþNRPLOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDQHXURORJDQHXURSVLKLMDWUD]GUDYVWYHQHXVWDQRYHNRMDREDYOMD]GUDYVWYHQX
delatnost na tercijarnom nivou.
pregabalin
1084736
N03AX16
pregabalin
LYRICA
kapsula, tvrda
56 po 75 mg
Pfizer Manufacturing
Deutschland GmbH
1HPDþND
2.095,50
0,3 g
149,68
50,00
Lista A - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPHOHND
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
1084738
N03AX16
pregabalin
LYRICA
kapsula, tvrda
56 po 150 mg
Pfizer Manufacturing
Deutschland GmbH
1HPDþND
3.151,20
0,3 g
112,54
50,00
1084745
N03AX16
pregabalin
LYRICA
kapsula, tvrda
56 po 300 mg
Pfizer Manufacturing
Deutschland GmbH
1HPDþND
6.302,40
0,3 g
112,54
50,00
1. Adjuvantna terapija parcijalnih konvuzija sa ili bez sekundarne generalizacije kod odraslih bolesnika (G 40).
*HQHUDOL]RYDQLDQNVLR]QLSRUHPHüDM)NRGRGUDVOLKSRVOHQH]DGRYROMDYDMXüHJRGJRYRUDQDGYDSUHWKRGQRSULPHQMHQDDQWLGHSUHVLYD
=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDQHXURORJDQHXURSVLKLMDWUDD]DLQGLNDFLMXSRGWDþNRPQDRVQRYXPLãOMHQMD
psihijatra/neuropsihijatra
NAPOMENA
N04
ANTIPARKINSONICI
N04A
$QWLKROLQHUJLþNLOHNRYL
N04AA
Tercijarni amini
N04AA02 biperiden
INDIKACIJE
1085320
N04AA02
biperiden
MENDILEX
tableta
blister, 50 po 2 mg
Alkaloid a.d.
Republika
Makedonija
169,80
10 mg
16,98
50,00
Republika Srbija
2.125,70
0,6 g
63,77
50,00
Švajcarska
2.125,70
0,6 g
63,77
50,00
1HPDþND
440,70
0,2 g
29,38
50,00
Lek se uvodi u terapiju na osnovu mišljenja neurologa ili neuropsihijatra ili psihijatra.
NAPOMENA
N04B
'RSDPLQHUJLþNLOHNRYL
N04BA
Dopa I derivati dope
N04BA02 levodopa, benzerazid
1085212
N04BA02
levodopa,
benzerazid
1085307
N04BA02
levodopa,
benzerazid
INDIKACIJE
MADOPAR
tableta
boca staklena,100 po
250 mg (200 mg + 50
mg)
MADOPAR ROCHE
tableta
ERþLFDSRPJ F. Hoffmann-La Roche
(200 mg + 50 mg)
Ltd.
Galenika a.d.
1. Parkinsonova bolest ( G20; G21; G22 ).
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja neurologa/neuropsihijatra.
N04BB
Derivati amantadina
N04BB01 amantadin sulfat
1085350
N04BB01
INDIKACIJE
NAPOMENA
amantadin sulfat
PK MERZ
tableta
30 po 100 mg
1. Parkinsonova bolest ( G20; G21; G22 ).
Lek se uvodi u terapiju na osnovu mišljenja neurologa/neuropsihijatra.
Merz Pharmaceuticals
GmbH
Lista A - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1149040
ATC
INN
N04BC
N04BC01 bromokriptin
N04BC01
bromokriptin
=DãWLüHQRLPHOHND
BROMOKRIPTIN
FO
tableta
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Agonisti dopamina
blister, 30 po 2,5 mg
Zdravlje a.d.
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Republika Srbija
274,80
40 mg
146,56
50,00
97,70
300 mg
23,45
50,00
Cena leka Participacija
na veliko osiguranog
po DDD
lica
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja neurologa/neuropsihijatra ili endokrinologa.
PSIHOLEPTICI
N05
Antipsihotici
N05A
N05AA
)HQRWLD]LQLVDDOLIDWLþQLPERþQLPODQFHP
N05AA01 hlorpromazin
1070056
N05AA01
hlorpromazin
LARGACTIL
film tableta
SODVWLþQDILRODSR
25 mg
Galenika a.d.
Republika Srbija
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja psihijatra/neuropsihijatra.
Fenotiazini sa piperazinskom strukturom
N05AB
N05AB02 flufenazin
1070850
N05AB02
flufenazin
METOTEN
obložena tableta
25 po 1 mg
Hemofarm a.d.
Republika Srbija
112,60
10 mg
45,04
50,00
1070851
N05AB02
flufenazin
METOTEN
obložena tableta
25 po 5 mg
Hemofarm a.d.
Republika Srbija
348,20
10 mg
27,86
50,00
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja psihijatra/neuropsihijatra.
Derivati butirofenona
N05AD
N05AD01 haloperidol
1070841
N05AD01
haloperidol
HALOPERIDOL
tableta
Hemofarm a.d.
Republika Srbija
465,70
8 mg
12,42
50,00
tableta
tableta
blister, 30 po 10 mg
SODVWLþQDERþLFD
po 2 mg
blister, 25 po 2 mg
1070840
1070800
N05AD01
N05AD01
haloperidol
haloperidol
HALOPERIDOL
HALOPERIDOL
Hemofarm a.d.
Zdravlje a.d.
Republika Srbija
Republika Srbija
229,50
229,50
8 mg
8 mg
36,72
36,72
50,00
50,00
1070801
N05AD01
haloperidol
HALOPERIDOL
tableta
blister, 30 po 10 mg
Zdravlje a.d.
Republika Srbija
465,70
8 mg
12,42
50,00
Lek se uvodi u terapiju na osnovu mišljenja psihijatra/neuropsihijatra.
NAPOMENA
Diazepini, oksazepini I tiazepini
N05AH
N05AH03 olanzapin
1070018
N05AH03
olanzapin
TREANA
film tableta
blister, 30 po 5 mg
Hemofarm a.d.
Republika Srbija
1.052,60
10 mg
70,17
50,00
1070017
N05AH03
olanzapin
TREANA
film tableta
blister, 30 po 10 mg
Hemofarm a.d.
Republika Srbija
2.105,40
10 mg
70,18
50,00
1070087
N05AH03
olanzapin
TREANA
oralna disperzibilna
tableta
blister, 28 po 5 mg
Hemofarm a.d.
Republika Srbija
982,50
10 mg
70,18
50,00
Lista A - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPHOHND
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
oralna disperzibilna
tableta
blister, 28 po 10 mg
Hemofarm a.d.
Republika Srbija
1.965,00
10 mg
70,18
50,00
SIZAP
film tableta
blister, 30 po 5 mg
Alkaloid d.o.o.
Republika Srbija
1.052,60
10 mg
70,17
50,00
olanzapin
SIZAP
film tableta
blister, 30 po 10 mg
Alkaloid d.o.o.
Republika Srbija
2.105,40
10 mg
70,18
50,00
N05AH03
olanzapin
ONZAPIN
film tableta
blister, 28 po 5 mg
Zdravlje a.d.
Republika Srbija
982,50
10 mg
70,18
50,00
1070023
N05AH03
olanzapin
ONZAPIN
film tableta
blister, 28 po 10 mg
Zdravlje a.d.
Republika Srbija
1.965,00
10 mg
70,18
50,00
1070024
N05AH03
olanzapin
ONZAPIN
film tableta
blister, 28 po 15 mg
Zdravlje a.d.
Republika Srbija
2.947,60
10 mg
70,18
50,00
Republika Srbija
397,40
1800 mg
23,84
50,00
1070088
N05AH03
olanzapin
TREANA
1070027
N05AH03
olanzapin
1070028
N05AH03
1070025
INDIKACIJE
âL]RIUHQLMDãL]RWLSVNLSRUHPHüDMLLSRUHPHüDMLVDVXPDQXWRãüX))
0DQLþQDHSL]RGDVDSVLKRWLþQLPVLPSWRPLPD)
%LSRODUQLDIHNWLYQLSRUHPHüDMPDQLþQDHSL]RGDVDSVLKRWLþQLPVLPSWRPLPD)
%LSRODUQLDIHNWLYQLSRUHPHüDMXUHPLVLML)
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra.
N05AN
N05AN01 litijum (karbonat)
1070885
N05AN01
NAPOMENA
N05AX
N05AX08
litijum karbonat
LITIJUM KARBONAT
kapsula
100 po 300 mg
Litijum
Srbolek a.d.
Lek se uvodi u terapiju na osnovu mišljenja psihijatra/neuropsihijatra.
Ostali antipsihotici
risperidon
1070920
N05AX08
risperidon
RISPOLEPT
film tableta
blister, 20 po 1 mg
Janssen-Cilag S.P.A.
Italija
280,70
5 mg
70,18
50,00
1070921
N05AX08
risperidon
RISPOLEPT
film tableta
blister, 20 po 2 mg
Janssen-Cilag S.P.A.
Italija
561,40
5 mg
70,18
50,00
Lista A - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPHOHND
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
1070922
N05AX08
risperidon
RISPOLEPT
film tableta
blister, 20 po 3 mg
Janssen-Cilag S.P.A.
Italija
842,20
5 mg
70,18
50,00
1070923
N05AX08
risperidon
RISPOLEPT
film tableta
blister, 20 po 4 mg
Janssen-Cilag S.P.A.
Italija
1.122,80
5 mg
70,18
50,00
1070034
N05AX08
risperidon
RISPERIDON
film tableta
blister, 20 po 1 mg
Hemofarm a.d.
Republika Srbija
280,70
5 mg
70,18
50,00
1070035
N05AX08
risperidon
RISPERIDON
film tableta
blister, 20 po 2 mg
Hemofarm a.d.
Republika Srbija
561,40
5 mg
70,18
50,00
1070036
N05AX08
risperidon
RISPERIDON
film tableta
blister, 20 po 3 mg
Hemofarm a.d.
Republika Srbija
842,20
5 mg
70,18
50,00
1070037
N05AX08
risperidon
RISPERIDON
film tableta
blister, 20 po 4 mg
Hemofarm a.d.
Republika Srbija
1.122,80
5 mg
70,18
50,00
blister, 20 po 2 mg
Slaviamed d.o.o. u
saradnji sa Krka
Tovarna Zdravil d.d,
Slovenija
Republika Srbija
561,40
5 mg
70,18
50,00
Republika Srbija
842,20
5 mg
70,18
50,00
1070063
N05AX08
risperidon
TORENDO
film tableta
1070066
N05AX08
risperidon
TORENDO
film tableta
blister, 20 po 3 mg
Slaviamed d.o.o. u
saradnji sa Krka
Tovarna Zdravil d.d,
Slovenija
1070935
N05AX08
risperidon
RISSAR
film tableta
blister, 20 po 1 mg
Alkaloid d.o.o.
Republika Srbija
280,70
5 mg
70,18
50,00
1070928
N05AX08
risperidon
RISSAR
film tableta
blister, 20 po 2 mg
Alkaloid d.o.o.
Republika Srbija
561,40
5 mg
70,18
50,00
1070929
N05AX08
risperidon
RISSAR
film tableta
blister, 20 po 3 mg
Alkaloid d.o.o.
Republika Srbija
842,20
5 mg
70,18
50,00
1070004
N05AX08
risperidon
SPERIDAN
film tableta
blister, 20 po 1 mg
Zdravlje a.d.
Republika Srbija
280,70
5 mg
70,18
50,00
1070001
N05AX08
risperidon
SPERIDAN
film tableta
blister, 20 po 2 mg
Zdravlje a.d.
Republika Srbija
561,40
5 mg
70,18
50,00
1070002
N05AX08
risperidon
SPERIDAN
film tableta
blister, 20 po 3 mg
Zdravlje a.d.
Republika Srbija
842,20
5 mg
70,18
50,00
Lista A - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1070003
ATC
N05AX08
INN
risperidon
=DãWLüHQRLPHOHND
SPERIDAN
FO
film tableta
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
blister, 20 po 4 mg
Zdravlje a.d.
INDIKACIJE
âL]RIUHQLMDãL]RWLSVNLSRUHPHüDMLLSRUHPHüDMLVDVXPDQXWRãüX))
%LSRODUQLDIHNWLYQLSRUHPHüDM)
3UROD]QDSVLKRWLþQDVWDQMDNRGRUJDQVNLKSRUHPHüDMD))))
NAPOMENA
N05AX08
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra ili neurologa.
risperidon
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Republika Srbija
1.122,80
5 mg
70,18
50,00
Cena leka Participacija
na veliko osiguranog
po DDD
lica
2070924
N05AX08
risperidon
RISPOLEPT
rastvor za oralnu
upotrebu
boca staklena,100 ml
(1 mg/ml)
Janssen
Pharmaceutica N.V.
Belgija
2.667,30
5 mg
133,37
50,00
2070936
N05AX08
risperidon
RISPOLEPT
oralni rastvor
ERþLFDVWDNOHQDSR
30 ml (1 mg/ml)
Janssen
Pharmaceutica N.V.
Belgija
1.235,80
5 mg
205,97
50,00
INDIKACIJE
âL]RIUHQLMDãL]RWLSVNLSRUHPHüDMLLSRUHPHüDMLVDVXPDQXWRãüX))
%LSRODUQLDIHNWLYQLSRUHPHüDM)
3UROD]QDSVLKRWLþQDVWDQMDNRGRUJDQVNLKSRUHPHüDMD))))
0HQWDOQDUHWDUGDFLMDVD]QDþDMQLPSRUHPHüDMHPSRQDãDQMDNRML]DKWHYDSDåQMXLOLWUHWPDQ))))))
+LSHUNLQHWLþNLSRUHPHüDMSRQDãDQMD)
3RUHPHüDMLSRQDãDQMD)
Za indikaciju pod taþ. 1. i 2. samo za odrasle osobe sa poremeüenim aktom gutanja.
Za indikaciju pod taþ. 3, 4, 5. i 6. samo za decu stariju od 5 godina i odrasle osobe sa poremeüenim aktom gutanja.
Prilikom propisivanja leka za pacijente sa poremeüenim aktom gutanja, izabrani lekar je u obavezi da na lekarskom receptu u delu "dijagnoza" posle odgovarajuüe šifre, u skladu sa
MKB-10 klasifikacijom, upiše slovo A, što ukazuje da se lek nalazi na Listi A.
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra ili neurologa.
NAPOMENA
N05B
N05BA
N05BA01 diazepam
Anksiolitici
Derivati benzodiazepina
N002592
N05BA01
diazepam
DIAZEPAM
rastvor za rektalnu
primenu
5 po 5 mg/2,5 ml
Apoteka-galenska
laboratorija
Republika Srbija
452,50
10 mg
181,00
50,00
1071121
N05BA01
diazepam
BENSEDIN
tableta
30 po 5 mg
Galenika a.d.
Republika Srbija
108,90
10 mg
7,26
50,00
1071122
N05BA01
diazepam
BENSEDIN
tableta
30 po 10 mg
Galenika a.d.
Republika Srbija
145,10
10 mg
4,84
50,00
1071701
N05BA01
diazepam
DIAZEPAM
tableta
blister, 30 po 5 mg
Hemofarm a.d.
Republika Srbija
108,90
10 mg
7,26
50,00
Lista A - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPHOHND
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
1071702
N05BA01
diazepam
DIAZEPAM
tableta
blister, 30 po 10 mg
Hemofarm a.d.
Republika Srbija
145,10
10 mg
4,84
50,00
1071786
N05BA01
diazepam
DIAZEPAM
tableta
blister, 30 po 5 mg
Jugoremedija a.d.
Republika Srbija
74,10
10 mg
4,94
50,00
/HNSURSLVXMHL]DEUDQLOHNDUEH]PLãOMHQMDOHNDUDVSHFLMDOLVWHRGUHÿHQHJUDQHPHGLFLQHGRWULPHVHFDXWRNXPHVHFLDQDVWDYDNWHUDSLMHX]PLãOMHQMHOHNDUD
VSHFLMDOLVWHRGUHÿHQHJUDQHPHGLFLQHSVLKLMDWUDLOLQHXURSVLKLMDWUDLOLQHXURORJD
NAPOMENA
N06
PSIHOANALEPTICI
N06A
Antidepresivi
N06AA
Neselektivni inhibitori preuzimanja monoamina
N06AA09 amitriptilin
1072762
N06AA09
amitriptilin
AMITRIPTYLINE
film tableta
blister, 100 po 10 mg
Remedica Ltd.
Kipar
194,40
75 mg
14,58
50,00
1072763
N06AA09
amitriptilin
AMITRIPTYLINE
film tableta
blister, 30 po 25 mg
Remedica Ltd.
Kipar
90,30
75 mg
9,03
50,00
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra ili neurologa.
N06AA21 maprotilin
1072730
N06AA21
maprotilin
MAPROTILIN
film tableta
blister, 30 po 25 mg
Zdravlje a.d.
Republika Srbija
127,90
0,1 g
17,05
50,00
1072731
N06AA21
maprotilin
MAPROTILIN
film tableta
blister, 30 po 50 mg
Zdravlje a.d.
Republika Srbija
272,80
0,1 g
18,19
50,00
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra ili neurologa.
N06AB
Selektivni inhibitori preuzimanja serotonina
N06AB03 fluoksetin
1072700
N06AB03
fluoksetin
FLUNIRIN
kapsula, tvrda
blister, 30 po 20 mg
Galenika a.d.
Republika Srbija
357,40
20 mg
11,91
50,00
1072930
N06AB03
fluoksetin
FLUNISAN
tableta
blister, 30 po 20 mg
Hemofarm a.d.
Republika Srbija
357,40
20 mg
11,91
50,00
INDIKACIJE
1. Depresivna epizoda (F32),
5HNXUHQWQLGHSUHVLYQLSRUHPHüDM)
2SVHVLYQRNRPSXOVLYQLSRUHPHüDM)
4. Bulimija nervosa (F50.2).
NAPOMENA
=DLQGLNDFLMXSRGWDþNRPVDPR]DRVREHVWDULMHRGJRGLQD
=DLQGLNDFLMXSRGWDþNRPLVDPR]DRVREHVWDULMHRGJRGLQD
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra ili neurologa.
Lista A - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
N06AB04 citalopram
=DãWLüHQRLPHOHND
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
1072062
N06AB04
citalopram
CITALEX
film tableta
blister, 20 po 10 mg
Zdravlje a.d.
Republika Srbija
119,10
20 mg
11,91
50,00
1072061
N06AB04
citalopram
CITALEX
film tableta
blister, 20 po 20 mg
Zdravlje a.d.
Republika Srbija
238,30
20 mg
11,92
50,00
1072067
N06AB04
citalopram
CITALEX
film tableta
blister, 50 po 10 mg
Zdravlje a.d.
Republika Srbija
297,90
20 mg
11,92
50,00
1072060
N06AB04
citalopram
CITALEX
film tableta
blister, 50 po 20 mg
Zdravlje a.d.
Republika Srbija
595,70
20 mg
11,91
50,00
1072706
N06AB04
citalopram
TIMOPRAM
film tableta
blister, 30 po 20 mg
PharmaSwiss d.o.o.
Republika Srbija
357,40
20 mg
11,91
50,00
1. Depresivna epizoda (F32),
5HNXUHQWQLGHSUHVLYQLSRUHPHüDM)
3. Agorafobija (F40.0),
4. Socijalna fobija (F40.1)
'UXJLDQNVLR]QLSRUHPHüDML)
INDIKACIJE
2UJDQVNLSRUHPHüDMLUDVSRORåHQMD)
Samo za osobe starije od 18 godina.
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra ili neurologa.
N06AB05 paroksetin
1072915
N06AB05
paroksetin
ACTAPAX
film tableta
blister, 30 po 20 mg
Zdravlje a.d.
Republika Srbija
357,50
20 mg
11,92
50,00
1072916
N06AB05
paroksetin
ACTAPAX
film tableta
blister, 30 po 30 mg
Zdravlje a.d.
Republika Srbija
536,30
20 mg
11,92
50,00
1072907
N06AB05
paroksetin
PAROKSETIN
PHARMAS
film tableta
blister, 30 po 20 mg
PharmaS d.o.o.
Republika Srbija
357,50
20 mg
11,92
50,00
Lista A - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1072909
ATC
N06AB05
INDIKACIJE
INN
paroksetin
=DãWLüHQRLPHOHND
PAROKSETIN
PHARMAS
FO
film tableta
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
blister, 30 po 30 mg
PharmaS d.o.o.
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Republika Srbija
536,30
20 mg
11,92
50,00
Cena leka Participacija
na veliko osiguranog
po DDD
lica
1. Depresivna epizoda (F32),
5HNXUHQWQLGHSUHVLYQLSRUHPHüDM)
3. Agorafobija (F40.0),
'UXJLDQNVLR]QLSRUHPHüDML)
2SVHVLYQRNRPSXOVLYQLSRUHPHüDML)
3RVWWUDXPDWVNLVWUHVQLSRUHPHüDM)
2UJDQVNLDQNVLR]QLSRUHPHüDM)
Samo za osobe starije od 18 godina.
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra ili neurologa.
NAPOMENA
N06AB06 sertralin
1072790
N06AB06
sertralin
ZOLOFT
film tableta
blister, 28 po 50 mg
Haupt Pharma Latina
S.R.L
Italija
333,60
50 mg
11,91
50,00
Italija
Republika Srbija
Republika Srbija
667,10
333,60
667,10
50 mg
50 mg
50 mg
11,91
11,91
11,91
50,00
50,00
50,00
Republika Srbija
333,60
50 mg
11,91
50,00
1072791
1072851
1072850
N06AB06
N06AB06
N06AB06
sertralin
sertralin
sertralin
ZOLOFT
SETALOFT
SETALOFT
film tableta
film tableta
film tableta
blister, 28 po 100 mg
blister, 28 po 50 mg
blister, 28 po 100 mg
Haupt Pharma Latina
S.R.L
Zdravlje a.d.
Zdravlje a.d.
1072724
N06AB06
sertralin
SIDATA
film tableta
blister, 28 po 50 mg
Hemofarm a.d.
1072723
N06AB06
sertralin
SIDATA
film tableta
blister, 28 po 100 mg
Hemofarm a.d.
Republika Srbija
667,10
50 mg
11,91
50,00
1072644
N06AB06
sertralin
TRAGAL
film tableta
blister, 28 po 50 mg
Galenika a.d.
Republika Srbija
333,60
50 mg
11,91
50,00
1072643
N06AB06
sertralin
TRAGAL
film tableta
blister, 28 po 100 mg
Galenika a.d.
Republika Srbija
667,10
50 mg
11,91
50,00
blister, 28 po 50 mg
Slaviamed d.o.o. u
saradnji sa Krka
Tovarna Zdravil d.d,
Slovenija
Republika Srbija
333,60
50 mg
11,91
50,00
1072635
N06AB06
sertralin
ASENTRA
film tableta
Lista A - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1072636
ATC
N06AB06
INDIKACIJE
INN
sertralin
=DãWLüHQRLPHOHND
ASENTRA
FO
film tableta
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
blister, 28 po 100 mg
Slaviamed d.o.o. u
saradnji sa Krka
Tovarna Zdravil d.d,
Slovenija
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Republika Srbija
667,10
50 mg
11,91
50,00
Cena leka Participacija
na veliko osiguranog
po DDD
lica
1. Depresivna epizoda (F32),
5HNXUHQWQLGHSUHVLYQLSRUHPHüDM)
3. Agorafobija (F40.0),
'UXJLDQNVLR]QLSRUHPHüDML)
2SVHVLYQRNRPSXOVLYQLSRUHPHüDML)
3RVWWUDXPDWVNLVWUHVQLSRUHPHüDM)
2UJDQVNLDQNVLR]QLSRUHPHüDM)
=DLQGLNDFLMXSRGWDþNRPLVDPR]DRVREHVWDULMHRGJRGLQD
=DLQGLNDFLMXSRGWDþNRPVDPR]DRVREHVWDULMHRGJRGLQD
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra ili neurologa.
N06AB10 escitalopram
1072627
N06AB10
escitalopram
ELICEA
film tableta
blister, 28 po 5 mg
Krka Tovarna Zdravil
d.d.
Slovenija
166,90
10 mg
11,92
50,00
1072628
N06AB10
escitalopram
ELICEA
film tableta
blister, 28 po 10 mg
Krka Tovarna Zdravil
d.d.
Slovenija
333,70
10 mg
11,92
50,00
1072625
N06AB10
escitalopram
LATA
film tableta
blister, 28 po 10 mg
Hemofarm a.d.
Republika Srbija
333,70
10 mg
11,92
50,00
INDIKACIJE
1. Depresivna epizoda (F32),
5HNXUHQWQLGHSUHVHYQLSRUHPHüDM)
3DQLþQLSRUHPHüDM)
4. Socijalna fobija (F40.1);
2SVHVLYQRNRPSXOVLYQLSRUHPHüDM)
NAPOMENA
Samo za osobe starije od 18 godina.
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra ili neurologa.
Lista A - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1073190
1073191
ATC
INN
N06B
N06BA
N06BA04 metilfenidat
N06BA04
N06BA04
metilfenidat
metilfenidat
=DãWLüHQRLPHOHND
FO
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
Psihostimulansi i nootropni lekovi
Simpatikomimetici centralnog delovanja
Cena leka na
veliko za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
CONCERTA
tableta sa
produženim
RVOREDÿDQMHP
ERþLFDSRPJ
Janssen
Pharmaceutica N.V.
Belgija
3.362,30
30 mg
186,79
50,00
CONCERTA
tableta sa
produženim
RVOREDÿDQMHP
ERþLFDSRPJ
Janssen
Pharmaceutica N.V.
Belgija
4.019,40
30 mg
111,65
50,00
+LSHUNLQHWVNLVLQGURPVDSRUHPHüDMHPSDåQMH
Samo za decu.
/HNVHXWHUDSLMXXYRGLQDRVQRYXPLãOMHQMDGHþLMHJSVLKLMDWUDLOLSVLKLMDWUDQHXURSVLKLMDWUDNRMLVHEDYLGHFRPLPODGLPDLOLGHþLMHJQHXURORJDLOLSHGLMDWUDVD
HGXNDFLMRPL]REODVWLUD]YRMQHQHXURORJLMHLSVLKLMDWULMHVOHGHüLK]GUDYVWYHQLKXVWDQRYD
1. Institut za mentalno zdravlje - Beograd,
2. Klinika za neurologiju i psihijatriju za decu i omladinu - Beograd,
=DYRG]DSVLKRIL]LRORãNHSRUHPHüDMHLJRYRUQXSDWRORJLMX3URIGU&%UDMRYLü%HRJUDG
.OLQLþNLFHQWDU9RMYRGLQH
.OLQLþNLFHQWDU1Lã
NAPOMENA
.OLQLþNLFHQWDU.UDJXMHYDF
N07
OSTALI LEKOVI KOJI DELUJU NA NERVNI SISTEM
N07A
Parasimpatomimetici
N07AA
Antiholinergici
N07AA02 piridostigmin
INDIKACIJE
1088055
N07AA02
piridostigmin
MESTINON
obložena tableta
ERþLFDSRPJ
ICN Polfa Rzeszow
S.A; Legacy
Pharmaceuticals
Switzerland GmbH
Poljska;
Švajcarska
3.196,40
0,18 g
63,93
50,00
Lista A - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1075091
ATC
INN
N07B
N07BB
N07BB01 disulfiram
N07BB01
disulfiram
=DãWLüHQRLPHOHND
ESPERAL
FO
tableta
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
Lekovi koji se upotrebljavaju u bolestima zavisnosti
Lekovi koji se upotrebljavaju u alkoholnoj zavisnosti
20 po 500 mg
Sofarimex-Industria
Quimica E
Farmaceutica; Chinoin
Pharmaceutical and
Chemical Works Co.
Ltd.
Portugalija;
0DÿDUVND
Cena leka na
veliko za
pakovanje
DDD
151,30
0,2 g
3,03
50,00
Cena leka Participacija
na veliko osiguranog
po DDD
lica
Lek se uvodi u terapiju na osnovu mišljenja psihijatra/neuropsihijatra.
NAPOMENA
N07BC
Lekovi koji se upotrebljavaju u opioidnoj zavisnosti
N07BC02 metadon
2087310
N07BC02
metadon
METADON
2087505
N07BC02
metadon
METADON ALKALOID
kapi
ERþLFDSRPO
mg/ml)
Hemofarm a.d.
Republika Srbija
144,30
25 mg
36,08
50,00
oralne kapi, rastvor
ERþLFDSRPO
mg/ml)
Alkaloid a.d.
Republika
Makedonija
144,30
25 mg
36,08
50,00
INDIKACIJE
/HþHQMH]DYLVQRVWLRGRSLMDWD)
2. Suzbijanje snažnog bola (bola uzrokovanog karcinomom) (C00-C97).
NAPOMENA
=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLXWHUDSLMXX]GUDYVWYHQLPXVWDQRYDPDNRMHREDYOMDMX]GUDYVWYHQXGHODWQRVWQDSULPDUQRPVHNXQGDUQRPLOLWHUFLMDUQRP
nivou, na osnovu mišljenja psihijatra/neuropsihijatra, a u skladu sa Smernicama za primenu supstitucione terapije.
=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLNDRVLPSWRPDWVNDWHUDSLMDERODXVOXåELNXüQRJOHþHQMDLOLX]GUDYVWYHQLPXVWDQRYDPDNRMHREDYOMDMX]GUDYVWYHQX
delatnost na sekundarnom ili tercijarnom nivou.
Lista A - Grupa P. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
Cena leka Participacija
na veliko osiguranog
po DDD
lica
ATC
P
P01
P01A
P01AB
P01AB01
metronidazol
1029080
P01AB01
metronidazol
ORVAGIL
tableta
20 po 250 mg
Galenika a.d.
Republika Srbija
124,00
2g
49,60
50,00
1029082
P01AB01
metronidazol
ORVAGIL
tableta
20 po 400 mg
Galenika a.d.
Republika Srbija
208,20
2g
52,05
50,00
1029083
P01AB01
metronidazol
ORVAGIL D
tableta
20 po 400 mg
Galenika a.d.
Republika Srbija
208,20
2g
52,05
50,00
Republika Srbija
129,10
0,2 g
43,03
50,00
INDIKACIJE
P02
P02C
P02CA
P02CA01
3028300
P02CA01
INN
=DãWLüHQRLPH
leka
Cena leka
Država
na veliko
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
za
FO
leka
SURL]YRÿDþDOHND
leka
pakovanje
DDD
ANTIPARAZITNI PROIZVODI, INSEKTICIDI I SREDSTVA ZA ZAŠTITU OD INSEKATA
ANTIPROTOZOICI
Amebicidi i srodni proizvodi za bolesti koje su izazvane protozoama
Derivati nitroimidazola
1. Infekcije trihomonasom (A59),
2. Infekcije usta (peri i paradentalni apcesi-K12.2, gingivitis-K05),
3. Amebiaza (A06),
4. Helicobacter pylori infekcija (K25; K26; K27; K28; K29).
ANTIHELMINTICI
Lekovi protiv nematoda
Derivati benzimidazola
mebendazol
mebendazol
SOLTRIK
oralna
suspenzija
ERþLFDSRPO
(100 mg/5 ml)
Galenika a.d.
Lista A - Grupa R. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
R
R01
R01A
R01AD
R01AD09 mometazon
=DãWLüHQRLPH
leka
Cena leka
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
Država
za
FO
leka
leka
proizvodnje leka pakovanje
5(63,5$7251,6,67(0/(.29,=$/(ý(1-(%2/(67,5(63,5$72512*6,67(0$
Nazalni preparati
Dekongestivi I ostali nazalni preparati za lokalnu primenu
Kortikosteroidi
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
7110310
R01AD09
mometazon
NASONEX
sprej za nos,
suspenzija
ERþLFDVDUDVSUãLYDþHP Schering Plough Labo
1 po 120 doza (0,05%)
N.V.
Belgija
737,20
200 mcg
24,57
50,00
7110311
R01AD09
mometazon
NASONEX
sprej za nos,
suspenzija
ERþLFDVDUDVSUãLYDþHP Schering Plough Labo
1 po 140 doza (0,05%)
N.V.
Belgija
859,90
200 mcg
24,57
50,00
24,46
50,00
NAPOMENA
6DPR]DGHFXQDRVQRYXPLãOMHQMDGHþMHJDOHUJRORJDLOLGHþMHJSXOPRORJDLOLRWRULQRODULQJRORJDLOLOHNDUDSHGLMDWUDXVOXåELSXOPRORJLMH
R01AD12 flutikazonfuroat
7110033
R01AD12
flutikazonfuroat
AVAMYS
sprej za nos,
suspenzija
ERþLFDVDSXPSRP]D
doziranje, 1 po 120 doza
(27,5 mcg/doza)
Glaxo Operations UK
Limited
Velika Britanija
733,70
110 mcg
NAPOMENA
6DPR]DGHFX QDRVQRYXPLãOMHQMDGHþMHJDOHUJRORJDLOLGHþMHJSXOPRORJDLOLRWRULQRODULQJRORJDLOLOHNDUDSHGLMDWUDXVOXåELSXOPRORJLMH
R03
/(.29,.2-,6(35,0(1-8-88236758.7,912-3/8û12-%2/(67,
R03A
Adrenergici, inhalacioni
R03AC
Selektivni agonisti beta-2-adrenoreceptora
R03AC02 salbutamol
7114462
7114550
7114685
R03AC02
R03AC02
R03AC02
INDIKACIJE
salbutamol
salbutamol
salbutamol
SPALMOTIL
VENTOLIN
ECOSAL
1. Bronhijalna astma (J45).
rastvor za
raspršivanje
ERþLFDSRPO
mg/ml)
Galenika a.d.
Republika Srbija
196,90
10 mg
39,38
50,00
suspenzija za
inhalaciju pod
pritiskom
inhalator pod pritiskom
sa dozerom, 1 po 10 ml
(200 doza po 0,1 mg)
GlaxoSmithKline
Pharmaceuticals S.A.
Poljska
287,40
0,8 mg
11,50
50,00
suspenzija za
inhalaciju pod
pritiskom
kontejner pod pritiskom
sa ventilom za
doziranje,1 po 200 doza
(100 mcg/doza)
Ivax Pharmaceuticals
ýHãND
287,40
0,8 mg
11,50
50,00
Lista A - Grupa R. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
7114591
ATC
INN
R03AC12 salmeterol
R03AC12
salmeterol
=DãWLüHQRLPH
leka
SEREVENT Inhaler
CFC-Free
FO
suspenzija za
inhalaciju pod
pritiskom
Cena leka
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
Država
za
leka
leka
proizvodnje leka pakovanje
inhalator pod pritiskom
sa dozerom, 1 po 120
doza (25 mcg/doza)
Hemofarm a.d. u
saradnji sa
GlaxoSmithKline
Export Ltd. Velika
Britanija
Republika Srbija
2.049,50
DDD
100 mcg
Cena leka Participacija
na veliko osiguranog
po DDD
lica
68,32
50,00
INDIKACIJE
1. Bronhijalna astma, samo uz terapiju inhalacionim kortikosteroidima (J45).
Samo za decu.
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja pulmologa ili pneumoftiziologa ili alergologa ili interniste ili pedijatra u službi pulmologije.
R03AC13 formoterol
7114162
R03AC13
formoterol
OXIS TURBUHALER
prašak za inhalaciju
kontejner višedozni, 1 po
60 doza (4,5 mcg/doza)
AstraZeneca AB
Švedska
1.051,20
24 mcg
70,08
50,00
7114163
R03AC13
formoterol
OXIS TURBUHALER
prašak za inhalaciju
kontejner višedozni, 1 po
60 doza (9 mcg/doza)
AstraZeneca AB
Švedska
2.102,20
24 mcg
70,07
50,00
INDIKACIJE
1. Bronhijalna astma, samo uz terapiju inhalacionim kortikosteroidima (J45).
Samo za decu.
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja pulmologa ili pneumoftiziologa ili alergologa ili interniste ili pedijatra u službi pulmologije.
R03AK
$GUHQHUJLFLLGUXJLOHNRYL]DRSVWUXNWLYQHSOXüQHEROHVWLXNRPELQDFLML
R03AK03 fenoterol, ipratropijum bromid
7114725
7114129
R03AK03
R03AK03
INDIKACIJE
fenoterol,
ipratropijum bromid BERODUAL N
fenoterol,
ipratropijum bromid BERODUAL
rastvor za inhalaciju
pod pritiskom
inhalator pod pritiskom
sa dozerom,1 po 200
doza (0,05 mg + 0,021
mg)/ doza
Boehringer Ingelheim
Pharma GmbH
1HPDþND
786,60
6 inh.
23,60
50,00
rastvor za
raspršivanje
ERþLFDRGWDPQRJ
stakla,1 po 20 ml ( 0,5
mg/ml + 0,25 mg/ml )
Istituto De Angeli
S.R.L.
Italija
384,90
-
-
50,00
1. Bronhijalna astma (J45).
+URQLþQDRSVWUXNWLYQDEROHVWSOXüDNRGRGUDVOLK]DXPHUHQRWHãNHWHãNHLYHRPDWHãNH,,,,,LOL,9VWDGLMXPREOLNHEROHVWL-
Lista A - Grupa R. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
7114670
7114671
7114672
=DãWLüHQRLPH
ATC
INN
leka
R03AK06 flutikazon propionat, salmeterol
R03AK06
R03AK06
R03AK06
flutikazon,
salmeterol
flutikazon,
salmeterol
flutikazon,
salmeterol
SERETIDE DISCUS
SERETIDE DISCUS
SERETIDE DISCUS
Cena leka
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
Država
za
leka
leka
proizvodnje leka pakovanje
DDD
prašak za inhalaciju,
podeljen
diskus, 1 po 60 doza
(100 mcg/doza + 50
mcg/doza)
Glaxo Wellcome
Operations
Velika Britanija
2.338,80
2 inh.
77,96
50,00
prašak za inhalaciju,
podeljen
diskus, 1 po 60 doza
(250 mcg/doza + 50
mcg/doza)
Glaxo Wellcome
Operations
Velika Britanija
3.033,40
2 inh.
101,11
50,00
prašak za inhalaciju,
podeljen
diskus, 1 po 60 doza
(500 mcg/doza + 50
mcg/doza)
Glaxo Wellcome
Operations
Velika Britanija
3.991,70
2 inh.
133,06
50,00
FO
Cena leka Participacija
na veliko osiguranog
po DDD
lica
INDIKACIJE
1. Bronhijalna astma (J45).
Samo za decu.
Lek se uvodi u terapiju na osnovu mišljenja pulmologa ili pneumoftiziologa ili alergologa ili interniste ili pedijatra u službi pulmologije.
NAPOMENA
R03AK07 budesonid, formoterol
7114710
R03AK07
budesonid,
formoterol
SYMBICORT
TURBUHALER
prašak za inhalaciju
inhaler,1 po 60 doza (80
mcg + 4,5 mcg)
AstraZeneca AB
Švedska
1.727,70
4 inh.
115,18
50,00
7114711
R03AK07
budesonid,
formoterol
SYMBICORT
TURBUHALER
prašak za inhalaciju
inhaler,1 po 60 doza (160
mcg + 4,5 mcg)
AstraZeneca AB
Švedska
2.118,10
4 inh.
141,21
50,00
7114712
R03AK07
budesonid,
formoterol
SYMBICORT
TURBUHALER
prašak za inhalaciju
1 po 60 doza (320 mcg +
9 mcg)
AstraZeneca AB
Švedska
3.991,70
2 inh.
133,06
50,00
INDIKACIJE
NAPOMENA
1. Bronhijalna astma (J45).
Samo za decu.
Lek se uvodi u terapiju na osnovu mišljenja pulmologa ili pneumoftiziologa ili alergologa ili interniste ili pedijatra u službi pulmologije.
Lista A - Grupa R. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
7114562
7114680
7114681
ATC
INN
R03B
R03BA
R03BA01 beklometazon
R03BA01
R03BA01
R03BA01
INDIKACIJE
beklometazon
beklometazon
dipropionat
beklometazon
dipropionat
=DãWLüHQRLPH
leka
BECLOFORTE CFCFREE INHALER
ECOBEC
ECOBEC
FO
Cena leka
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
Država
za
leka
leka
proizvodnje leka pakovanje
2VWDOLOHNRYL]DRSVWUXNWLYQHSOXüQHEROHVWLLQKDODFLRQL
Glukokortikoidi
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
rastvor za inhalaciju
pod pritiskom
inhalator pod pritiskom
sa dozerom, 1 po 200
doza (250 mcg/1 doza)
Hemofarm a.d. u
saradnji sa
GlaxoSmithKline
Export Ltd. Velika
Britanija
aerosol
kontejner pod pritiskom,
1 po 200 doza (100
mcg/1 doza)
Ivax Pharmaceuticals
ýHãND
738,70
800 mcg
29,55
50,00
aerosol
kontejner pod pritiskom,
1 po 200 doza (250
mcg/1 doza)
Ivax Pharmaceuticals
ýHãND
729,70
800 mcg
11,68
50,00
Republika Srbija
729,70
800 mcg
11,68
50,00
1. Bronhijalna astma (J45).
Lek se uvodi u terapiju na osnovu mišljenja pulmologa ili pneumoftiziologa ili alergologa ili interniste ili pedijatra u službi pulmologije.
NAPOMENA
R03BA02 budesonid
7114572
R03BA02
budesonid
PULMICORT
TURBUHALER
prašak za inhalaciju
inhaler, 1 po 100 doza
(200 mcg/doza)
AstraZeneca AB
Švedska
925,60
800 mcg
37,02
50,00
7114574
R03BA02
budesonid
PULMICORT
TURBUHALER
prašak za inhalaciju
inhaler, 1 po 100 doza
(400 mcg/doza)
AstraZeneca AB
Švedska
1.851,10
800 mcg
37,02
50,00
26,06
50,00
INDIKACIJE
1. Bronhijalna astma (J45).
Samo za decu i trudnice.
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja pulmologa ili pneumoftiziologa ili alergologa ili interniste ili pedijatra u službi pulmologije.
R03BA02 budesonid
7114722
R03BA02
budesonid
BUDELIN
NOVOLIZER
prašak za inhalaciju
uložak, 1 po 200 doza
(200 mcg/doza)
Meda Pharma GmbH &
Co. KG; Meda
Manufacturing GmbH
1HPDþND
1HPDþND
1.303,20
800 mcg
Lista A - Grupa R. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
7114721
ATC
R03BA02
INDIKACIJE
INN
budesonid
=DãWLüHQRLPH
leka
BUDELIN
NOVOLIZER
FO
Cena leka
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
Država
za
leka
leka
proizvodnje leka pakovanje
Meda Pharma GmbH &
inhalator i uložak, 1 po
Co. KG; Meda
prašak za inhalaciju 200 doza (200 mcg/doza) Manufacturing GmbH
1HPDþND
1HPDþND
1.485,70
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
800 mcg
29,71
50,00
1. Bronhijalna astma (J45).
Samo za decu i trudnice.
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja pulmologa ili pneumoftiziologa ili alergologa ili interniste ili pedijatra u službi pulmologije.
R03BA02 budesonid
7114576
R03BA02
budesonid
PULMICORT
7114577
R03BA02
budesonid
PULMICORT
INDIKACIJE
suspenzija za
raspršivanje
suspenzija za
raspršivanje
ampula, 20 po 2 ml (0,25
mg/ml)
ampula, 20 po 2 ml (0,5
mg/ml)
AstraZeneca AB
Švedska
1.126,20
800 mcg
90,10
50,00
AstraZeneca AB
Švedska
1.655,70
800 mcg
66,23
50,00
kontejner pod pritiskom,
1 po 120 doza (50 mcg/1
doza)
Hemofarm a.d. u
saradnji sa
GlaxoSmithKline
Export Ltd. Velika
Britanija
Republika Srbija
907,40
0,6 mg
90,74
50,00
kontejner pod pritiskom,
1 po 60 doza (125 mcg/1
doza)
Hemofarm a.d. u
saradnji sa
GlaxoSmithKline
Export Ltd. Velika
Britanija
Republika Srbija
786,00
0,6 mg
62,88
50,00
kontejner pod pritiskom,
1 po 60 doza (250 mcg/1
doza)
Hemofarm a.d. u
saradnji sa
GlaxoSmithKline
Export Ltd. Velika
Britanija
Republika Srbija
1.559,50
0,6 mg
62,38
50,00
1. Bronhijalna astma (J45).
NAPOMENA
Samo za decu.
R03BA05 flutikazon propionate
7114597
7114595
7114596
R03BA05
R03BA05
R03BA05
INDIKACIJE
NAPOMENA
flutikazon
propionate
flutikazon
flutikazon
FLIXOTIDE
FLIXOTIDE
FLIXOTIDE
suspenzija za
inhalaciju pod
pritiskom
suspenzija za
inhalaciju pod
pritiskom
suspenzija za
inhalaciju pod
pritiskom
1. Bronhijalna astma (J45).
Samo za decu stariju od 4 godine.
Lek se uvodi u terapiju na osnovu mišljenja pulmologa ili pneumoftiziologa ili alergologa ili interniste ili pedijatra u službi pulmologije.
Lista A - Grupa R. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
7114744
7114741
ATC
INN
R03BA08 ciklesonid
R03BA08
R03BA08
INDIKACIJE
ciklesonid
ciklesonid
=DãWLüHQRLPH
leka
FO
Cena leka
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
Država
za
leka
leka
proizvodnje leka pakovanje
VSUHMERþLFDVD
dozerom,1 po 60 doza
(160 mcg/doza)
ALVESCO 160
rastvor za inhalaciju
pod pritiskom
ALVESCO 80
sprej-boca sa dozerom, 1
rastvor za inhalaciju po 10 ml (120 doza po 80
pod pritiskom
mcg)
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
Nycomed GmbH
1HPDþND
1.741,60
0,16 mg
29,03
50,00
Nycomed GmbH
1HPDþND
3.088,10
0,16 mg
51,47
50,00
1. Bronhijalna astma (J45).
Samo za decu stariju od 12 godina.
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja pulmologa ili pneumoftiziologa ili alergologa ili interniste ili pedijatra u službi pulmologije.
R03C
Adrenergici za sistemsku primenu
R03CC
Selektivni agonisti beta-2-adrenoreceptora
R03CC02 salbutamol
3114460
R03CC02
salbutamol
SPALMOTIL
oralni rastvor
boca,1 po 200 ml (2 mg/5
ml)
Galenika a.d.
Republika Srbija
198,20
12 mg
29,73
50,00
1114461
R03CC02
salbutamol
SPALMOTIL
tableta
blister, 60 po 2 mg
Galenika a.d.
Republika Srbija
175,00
12 mg
17,50
50,00
'UXJLOHNRYL]DVLVWHPVNXSULPHQXXRSVWUXNWLYQLPSOXüQLPEROHVWLPD
Ksantini
R03D
R03DA
R03DA04 teofilin
1114220
R03DA04
teofilin
DUROFILIN
kapsula retard
blister, 40 po 125 mg
Zdravlje a.d.
Republika Srbija
132,00
0,4 g
10,56
50,00
1114221
R03DA04
teofilin
DUROFILIN
kapsula retard
blister, 40 po 250 mg
Zdravlje a.d.
Republika Srbija
320,80
0,4 g
12,83
50,00
AMINOFILIN
tableta sa
produženim
RVOREDÿDQMHP
blister, 20 po 350 mg
Srbolek a.d.
Republika Srbija
206,80
0,6 g
17,73
50,00
AMINOFILIN Retard
tableta sa
produženim
RVOREDÿDQMHP
blister, 20 po 350 mg
Jugoremedija a.d.
Republika Srbija
206,80
0,6 g
17,73
50,00
Holandija
1.856,40
10 mg
132,60
50,00
R03DA05 aminofilin
1114292
1114503
R03DA05
R03DA05
aminofilin
aminofilin
R03DC
R03DC03 montelukast
1114640
R03DC03
montelukast
Antagonisti receptora leukotriena
SINGULAIR
tableta za žvakanje
blister, 28 po 5 mg
Merck Sharp & Dohme
Lista A - Grupa R. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPH
leka
FO
Cena leka
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
Država
za
leka
leka
proizvodnje leka pakovanje
1114643
R03DC03
montelukast
SINGULAIR
film tableta
blister, 28 po 10 mg
3114644
R03DC03
montelukast
SINGULAIR
granule
kesica, 28 po 4 mg
1114646
R03DC03
montelukast
SINGULAIR
tableta za žvakanje
1114552
R03DC03
montelukast
ALVOKAST
1114553
R03DC03
montelukast
ALVOKAST
1114554
R03DC03
montelukast
1114561
R03DC03
montelukast
1114560
R03DC03
montelukast
ALVOKAST
MONTELUKAST
PHARMAS
MONTELUKAST
PHARMAS
1114647
R03DC03
montelukast
1114648
R03DC03
1114645
R03DC03
INDIKACIJE
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
Holandija
1.856,40
10 mg
66,30
50,00
Holandija
1.857,60
10 mg
165,86
50,00
blister, 28 po 4 mg
Merck Sharp & Dohme
Merck Sharp & Dohme
B.V.
Merck Sharp & Dohme
B.V.
Holandija
1.857,60
10 mg
165,86
50,00
tableta za žvakanje
blister, 28 po 4 mg
Alvogen d.o.o.
Republika Srbija
1.857,60
10 mg
165,86
50,00
tableta za žvakanje
blister, 28 po 5 mg
Alvogen d.o.o.
Republika Srbija
1.856,40
10 mg
132,60
50,00
film tableta
blister, 28 po 10 mg
Alvogen d.o.o.
Republika Srbija
1.856,40
10 mg
66,30
50,00
tableta za žvakanje
blister, 28 po 5 mg
PharmaS d.o.o.
Republika Srbija
1.856,40
10 mg
132,60
50,00
tableta
blister, 28 po 10 mg
PharmaS d.o.o.
Republika Srbija
1.856,40
10 mg
66,30
50,00
TELUKA
tableta za žvakanje
blister, 28 po 4 mg
Galenika a.d.
Republika Srbija
1.857,60
10 mg
165,86
50,00
montelukast
TELUKA
tableta za žvakanje
blister, 28 po 5 mg
Galenika a.d.
Republika Srbija
1.856,40
10 mg
132,60
50,00
montelukast
TELUKA
film tableta
blister, 28 po 10 mg
Galenika a.d.
Republika Srbija
1.856,40
10 mg
66,30
50,00
1. Bronhijalna astma (J45).
Samo za decu.
Lek se uvodi u terapiju kao dodatna terapija kada primena inhalacionih kortikosteroida ne obezbeÿuje odgovarajuüu kontrolu bolesti. Tablete i granule od 4 mg se mogu koristiti kao
alternativa niskim dozama inhalacionih kortikosteroida samo za decu do 5 godina starosti.
Lek se uvodi u terapiju na osnovu mišljenja pulmologa ili pneumoftiziologa ili alergologa ili imunologa ili pedijatra u službi pulmologije.
NAPOMENA
R05
R05C
R05CB
R05CB13 dornaza alfa
7112250
R05CB13
dornaza alfa
LEKOVI PROTIV KAŠLJA I PREHLADE
(NVSHNWRUDQVLLVNOMXþXMXüLNRPELQDFLMHVDDQWLWXVLFLPD
Mukolitici
PULMOZYME
rastvor za
raspršivanje
6 po 2,5 ml (2500 i.j./2,5 F. Hoffmann-La Roche
ml)
Ltd.
Švajcarska
11.729,80
2,5 mg
1.954,97
INDIKACIJE
&LVWLþQDILEUR]DSOXüDVDIRUVLUDQLPYLWDOQLPNDSDFLWHWRPYHüLPRG(
NAPOMENA
/HNVHXYRGLXWHUDSLMXNRGEROHVQLNDVWDURVQHGRELRGJRGLQDLYLãHQDRVQRYXPLãOMHQMDSXOPRORJDXUHIHUHQWQRPFHQWUX]DFLVWLþQXILEUR]X
50,00
Lista A - Grupa S. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPHOHND
FO
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
SENZORNI ORGANI - LEKOVI KOJI DELUJU NA OKO I UHO
LEKOVI KOJI DELUJU NA OKO
Antiinfektivi
Antibiotici
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
S
S01
S01A
S01AA
S01AA01
hloramfenikol
4090121
S01AA01
hloramfenikol
CHLORAMPHENICOL
PDVW]DRþL
tuba, 1 po 5 g (1%)
Galenika a.d.
Republika Srbija
136,90
-
-
50,00
4090815
S01AA01
hloramfenikol
HLORAMKOL
PDVW]DRþL
tuba, 1 po 5 g (1%)
Hemomont d.o.o.
Republika Crna
Gora
136,90
-
-
50,00
S01AA01
hloramfenikol
HLORAMFENIKOL
ALKALOID
136,90
-
-
50,00
S01AA11
gentamicin
S01AA11
gentamicin
S01AA30
bacitracin, neomicin
S01AA30
bacitracin,
neomicin
4090816
7090801
4150250
GENTOKULIN
ENBECIN
PDVW]DRþL
tuba, 1 po 5 g (1%)
Alkaloid a.d.
Republika
Makedonija
NDSL]DRþLUDVWYRU
ERþLFDSRPO
(0,3%)
Hemomont d.o.o.
Republika Crna
Gora
163,20
-
-
50,00
PDVW]DRþL
tuba, 1 po 5 g (500 +
3300 i.j.)/1 g
Galenika a.d.
Republika Srbija
94,50
-
-
50,00
Ostali antiinfektivi
S01AX
S01AX13
ciprofloksacin
7090010
S01AX13
ciprofloksacin
MAROCEN
NDSL]DRþLUDVWYRU
ERþLFDVWDNOHQDSR
ml 0,3%
Hemomont d.o.o.
Republika Crna
Gora
192,50
-
-
50,00
7090911
S01AX13
ciprofloksacin
CITERAL
NDSL]DRþLUDVWYRU
ERþLFDVWDNOHQDSR
ml 0,3%
Alkaloid a.d.
Republika
Makedonija
192,50
-
-
50,00
Republika Srbija
138,20
-
-
50,00
INDIKACIJE
S01B
S01BA
S01BA02
4090620
S01BA02
1. Bakterijski keratitis ( H16 ),
2. Bakterijski konjuktivitis ( H10.0 ),
3. Bakterijski blefaritis ( H01.0).
Antiinflamatorni lekovi
Kortikosteroidi, monokomponentni
hidrokortizon
hidrokortizon
HYDROCORTISON
PDVW]DRþL
tuba, 1 po 5 g (1%)
Galenika a.d.
Lista A - Grupa S. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
7094033
7096050
ATC
S01E
S01EB
S01EB01
INN
pilokarpin
S01EB01
pilokarpin
S01EC
S01EC03
dorzolamid
S01EC03
dorzolamid
=DãWLüHQRLPHOHND
MIOKARPIN
FO
NDSL]DRþL
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Lekovi u terapiji glaukoma i miotici
Parasimpatikomimetici
ERþLFDSRPO
Hemomont d.o.o.
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Republika Crna
Gora
143,80
0,4 ml
5,75
50,00
Francuska
500,10
0,3 ml
30,01
50,00
0DÿDUVND
Hrvatska
500,10
0,3 ml
30,01
50,00
*UþND
500,10
0,3 ml
30,01
50,00
Cena leka Participacija
na veliko osiguranog
po DDD
lica
Inhibitori karboanhidraze
TRUSOPT
NDSL]DRþLUDVWYRU
ERþLFDSODVWLþQDSR
Laboratories Merck
5 ml (2%)
Sharp & Dohme-Chibret
7096055
S01EC03
dorzolamid
ULOM
NDSL]DRþLUDVWYRU
ERþLFDVDNDSDOMNRP
po 5 ml (2%)
Teva Pharmaceutical
Works Private Ltd.
Company; Pliva
Hrvatska
7096070
S01EC03
dorzolamid
OPTODROP
NDSL]DRþLUDVWYRU
ERþLFDVDNDSDOMNRP
po 5 ml (20 mg/ml)
Rafarm S.A.
INDIKACIJE
=DOHþHQMHJODXNRPD+NDRGUXJDLOLWUHüDWHUDSLMVNDOLQLMDRGQRVQRSUYDLOLGUXJDNDGDSRVWRMLNRQWUDLQGLNDFLMDQDSULPHQXEHWDDGUHQHUJLþNLKEORNDWRUD
=DOHþHQMHJODXNRPD+NRGREROHOLKNRGNRMLKMHUDQLMHGLMDJQRVWLNRYDQDEROHVWLNRMLVHYHüQDOD]HQDOHþHQMXNDRQDVWDYDNWHUDSLMHRYLPOHNRPQDRVQRYX
mišljenja oftalmologa.
NAPOMENA
S01EC04
Lek se uvodi u terapiju na osnovu mišljenja oftalmologa.
brinzolamid
7096060
S01EC04
brinzolamid
AZOPT
NDSL]DRþL
5 ml (10 mg/ml)
Alcon-Couvreur
Belgija
781,30
0,2 ml
31,25
50,00
INDIKACIJE
=DOHþHQMHJODXNRPD+NDRGUXJDLOLWUHüDWHUDSLMVNDOLQLMDRGQRVQRSUYDLOLGUXJDNDGDSRVWRMLNRQWUDLQGLNDFLMDQDSULPHQXEHWDDGUHQHUJLþNLKEORNDWRUD
=DOHþHQMHJODXNRPD+NRGREROHOLKNRGNRMLKMHUDQLMHGLMDJQRVWLNRYDQDEROHVWLNRMLVHYHüQDOD]HQDOHþHQMXNDRQDVWDYDNWHUDSLMHRYLPOHNRPQDRVQRYX
mišljenja oftalmologa.
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja oftalmologa.
Lista A - Grupa S. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
7093071
7093020
ATC
S01ED
S01ED01
timolol
S01ED01
timolol
S01ED01
INN
timolol
=DãWLüHQRLPHOHND
GLAUMOL
UNITIMOLOL 0.5%
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
%HWDDGUHQHUJLþNLEORNDWRUL
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
NDSL]DRþLUDVWYRU
ERþLFDVWDNOHQDSR
ml 0,5%
Galenika a.d.
Republika Srbija
139,10
0,2 ml
5,56
50,00
NDSL]DRþLUDVWYRU
ERþLFDSRPO
0,5%
Unimed Pharma S.R.O.
6ORYDþND
278,20
0,2 ml
5,56
50,00
29,52
50,00
INDIKACIJE
=DOHþHQMHQRYRRWNULYHQLKREROHOLKRGJODXNRPDNDRSUYDWHUDSLMVNDOLQLMDNDRL]DOHþHQMHREROHOLOKNRGNRMLKMHUDQLMHGLMDJQRVWLNRYDQDEROHVW
NAPOMENA
S01ED51
Lek se uvodi u terapiju na osnovu mišljenja oftalmologa.
timolol, latanoprost
7099170
S01ED51
timolol,
latanoprost
XALACOM
NDSL]DRþLUDVWYRU
1 po 2,5 ml (5 mg/ml +
50 mcg/ml)
Pfizer Manufacturing
Belgium NV
Belgija
738,10
0,1 ml
INDIKACIJE
=DOHþHQMHJODXNRPD+NDRGUXJDLOLWUHüDWHUDSLMVNDOLQLMD
=DOHþHQMHJODXNRPD+NRGREROHOLKNRGNRMLKMHUDQLMHGLMDJQRVWLNRYDQDEROHVWLNRMLVHYHüQDOD]HQDOHþHQMXNDRQDVWDYDNWHUDSLMHRYLPOHNRPQDRVQRYX
mišljenja oftalmologa.
NAPOMENA
S01ED51
Lek se uvodi u terapiju na osnovu mišljenja oftalmologa.
dorzolamid, timolol
7099180
7096052
S01ED51
dorzolamid,
timolol
S01ED51
dorzolamid,
timolol
INDIKACIJE
NAPOMENA
COSOPT
OPTODROP-CO
NDSL]DRþLUDVWYRU
ERþLFDSRPO
Laboratories Merck
+ 0,5%)
Sharp & Dohme-Chibret
NDSL]DRþLUDVWYRU
ERþLFDVDNDSDOMNRP
po 5 ml (5 mg/ml + 20
mg/ml)
Rafarm S.A.
Francuska
692,80
0,2 ml
27,71
50,00
*UþND
638,00
0,2 ml
25,52
50,00
=DOHþHQMHJODXNRPD+NDRGUXJDLOLWUHüDWHUDSLMVNDOLQLMD
=DOHþHQMHJODXNRPD+NRGREROHOLKNRGNRMLKMHUDQLMHGLMDJQRVWLNRYDQDEROHVWLNRMLVHYHüQDOD]HQDOHþHQMXNDRQDVWDYDNWHUDSLMHRYLPOHNRPQDRVQRYX
mišljenja oftalmologa.
Lek se uvodi u terapiju na osnovu mišljenja oftalmologa.
Lista A - Grupa S. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
7099140
7099155
ATC
S01EE
S01EE01
latanoprost
S01EE01
latanoprost
S01EE01
INN
latanoprost
=DãWLüHQRLPHOHND
XALATAN
UNILAT
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Analozi prostaglandina
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Belgija
772,70
0,1 ml
30,91
50,00
Cena leka Participacija
na veliko osiguranog
po DDD
lica
NDSL]DRþLUDVWYRU
ERþLFDVDNDSDOMNRP
1 po 2,5 ml 0,005%
NDSL]DRþLUDVWYRU
ERþLFDVDNDSDOMNRP
1 po 2,5 ml (50
mcg/ml)
Unimed Pharma S.R.O.
6ORYDþND
664,70
0,1 ml
26,59
50,00
6ORYDþND
1.994,10
0,1 ml
26,59
50,00
Republika Srbija
664,70
0,1 ml
26,59
50,00
Pfizer Manufacturing
Belgium NV
7099156
S01EE01
latanoprost
UNILAT
NDSL]DRþLUDVWYRU
ERþLFDVDNDSDOMNRP
3 po 2,5 ml (50
mcg/ml)
Unimed Pharma S.R.O.
7099001
S01EE01
latanoprost
LANOPROGAL
NDSL]DRþLUDVWYRU
ERþLFDVDNDSDOMNRP
po 2,5 ml (50 mcg/ml)
Galenika a.d.
INDIKACIJE
=DOHþHQMHJODXNRPD+NDRGUXJDLOLWUHüDWHUDSLMVNDOLQLMDRGQRVQRSUYDLOLGUXJDNDGDSRVWRMLNRQWUDLQGLNDFLMDQDSULPHQXEHWDDGUHQHUJLþNLKEORNDWRUD
=DOHþHQMHJODXNRPD+NRGREROHOLKNRGNRMLKMHUDQLMHGLMDJQRVWLNRYDQDEROHVWLNRMLVHYHüQDOD]HQDOHþHQMXNDRQDVWDYDNWHUDSLMHRYLPOHNRPQDRVQRYX
mišljenja oftalmologa.
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja oftalmologa.
Lista A - Grupa V. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
ŠIFRA
INN
=DãWLüHQRLPHOHND
FO
3DNRYDQMHLMDþLQD
Naziv
leka
SURL]YRÿDþDOHND
OSTALO
OPŠTI NUTRIJENSI
Ostali nutrijensi
Ostali nutrijensi
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
ATC
V
V06
V06D
V06DX
V06DX..
bezglutensko brašno
N002832
V06DX..
bezglutensko brašno
WHITE FLOUR MIX
prašak
1 kg
Hammermuhle
GmbH
1HPDþND
503,00
-
-
50,00
N002840
V06DX..
bezglutensko brašno
DARK FLOUR MIX
prašak
1 kg
Hammermuhle
GmbH
1HPDþND
503,00
-
-
50,00
INDIKACIJE
&HOLMDþQDEROHVW.
NAPOMENA
V06DX..
Lek se uvodi u terapiju na osnovu mišljenja gastroenterologa ili gastroenterologa-pedijatra ili pedijatra u službi gastroenterologije.
/HNVHPRåHSURSLVDWLXNROLþLQLGRNJQDMHGDQOHNDUVNLUHFHSW]DSHULRGGRGDQD
namirnice za enteralnu ishranu
N003582
V06DX..
namirnice za
enteralnu ishranu
NUTRIDRINK
rastvor za enteralnu
ishranu
ERþLFDPO
kcal/ml)
N.V.Nutricia
Zoetermeer
Holandija
168,40
-
-
50,00
N003590
V06DX..
namirnice za
enteralnu ishranu
NUTRISON
rastvor za enteralnu
ishranu
boca, 500 ml (1
kcal/ml)
N.V.Nutricia
Zoetermeer
Holandija
335,60
-
-
50,00
INDIKACIJE
3URJUHVLYQDPLRNORQLþQDHSLOHSVLMD/D)RULQDHSLOHSVLMD*
2. Mitohondrijalna (metahromatska) leukodistrofija (G31.9)
6SLQDOQDPLãLüQDGLVWURILMD*
4. Batenova bolest (G25.3).
NAPOMENA
.RGEROHVQLNDNRMLVX]ERJSURJUHVLMHEROHVWLL]JXELOLUHIOHNVJXWDQMDLQHRSKRGQDLPMHHQWHUDOQDLVKUDQDNRMXPRJXGDGRELMDMXLVNOMXþLYRSUHNRDOWHUQDWLYQLK
puteva hranjenja (specijalne jejunalne sonde, perkutane gastrostome, jejunostome).
Lek se uvodi u terapiju na osnovu mišljenja tri lekara zdravstvene ustanove koja obavlja zdravstvenu delatnost na tercijarnom nivou zdravstvene zaštite.
Lista A1 - Grupa A. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
A
A02
A02B
A02BC
A02BC01 omeprazol
Cena leka
Država
na veliko
Cena leka
=DãWLüHQRLPH
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
za
na veliko
leka
FO
leka
leka
leka
pakovanje
DDD
po DDD
$/,0(17$51,75$.7,0(7$%2/,=$0/(.29,=$/(ý(1-(%2/(67,',*(67,912*6,67(0$,0(7$%2/,=0$
/(.29,=$325(0(û$-($&,',7(7$
/HNRYL]DOHþHQMHSHSWLþNRJXONXVDLJDVWURH]RIDJXVQRJUHIOXNVD
Inhibitori protonske pumpe
Participacija
osiguranog
lica
1122460
A02BC01
omeprazol
OMEPROL
gastrorezistentna
kapsula, tvrda
kontejner za tablete, 15
po 20 mg
Zdravlje a.d.
Republika Srbija
406,70
20 mg
27,11
80%
1122858
A02BC01
omeprazol
ZEPROM
gastrorezistentna
kapsula, tvrda
blister, 14 po 20 mg
PharmaSwiss d.o.o.
Republika Srbija
379,60
20 mg
27,11
80%
blister, 14 po 20 mg
Ufar d.o.o. u saradnji sa
Sandoz
Pharmaceuticals d.d.
Republika Srbija
379,60
20 mg
27,11
80%
blister, 14 po 20 mg
Alvogen d.o.o.
Republika Srbija
379,60
20 mg
27,11
80%
1122846
A02BC01
omeprazol
ORTANOL
gastrorezistentna
kapsula, tvrda
1122857
A02BC01
omeprazol
OMEPRAZOL
gastrorezistentna
kapsula, tvrda
INDIKACIJE
1. Za eradikaciju Helicobacter pylori infekcije do 14 dana dokazanu validnim testom (K22.1; K25; K26; K28),
1DNRQNUYDUHQMDL]SHSWLþNRJXONXVDGRPHVHFD...
3. Gastroezofagealna refluksna bolest do 2 nedelje terapije (K21).
=DLQGLNDFLMXSRGWDþNRPOHNVHXWHUDSLMXXYRGLQDRVQRYXPLãOMHQMDJDVWURHQWHURORJD
=DLQGLNDFLMXSRGWDþNRPQDNRQJRUHQDYHGHQRJSHULRGDOHþHQMDQHGHOMHQDVWDYDNWHUDSLMHGRQHGHOMDXWRNXPHVHFLQDRVQRYXPLãOMHQMD
a) gastroenterologa ili
NAPOMENA
b) mišljenja specijaliste abdominalnog hirurga uz nalaz gornje endoskopije.
A02BC02 pantoprazol
1122750
A02BC02
INDIKACIJE
pantoprazol
CONTROLOC
gastrorezistentna
tableta
14 po 40 mg
Nycomed Oranienburg
GmbH
1HPDþND
327,90
40 mg
23,42
20%
40 mg
38,87
85%
1. Zollinger Elisonov sindrom trajno ( E16.8 ).
NAPOMENA
Lek se u terapiju uvodi na osnovu mišljenja gastroenterologa ili endokrinologa na osnovu patohistološkog nalaza.
A02BC02 pantoprazol
1122752
A02BC02
pantoprazol
CONTROLOC
gastrorezistentna
tableta
blister,14 po 20 mg
Nycomed GmbH
1HPDþND
272,10
Lista A1 - Grupa A. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1122750
A02BC02
pantoprazol
CONTROLOC
gastrorezistentna
tableta
blister, 14 po 40 mg
Nycomed Oranienburg
GmbH
1HPDþND
327,90
40 mg
23,42
85%
1122860
A02BC02
pantoprazol
GASTROLOC
gastrorezistentna
tableta
blister, 14 po 20 mg
Pharmanova d.o.o.
Republika Srbija
226,70
40 mg
32,39
80%
1122861
A02BC02
pantoprazol
GASTROLOC
gastrorezistentna
tableta
blister, 28 po 20 mg
Pharmanova d.o.o.
Republika Srbija
453,40
40 mg
32,39
80%
1122862
A02BC02
pantoprazol
GASTROLOC
gastrorezistentna
tableta
blister, 14 po 40 mg
Pharmanova d.o.o.
Republika Srbija
273,20
40 mg
19,51
80%
1122863
A02BC02
pantoprazol
GASTROLOC
gastrorezistentna
tableta
blister, 28 po 40 mg
Pharmanova d.o.o.
Republika Srbija
546,40
40 mg
19,51
80%
1122866
A02BC02
pantoprazol
PANRAZOL
gastrorezistentna
tableta
blister, 14 po 20 mg
Zdravlje a.d.
Republika Srbija
226,70
40 mg
32,39
80%
1122867
A02BC02
pantoprazol
PANRAZOL
gastrorezistentna
tableta
blister, 14 po 40 mg
Zdravlje a.d.
Republika Srbija
273,20
40 mg
19,51
80%
1122772
A02BC02
pantoprazol
PANTOPRAZOL
PHARMAS
gastrorezistentna
tableta
blister, 14 po 20 mg
PharmaS d.o.o.
Republika Srbija
226,70
40 mg
32,39
80%
1122773
A02BC02
pantoprazol
PANTOPRAZOL
PHARMAS
gastrorezistentna
tableta
blister, 28 po 20 mg
PharmaS d.o.o.
Republika Srbija
453,40
40 mg
32,39
80%
1122774
A02BC02
pantoprazol
PANTOPRAZOL
PHARMAS
gastrorezistentna
tableta
blister, 14 po 40 mg
PharmaS d.o.o.
Republika Srbija
273,20
40 mg
19,51
80%
1122775
A02BC02
pantoprazol
PANTOPRAZOL
PHARMAS
gastrorezistentna
tableta
blister, 28 po 40 mg
PharmaS d.o.o.
Republika Srbija
546,40
40 mg
19,51
80%
INDIKACIJE
1. Za eradikaciju Helicobacter pylori infekcije do 14 dana dokazanu validnim testom (K22.1; K25; K26; K28);
1DNRQNUYDUHQMDL]SHSWLþNRJXONXVDGRPHVHFD...
3. Gastroezofagealna refluksna bolest do 2 nedelje terapije (K21).
NAPOMENA
=DLQGLNDFLMXSRGWDþNRPOHNVHXWHUDSLMXXYRGLQDRVQRYXPLãOMHQMDJDVWURHQWHURORJD
=DLQGLNDFLMXSRGWDþNRPQDNRQJRUHQDYHGHQRJSHULRGDOHþHQMDQHGHOMHQDVWDYDNWHUDSLMHGRQHGHOMDXWRNXPHVHFLQDRVQRYXPLãOMHQMD
a) gastroenterologa ili
b) mišljenja specijaliste abdominalnog hirurga uz nalaz gornje endoskopije.
Lista A1 - Grupa A. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
A02BC03 lansoprazol
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1122160
A02BC03
lansoprazol
SABAX
gastrorezistentna
kapsula, tvrda
blister, 14 po 30 mg
Hemofarm a.d.
Republika Srbija
439,00
30 mg
31,36
85%
1122161
A02BC03
lansoprazol
SABAX
gastrorezistentna
kapsula, tvrda
blister, 28 po 15 mg
Hemofarm a.d.
Republika Srbija
520,60
30 mg
37,19
85%
INDIKACIJE
1. Za eradikaciju Helicobacter pylori infekcije do 14 dana dokazanu validnim testom (K22.1; K25; K26; K28),
1DNRQNUYDUHQMDL]SHSWLþNRJXONXVDGRPHVHFD...
3. Gastroezofagealna refluksna bolest do 2 nedelje terapije (K21).
=DLQGLNDFLMXSRGWDþNRPOHNVHXWHUDSLMXXYRGLQDRVQRYXPLãOMHQMDJDVWURHQWHURORJD
=DLQGLNDFLMXSRGWDþNRPQDNRQJRUHQDYHGHQRJSHULRGDOHþHQMDQHGHOMHQDVWDYDNWHUDSLMHGRQHGHOMDXWRNXPHVHFLQDRVQRYXPLãOMHQMD
a) gastroenterologa ili
NAPOMENA
b) mišljenja specijaliste abdominalnog hirurga uz nalaz gornje endoskopije.
A02BC05 esomeprazol
1122859
A02BC05
esomeprazol
EMANERA
gastrorezistentna
kapsula, tvrda
blister, 7 po 20 mg
Krka Tovarna Zdravil
d.d.
Slovenija
134,60
30 mg
28,84
75%
1122882
A02BC05
esomeprazol
EMANERA
gastrorezistentna
kapsula, tvrda
blister, 14 po 20 mg
Krka Tovarna Zdravil
d.d.
Slovenija
269,20
30 mg
28,84
75%
1122881
A02BC05
esomeprazol
EMANERA
gastrorezistentna
kapsula, tvrda
blister, 28 po 20 mg
Krka Tovarna Zdravil
d.d.
Slovenija
538,40
30 mg
28,84
75%
1122883
A02BC05
esomeprazol
EMANERA
gastrorezistentna
kapsula, tvrda
blister, 7 po 40 mg
Krka Tovarna Zdravil
d.d.
Slovenija
181,30
30 mg
19,43
75%
1122864
A02BC05
esomeprazol
EMANERA
gastrorezistentna
kapsula, tvrda
blister, 14 po 40 mg
Krka Tovarna Zdravil
d.d.
Slovenija
362,40
30 mg
19,41
75%
1122865
A02BC05
esomeprazol
EMANERA
gastrorezistentna
kapsula, tvrda
blister, 28 po 40 mg
Krka Tovarna Zdravil
d.d.
Slovenija
724,80
30 mg
19,41
75%
1122831
A02BC05
esomeprazol
ESOMEPRAZOL
SANDOZ
gastrorezistentna
tableta
blister, 7 po 20 mg
Salutas Pharma GmbH
1HPDþND
134,60
30 mg
28,84
75%
1122833
A02BC05
esomeprazol
ESOMEPRAZOL
SANDOZ
gastrorezistentna
tableta
blister, 7 po 40 mg
Salutas Pharma GmbH
1HPDþND
181,30
30 mg
19,43
75%
1122876
A02BC05
esomeprazol
ESOMEPRAZOL
PHARMAS
gastrorezistentna
tableta
blister, 7 po 20 mg
PharmaS d.o.o.
Republika Srbija
134,60
30 mg
28,84
75%
Lista A1 - Grupa A. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1122854
A02BC05
esomeprazol
ESOMEPRAZOL
PHARMAS
gastrorezistentna
tableta
blister, 14 po 20 mg
PharmaS d.o.o.
Republika Srbija
269,20
30 mg
28,84
75%
1122875
A02BC05
esomeprazol
ESOMEPRAZOL
PHARMAS
gastrorezistentna
tableta
blister, 7 po 40 mg
PharmaS d.o.o.
Republika Srbija
181,30
30 mg
19,43
75%
1122853
A02BC05
esomeprazol
ESOMEPRAZOL
PHARMAS
gastrorezistentna
tableta
blister, 14 po 40 mg
PharmaS d.o.o.
Republika Srbija
362,40
30 mg
19,41
75%
INDIKACIJE
1. Za eradikaciju Helicobacter pylori infekcije do 14 dana dokazanu validnim testom (K22.1; K25; K26; K28),
1DNRQNUYDUHQMDL]SHSWLþNRJXONXVDGRPHVHFD...
3. Gastroezofagealna refluksna bolest do 2 nedelje terapije (K21).
=DLQGLNDFLMXSRGWDþNRPOHNVHXWHUDSLMXXYRGLQDRVQRYXPLãOMHQMDJDVWURHQWHURORJD
=DLQGLNDFLMXSRGWDþNRPQDNRQJRUHQDYHGHQRJSHULRGDOHþHQMDQHGHOMHQDVWDYDNWHUDSLMHGRQHGHOMDXWRNXPHVHFLQDRVQRYXPLãOMHQMD
a) gastroenterologa ili
NAPOMENA
b) mišljenja specijaliste abdominalnog hirurga uz nalaz gornje endoskopije.
A05
7(5$3,-$%2/(67,ä8ý1,+387(9$%,/,-$512*75$.7$,-(75(
A05A
7HUDSLMDEROHVWLåXþQLKSXWHYD
A05AA
3UHSDUDWLåXþQLKNLVHOLQD
A05AA02 ursodeoksiholna kiselina
1127177
A05AA02
1127176
A05AA02
INDIKACIJE
ursodeoksiholna
kiselina
ursodeoksiholna
kiselina
URSOFALK
kapsula
100 po 250 mg
Dr Falk Pharma GmbH
1HPDþND
3.136,70
0,75 g
94,10
20%
URSOFALK
kapsula
50 po 250 mg
Dr Falk Pharma GmbH
1HPDþND
1.568,30
0,75 g
94,10
20%
1. Primarna bilijarna ciroza dijagnostikovana u zdravstvenoj ustanovi koja obavlja zdravstvenu delatnost na tercijarnom nivou zdravstvene zaštite (K74.3)
Lek se u terapiju uvodi na osnovu mišljenja gastroenterologa ili infektologa/hepatologa.
NAPOMENA
A06
LAKSATIVI
A06A
Laksativi
A06AD
Osmotski laksativi
A06AD11 laktuloza
3127425
A06AD11
laktuloza
DUPHALAC
oralni rastvor
ERFDSODVWLþQDSR
500 ml (667 g/l)
Abbott Biologicals B.V.
INDIKACIJE
1. Portosistemske encefalopatije ( K72 ).
NAPOMENA
Lek se u terapiju uvodi na osnovu mišljenja gastroenterologa ili infektologa/hepatologa.
Holandija
482,80
6,7 g
9,70
20%
Lista A1 - Grupa A. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
A07
A07E
A07EC
A07EC02
mesalazin
5129472
A07EC02
mesalazin
SALOFALK
1129470
A07EC02
mesalazin
SALOFALK 250
1129471
A07EC02
mesalazin
SALOFALK 250
1129474
A07EC02
mesalazin
SALOFALK 500
1129475
A07EC02
mesalazin
SALOFALK 500
1129110
A07EC02
INN
=DãWLüHQRLPH
leka
mesalazin
ASACOL
Cena leka
Država
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
za
FO
leka
leka
leka
pakovanje
ANTIDIJAROICI, INTESTINALNI ANTIINFLAMATORNI / ANTIINFEKTIVNI LEKOVI
Intestinalni antiinflamatorni lekovi
$PLQRVDOLFLOQDNLVHOLQDLVOLþQLOHNRYL
1HPDþND
655,90
1,5 g
196,77
20%
blister, 50 po 250 mg
Dr Falk Pharma GmbH
1HPDþND
669,30
1,5 g
80,32
20%
blister, 100 po 250 mg Dr Falk Pharma GmbH
1HPDþND
1.338,60
1,5 g
80,32
20%
blister, 50 po 500 mg
Dr Falk Pharma GmbH
1HPDþND
1.455,70
1,5 g
87,34
20%
blister, 100 po 500 mg Dr Falk Pharma GmbH
1HPDþND
2.911,30
1,5 g
87,34
20%
Lek farmacevtska
družba d.d. u saradnji
sa Tillots Pharma AG,
Švajcarska
Slovenija
1.940,50
1,5 g
72,77
20%
Švajcarska
2.727,60
1,5 g
81,83
20%
Švajcarska
3.447,30
1,5 g
184,68
20%
2g
11,96
25%
blister, 100 po 400 mg
blister, 100 po 500 mg
blister, 28 po 1 g
A07EC02
mesalazin
PENTASA
5129131
A07EC02
mesalazin
PENTASA
supozitorija
INDIKACIJE
Dr Falk Pharma GmbH
gastrorezistentna
tableta
1129130
Participacija
osiguranog
lica
strip, 10 po 500 mg
supozitorija
gastrorezistentna
tableta
gastrorezistentna
tableta
gastrorezistentna
tableta
gastrorezistentna
tableta
tableta sa
produženim
RVOREDÿDQMHP
DDD
Cena leka
na veliko
po DDD
Ferring International
Center SA
Ferring International
Center SA
1. Crohnova bolest (K50),
2. Ulcerozni kolitis (K51).
NAPOMENA
=DLQGLNDFLMHSRGWDþNRPLOHNVHXWHUDSLMXXYRGLQDRVQRYXPLãOMHQMDJDVWURHQWHURORJD
A10
LEKOVI KOJI SE UPOTREBLJAVAJU U DIJABETES MELITUSU ( ANTIDIJABETICI )
A10B
Oralni antidijabetici (lekovi koji snižavaju glukozu u krvi)
A10BA
Bigvanidini
A10BA02 metformin
1043106
A10BA02
metformin
GLUCOPHAGE
film tableta
blister, 50 po 500 mg
Merck KGaA; Merck
KGaA & Co. WERK
SPITTAL
1HPDþND$XVWULMD
149,50
Lista A1 - Grupa A. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1042062
1042063
1042161
ATC
INN
A10BB
A10BB09 gliklazid
A10BB09
A10BB09
A10BB09
gliklazid
gliklazid
gliklazid
=DãWLüHQRLPH
leka
DIAPREL MR
DIAPREL MR
DIAPREL MR
FO
tableta sa
modifikovanim
RVOREDÿDQMHP
tableta sa
modifikovanim
RVOREDÿDQMHP
tableta sa
modifikovanim
RVOREDÿDQMHP
1050102
1050101
A11CC03
A11CC03
A11CC03
INDIKACIJE
NAPOMENA
alfakalcidol
alfakalcidol
alfakalcidol
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
blister, 60 po 30 mg
Les Laboratoires
Servier Industrie
Francuska
644,60
60 mg
21,49
50%
blister, 30 po 60 mg
Servier (Ireland)
Industries Ltd.; Les
Laboratoires Servier
Industrie
Irska; Francuska
681,40
60 mg
22,71
50%
blister, 60 po 60 mg
Servier (Ireland)
Industries Ltd.; Les
Laboratoires Servier
Industrie
Irska; Francuska
1.362,80
60 mg
22,71
50%
Republika Srbija
518,20
1 mcg
41,46
25%
VITAMINI
9LWDPLQL$L'XNOMXþXMXüLQMLKRYHNRPELQDFLMH
Vitamin D i analozi
A11
A11C
A11CC
A11CC03 alfakalcidol
1050100
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
Sulfonamidi, derivati sulfoniluree
ALPHA D3
ALPHA D3
ALPHA D3
kapsula, meka
ERþLFDSRPFJ
kapsula, meka
Zdravlje a.d. u saradnji
sa Teva
Pharmaceutical
ERþLFDSRPFJ
Industries Ltd, Izrael
Republika Srbija
564,90
1 mcg
37,66
25%
kapsula, meka
Zdravlje a.d. u saradnji
sa Teva
Pharmaceutical
Industries Ltd, Izrael
Republika Srbija
949,90
1 mcg
31,66
25%
ERþLFDSRPFJ
Zdravlje a.d.
1. Hipokalcemija bilo koje etiologije ( E58 ),
2. Renalna osteodistrofija ( N25.0 ),
3. Osteomalacija kod vitamin D rezistentnog rahitisa ( E83.3),
4. Glukokortikoidima indukovana osteoporoza ( M81.4).
/HNVHXYRGLXWHUDSLMX]DLQGLNDFLMXSRGWDþNRPQDRVQRYXPLãOMHQMDHQGRNULQRORJDDSRGWDþNRPQDRVQRYXPLãOMHQMDQHIURORJDLOLHQGRNULQRORJDDSRG
WDþNRPLQDRVQRYXPLãOMHQMDUHXPDWRORJD
Lista A1 - Grupa A. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1050121
ATC
INN
A11CC04 kalcitriol
A11CC04
kalcitriol
=DãWLüHQRLPH
leka
ROCALTROL
FO
kapsula, meka
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
blister, 100 po 0,25
mcg
INDIKACIJE
Renalna osteodistrofija ( N25.0 ).
NAPOMENA
Lek se u terapiju uvodi na osnovu mišljenja nefrologa ili endokrinologa.
F. Hoffmann-La Roche
Ltd.
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
Švajcarska
1.479,60
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1 mcg
59,18
25%
Lista A1 - Grupa B. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1063220
ATC
INN
B
B01
B01A
B01AA
B01AA07 acenokumarol
B01AA07
acenokumarol
Cena leka
na veliko
=DãWLüHQRLPH
3DNRYDQMHLMDþLQD
Naziv
Država
za
leka
FO
leka
SURL]YRÿDþDOHND proizvodnje leka pakovanje
DDD
.59,.59279251,25*$1,/(.29,=$/(ý(1-(%2/(67,.59,,.59279251,+25*$1$
$17,7520%27,ý.$65('679$$17,.2$*8/$16,
$QWLWURPERWLþNDVUHGVWYDDQWLNRDJXODQVL
Antagonisti vitamina K
SINKUM 4
tableta
B01AC04
klopidogrel
Jugoremedija a.d.
Republika Srbija
114,20
5 mg
7,14
45%
,QKLELWRULDJUHJDFLMHWURPERFLWDLVNOMXþXMXüLKHSDULQ
B01AC
B01AC04 klopidogrel
1068220
blister, 20 po 4 mg
Cena leka Participacija
na veliko osiguranog
po DDD
lica
PLAVIX
film tableta
28 po 75 mg
Sanofi-Synthelabo
Group
Francuska
1.011,90
75 mg
36,14
50%
Republika Srbija
1.011,90
75 mg
36,14
50%
1068502
B01AC04
klopidogrel
ZYLLT
film tableta
blister, 28 po 75 mg
Slaviamed d.o.o. u
saradnji sa Krka
Tovarna Zdravil d.d,
Slovenija
1068221
B01AC04
klopidogrel
ANTIAGREX
film tableta
blister, 28 po 75 mg
Zdravlje a.d.
Republika Srbija
1.011,90
75 mg
36,14
50%
1068239
B01AC04
klopidogrel
CLOPIGAL
film tableta
blister, 28 po 75 mg
Galenika a.d.
Republika Srbija
1.011,90
75 mg
36,14
50%
1068237
B01AC04
klopidogrel
KLOPIDOGREL
fIlm tableta
blister, 14 po 75 mg
M.D. Nini d.o.o.
Republika Srbija
293,50
75 mg
20,96
50%
1068236
B01AC04
klopidogrel
KLOPIDOGREL
fIlm tableta
blister, 84 po 75 mg
M.D. Nini d.o.o.
Republika Srbija
1.760,80
75 mg
20,96
50%
blister, 30 po 75 mg
Ufar d.o.o. u saradnji
sa Sandoz
Pharmaceuticals d.d.
Slovenija
Republika Srbija
1.084,00
75 mg
36,13
50%
1086243
B01AC04
NAPOMENA
klopidogrel
CARDOGREL
film tableta
1. Lek se uvodi u terapiju na osnovu mišljenja lekara zdravstvene ustanove koja vrši ugradnju stenta i/ili grafta, a obavlja zdravstvenu delatnost na
sekundarnom ili tercijarnom nivou zdravstvene zaštite, za period do 12 meseci neposredno posle ugradnje stenta i/ili grafta.
2. Kod pacijenata u sekundarnoj prevenciji infarkta miokarda i mozga kod osoba koje su rezistentne na acetilsalicilnu kiselinu ( koji su imali jedan ili više
YDVNXODUQLKGRJDÿDMDDQDRVQRYXPLãOMHQMDNDUGLRORJDLOLLQWHUQLVWHLOLQHXURORJDQHXURSVLKLMDWUD
Lista A1 - Grupa B. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1068520
=DãWLüHQRLPH
ATC
INN
leka
B01AC30 klopidogrel, acetilsalicilna kiselina
B01AC30
klopidogrel,
acetilsalicilna
kiselina
DUOPLAVIN
FO
film tableta
Cena leka
na veliko
3DNRYDQMHLMDþLQD
Naziv
Država
za
leka
SURL]YRÿDþDOHND proizvodnje leka pakovanje
blister, 28 po (75 mg +
100 mg)
Sanofi Winthrop
Industrie
Francuska
1.194,00
DDD
1 tableta
Cena leka Participacija
na veliko osiguranog
po DDD
lica
42,64
60%
3UHYHQFLMDDWHURWURPERWLþNLKGRJDGMDMDQDRVQRYXPLãOMHQMDLQWHUQLVWH]DSHULRGRGPHVHFLQDNRQSUHOHåDQRJDNWXQRJLQIDUNWDPLRNDUGD
2. Kod bolesnika sa anginom pektoris i za prevenciju tromboze stenta 12 meseci nakon ugradnje stenta sa oslobadjanjem leka i mesec dana nakon ugradnje
INDIKACIJE
stenta bez leka, na osnovu mišljenja lekara zdravstvene ustanove koja vrši ugradnju stenta.
B03
ANTIANEMICI
B03A
3UHSDUDWLJYRåÿD
B03AA
'YRYDOHQWQRJYRåÿHRUDOQLSUHSDUDWL
B03AA02 ferofumarat
1060140
B03AA02
JYRåÿH,,IXPDUDW
HEFEROL
kapsula, tvrda
B03AB
B03AB05 JYRåÿH,,,KLGURNVLGSROLPDOWR]QLNRPSOHNV
1060072
B03AB05
1060075
B03AB05
blister, 30 po 350 mg
Alkaloid a.d.
Republika
Makedonija
310,40
0,2 g
17,99
15%
7URYDOHQWQRJYRåÿHRUDOQLSUHSDUDWL
JYRåÿH,,,KLGURNVLG
polimaltozni
kompleks
FERRUM SANDOZ tableta za žvakanje
30 po 100 mg
JYRåÿH,,,KLGURNVLG
polimaltozni
kompleks
REFERUM
tableta za žvakanje blister, 30 po 100 mg
Lek farmacevtska
družba d.d.
Slovenija
346,20
90 mg
10,39
15%
Slaviamed d.o.o.
Republika Srbija
346,20
90 mg
10,39
15%
Lista A1 - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPH
leka
C
C01
C01D
C01DA
C01DA02 gliceriltrinitrat (nitroglicerin)
7102621
C01DA02
C01E
C01EB
C01EB15
1109120
gliceriltrinitrat
(nitroglicerin)
NITROLINGUAL
Cena leka
Država
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
za
FO
leka
leka
leka
pakovanje
KARDIOVASKULARNI SISTEM (LEKOVI KOJI DELUJU NA KARDIOVASKULARNI SISTEM)
TERAPIJA BOLESTI SRCA
Vazodilatatori u terapiji bolesti srca
Organski nitrati
sublingvalni sprej
boca sa pumpom za
doziranje, 12,2 ml/ 200
doza (0,4 mg/doza)
G. Pohl-Boskamp
GmbH & Co. KG
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1HPDþND
543,00
2,5 mg
16,97
75%
Irska; Francuska;
Poljska
519,00
40 mg
9,89
65%
Ostali lekovi u terapiji bolesti srca
Ostali lekovi u terapiji bolesti srca
trimetazidin
film tableta sa
modifikovanim
RVOREDÿDQMHP
blister, 60 po 35 mg
Servier (Ireland)
Industries Ltd.; Les
Laboratoires Servier
Industrie; Anpharm
Przedsiebiorstwo
Farmaceutyczne S.A.
tableta sa produženim
RVOREDÿDQMHP
blister, 60 po 35 mg
Alvogen d.o.o.
Republika Srbija
432,60
40 mg
8,24
55%
TRIMECARD
tableta sa
modifikovanim
RVOREDÿDQMHP
blister, 30 po 35 mg
PharmaSwiss d.o.o.
Republika Srbija
216,30
40 mg
8,24
55%
TRIMECARD
tableta sa
modifikovanim
RVOREDÿDQMHP
blister, 60 po 35 mg
PharmaSwiss d.o.o.
Republika Srbija
432,60
40 mg
8,24
55%
C01EB15
trimetazidin
PREDUCTAL MR
C01EB15
trimetazidin
TRIMETACOR
1109142*
1109131
1109130
1109133
C01EB15
C01EB15
INDIKACIJE
NAPOMENA
trimetazidin
trimetazidin
%ROHVQLFLVDDQJLQRPSHNWRULV,NRMLLPDMXVLPSWRPHLSRUHGX]LPDQMDSXQHPHGLNDPHQWQHWHUDSLMHNRMDVDGUåLUD]OLþLWHNRPELQDFLMHDQWLDJUHJDFLRQLKOHNRYD
nitrata, beta blokatora, kalcijumskih antagonista, ACE inhibitora i antilipidnih lekova.
Lek se u terapiju uvodi na osnovu mišljenja interniste ili kardiologa.
* Lek je obrisan sa Liste lekova 30. juna 2013. godine.
Lista A1 - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
C02
C02A
C02AB
C02AB02
INN
=DãWLüHQRLPH
leka
FO
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
ANTIHIPERTENZIVI
Antiadrenergici centralnog delovanja
Metildopa
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
metildopa (racemat)
1103740
C02AB02
metildopa
METILDOPA
1103432
C02AB02
metildopa (racemat) METHYLDOPA
tableta
20 po 250 mg
Srbolek a.d.
Republika Srbija
118,60
2g
47,44
50%
film tableta
20 po 250 mg
Hemofarm a.d.
Republika Srbija
158,90
2g
63,56
50%
NAPOMENA
Lek se u terapiju uvodi na osnovu mišljenja interniste ili kardiologa.
C02AC
Agonisti imidazolinskih receptora
C02AC05 moksonidin
1103481
C02AC05
moksonidin
PHYSIOTENS
film tableta
blister, 28 po 0,2 mg
Abbott Healthcare SAS
Francuska
485,20
0,3 mg
25,99
60%
1103482
C02AC05
moksonidin
PHYSIOTENS
film tableta
blister, 28 po 0,4 mg
Abbott Healthcare SAS
Francuska
774,50
0,3 mg
20,75
60%
Les Laboratoires
Servier Industrie
Francuska
704,80
1 mg
23,49
60%
INDIKACIJE
Esencijalna arterijska hipertenzija (I10).
NAPOMENA
Lek se u terapiju uvodi na osnovu mišljenja interniste ili kardiologa.
C02AC06 rilmenidin
1103892
C02AC06
INDIKACIJE
rilmenidin
TENAXUM
tableta
blister, 30 po 1 mg
Esencijalna arterijska hipertenzija (I10).
Lek se u terapiju uvodi na osnovu mišljenja interniste ili kardiologa.
NAPOMENA
C02C
Antiadrenergici sa perifernim delovanjem
C02CA
$QWDJRQLVWLDOIDDGUHQHUJLþNLKUHFHSWRUD
C02CA04 doksazosin
1103765
C02CA04
doksazosin
ALPHAPRES
tableta
blister, 30 po 1 mg
Zdravlje a.d.
Republika Srbija
169,90
4 mg
22,65
60%
1103766
C02CA04
doksazosin
ALPHAPRES
tableta
blister, 30 po 2 mg
Zdravlje a.d.
Republika Srbija
288,10
4 mg
19,21
60%
NAPOMENA
Lek se u terapiju uvodi na osnovu mišljenja interniste ili urologa.
Lista A1 - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
C03
C03B
C03BA
C03BA11 indapamid
=DãWLüHQRLPH
leka
FO
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
DIURETICI
6ODELGLXUHWLFLLVNOMXþXMXüLWLD]LGH
Sulfonamidski diuretici, monokomponentni
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1103046
C03BA11
indapamid
INDAPRES SR
tableta sa produženim
RVOREDÿDQMHP
blister, 30 po 1,5 mg
Hemofarm a.d.
Republika Srbija
304,40
1 tableta
10,15
75%
1103051
C03BA11
indapamid
RAWEL SR
tableta sa produženim
RVOREDÿDQMHP
blister, 30 po 1,5 mg
Krka Tovarna Zdravil
d.d.
Slovenija
304,40
1 tableta
10,15
75%
1HPDþND
428,70
0,16 g
17,15
50%
%/2.$725,%(7$$'5(1(5*,ý.,+5(&(3725$
%HWDDGUHQHUJLþNLEORNDWRUL
%HWDDGUHQHUJLþNLEORNDWRULQHVHOHNWLYQL
C07
C07A
C07AA
C07AA07 sotalol
1107018
C07AA07
INDIKACIJE
sotalol
DAROB MITE
tableta
blister, 50 po 80 mg
Abbott GmbH & Co. KG
3RUHPHüDMULWPDVUFD,,,
NAPOMENA
Lek se u terapiju uvodi na osnovu mišljenja kardiologa ili interniste.
%HWDDGUHQHUJLþNLEORNDWRULVHOHNWLYQL
C07AB
C07AB02 metoprolol sukcinat
1107824
C07AB02
metoprolol sukcinat
BETALOC ZOK
tableta sa produženim
RVOREDÿDQMHP
blister, 28 po 25 mg
AstraZeneca AB
Švedska
189,70
0,15 g
38,62
40%
1107820
C07AB02
metoprolol sukcinat
BETALOC ZOK
tableta sa produženim
RVOREDÿDQMHP
blister, 28 po 50 mg
AstraZeneca AB
Švedska
225,60
0,15 g
22,96
40%
1107823
C07AB02
metoprolol sukcinat
BETALOC ZOK
tableta sa produženim
RVOREDÿDQMHP
blister, 28 po 100 mg
AstraZeneca AB
Švedska
269,70
0,15 g
13,73
40%
1107825
C07AB02
metoprolol sukcinat
BETALOC ZOK
tableta sa produženim ERþLFDSODVWLþQDSR
RVOREDÿDQMHP
25 mg
AstraZeneca GmbH
1HPDþND
203,30
0,15 g
38,63
40%
Lista A1 - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1107822
C07AB02
metoprolol sukcinat
BETALOC ZOK
tableta sa produženim ERþLFDSODVWLþQDSR
RVOREDÿDQMHP
50 mg
AstraZeneca GmbH
1HPDþND
241,70
0,15 g
22,96
40%
1107821
C07AB02
metoprolol sukcinat
BETALOC ZOK
tableta sa produženim ERþLFDSODVWLþQDSR
RVOREDÿDQMHP
100 mg
AstraZeneca GmbH
1HPDþND
289,00
0,15 g
13,73
40%
metoprolol sukcinat
METOPROLOL XL
SANDOZ
film tableta sa
modifikovanim
RVOREDÿDQMHP
blister, 30 po 47,5 mg
Salutas Pharma GmbH
1HPDþND
229,60
0,15 g
22,96
40%
metoprolol sukcinat
METOPROLOL XL
SANDOZ
film tableta sa
modifikovanim
RVOREDÿDQMHP
blister, 30 po 95 mg
Salutas Pharma GmbH
1HPDþND
274,50
0,15 g
13,73
40%
1107810
1107814
C07AB02
C07AB02
INDIKACIJE
6UþDQDLQVXILFLMHQFLMD,
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja kardiologa.
C07AB12 nebivolol
1107633
C07AB12
nebivolol
BINEVOL
tableta
blister, 30 po 5 mg
PharmaSwiss d.o.o.
Republika Srbija
351,70
5 mg
11,72
35%
1107645
C07AB12
nebivolol
NEBACOP
tableta
blister, 28 po 5 mg
Medico Uno d.o.o.
Republika Srbija
328,20
5 mg
11,72
35%
1107634
C07AB12
nebivolol
NEVOTENS
tableta
blister, 30 po 5 mg
Zdravlje a.d
Republika Srbija
351,70
5 mg
11,72
35%
%ORNDWRULDOIDLEHWDDGUHQHUJLþNLKUHFHSWRUD
C07AG
C07AG02 karvedilol
1107625
C07AG02
karvedilol
KARVILEKS
tableta
blister, 30 po 12,5 mg
Zdravlje a.d.
Republika Srbija
279,40
37,5 mg
27,94
50%
1107660
C07AG02
karvedilol
MILENOL
tableta
28 po 12,5 mg
Hemofarm a.d.
Republika Srbija
260,80
37,5 mg
27,94
50%
1107661
C07AG02
karvedilol
MILENOL
tableta
28 po 25 mg
Republika Srbija
387,50
37,5 mg
20,76
50%
1107621
C07AG02
karvedilol
DILATREND
tableta
28 po 12,5 mg
Švajcarska
260,80
37,5 mg
27,94
50%
1107622
C07AG02
karvedilol
DILATREND
tableta
28 po 25 mg
Hemofarm a.d.
F. Hoffmann-La Roche
Ltd.
F. Hoffmann-La Roche
Ltd.
Švajcarska
387,50
37,5 mg
20,76
50%
Lista A1 - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1107676
ATC
C07AG02
INN
karvedilol
=DãWLüHQRLPH
leka
CORYOL
FO
tableta
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
blister, 28 po 12,5 mg
Slaviamed d.o.o. u
saradnji sa Krka
Tovarna Zdravil d.d,
Slovenija
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
Republika Srbija
260,80
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
37,5 mg
27,94
50%
5 mg
10,75
35%
INDIKACIJE
1. Arterijska hipertenzija (I10; I12; I13; I15)
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja interniste ili kardiologa.
C08
BLOKATORI KALCIJUMSKIH KANALA
C08C
Selektivni blokatori kalcijumskih kanala sa pretežno vaskularnim delovanjem
C08CA
Derivati dihidropiridina
C08CA02 felodipin
1402821
C08CA02
felodipin
PLENDIL
tableta sa produženim ERþLFDSODVWLþQDSR
RVOREDÿDQMHP
5 mg
AstraZeneca AB
Švedska
322,50
1. Angina pektoris (I20),
INDIKACIJE
2. Arterijska hipertenzija ( I10; I11; I12; I13; I15 ).
C09
LEKOVI KOJI DELUJU NA RENIN-ANGIOTENZIN SISTEM
C09A
,QKLELWRULDQJLRWHQ]LQNRQYHUWXMXüHJHQ]LPD$&(PRQRNRPSRQHQWQL
C09AA
Inhibitori ACE, monokomponentni
C09AA04 perindopril
1103916
C09AA04
perindopril
PREXANIL
tableta
30 po 5 mg
Les Laboratoires
Servier
Francuska
466,20
4 mg
12,43
45%
1103915
C09AA04
perindopril
PREXANIL
tableta
30 po 10 mg
Les Laboratoires
Servier
Francuska
600,30
4 mg
8,00
45%
1103935
C09AA04
perindopril
NOPRITEX
tableta
blister, 30 po 4 mg
Pharmanova d.o.o.
Republika Srbija
315,60
4 mg
10,52
35%
1103929
C09AA04
perindopril
NOPRITEX
tableta
blister, 30 po 8 mg
Pharmanova d.o.o.
Republika Srbija
406,30
4 mg
6,77
35%
1103955
C09AA04
perindopril
RANBAPRIL
tableta
blister, 30 po 4 mg
Medico Uno d.o.o.
Republika Srbija
315,60
4 mg
10,52
35%
1103956
C09AA04
perindopril
RANBAPRIL
tableta
blister, 30 po 8 mg
Medico Uno d.o.o.
Republika Srbija
406,30
4 mg
6,77
35%
1103856
C09AA04
perindopril
PERIGARD
tableta
blister, 30 po 4 mg
PharmaSwiss d.o.o.
Republika Srbija
315,60
4 mg
10,52
35%
1103857
C09AA04
perindopril
PERIGARD
tableta
blister, 30 po 8 mg
PharmaSwiss d.o.o.
Republika Srbija
406,30
4 mg
6,77
35%
Lista A1 - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1103731
1103732
ATC
INN
C09AA06 kvinapril
C09AA06
C09AA06
kvinapril
kvinapril
=DãWLüHQRLPH
leka
HEMOKVIN
HEMOKVIN
FO
film tableta
film tableta
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
blister, 20 po 10 mg
Hemofarm a.d. u
saradnji sa Pfizer
H.C.P Corporation,
USA
Republika Srbija
blister, 20 po 20 mg
Hemofarm a.d. u
saradnji sa Pfizer
H.C.P Corporation,
USA
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
187,30
15 mg
14,05
55%
Republika Srbija
221,80
15 mg
8,32
25%
Galenika a.d. u saradnji
sa F. Hoffmann-La
Roche Ltd, Švajcarska Republika Srbija
425,80
2,5 mg
14,19
55%
Galenika a.d. u saradnji
kontejner za tablete, 30
sa F. Hoffmann-La
po 5 mg
Roche Ltd, Švajcarska Republika Srbija
758,40
2,5 mg
12,64
55%
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
C09AA08 cilazapril
1103702
C09AA08
cilazapril
PRILAZID
film tableta
blister, 30 po 2,5 mg
1103704
C09AA08
cilazapril
PRILAZID
film tableta
1103883
C09AA08
cilazapril
ZOBOX
film tableta
blister, 30 po 5 mg
Hemofarm a.d.
Republika Srbija
758,40
2,5 mg
12,64
55%
1103882
C09AA08
cilazapril
ZOBOX
film tableta
blister, 30 po 2,5 mg
Hemofarm a.d.
Republika Srbija
425,80
2,5 mg
14,19
55%
blister, 28 po 2,5 mg
Roche Farma, S.A.; F.
Hoffmann-La Roche
Ltd.
Španija;
Švajcarska
397,40
2,5 mg
14,19
55%
Španija;
Švajcarska
707,80
2,5 mg
12,64
55%
1103712
1103714
C09AA08
C09AA08
cilazapril
cilazapril
INHIBACE
film tableta
INHIBACE
film tableta
blister, 28 po 5 mg
Roche Farma, S.A.; F.
Hoffmann-La Roche
Ltd.
C09AA09 fosinopril
1103810
C09AA09
fosinopril
MONOPRIL
tableta
blister, 28 po 10 mg
PharmaSwiss d.o.o.
Republika Srbija
305,40
15 mg
16,36
50%
1103811
C09AA09
fosinopril
MONOPRIL
tableta
blister, 28 po 20 mg
PharmaSwiss d.o.o.
Republika Srbija
442,20
15 mg
11,84
50%
1103814
C09AA09
fosinopril
FOSINOPRIL-TEVA
tableta
blister, 30 po 10 mg
Teva Pharmaceutical
Industries Ltd.
Izrael
327,20
15 mg
16,36
50%
Lista A1 - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1103815
ATC
C09AA09
INN
fosinopril
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
=DãWLüHQRLPH
leka
FO
FOSINOPRIL-TEVA
tableta
blister, 30 po 20 mg
Teva Pharmaceutical
Industries Ltd.
Izrael
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
473,70
15 mg
11,84
50%
C09AA10 trandolapril
1103940
C09AA10
trandolapril
TRANDOLAPRIL
PHARMAS
kapsula, tvrda
blister, 28 po 0,5 mg
PharmaS d.o.o.
Republika Srbija
163,20
2 mg
23,31
60%
1103941
C09AA10
trandolapril
TRANDOLAPRIL
PHARMAS
kapsula, tvrda
blister, 28 po 2 mg
PharmaS d.o.o.
Republika Srbija
399,20
2 mg
14,26
60%
1103942
C09AA10
trandolapril
TRANDOLAPRIL
PHARMAS
kapsula, tvrda
blister, 28 po 4 mg
PharmaS d.o.o.
Republika Srbija
515,70
2 mg
9,21
60%
Menarini Von Heyden
GmbH; A. Menarini
Manufacturing Logistics
and Services S.R.L.
1HPDþND,WDOLMD
688,70
30 mg
24,60
75%
C09AA15 zofenopril
1103467
C09AA15
INDIKACIJE
zofenopril
ZOFECARD
film tableta
blister, 28 po 30 mg
1. Esencijalna arterijska hipertenzija (I10).
Lek se u terapiju uvodi na osnovu mišljenja interniste ili kardiologa.
NAPOMENA
C09B
Inhibitori ACE, kombinacije
C09BA
Inhibitori ACE i diuretici
C09BA04 perindopril, indapamid
1401260
C09BA04
perindopril,
indapamid
NOPRITEX PLUS
tableta
blister, 30 po (2 mg +
0,625 mg)
Pharmanova d.o.o.
Republika Srbija
233,40
1 tableta
7,78
35%
1401261
C09BA04
perindopril,
indapamid
NOPRITEX PLUS
tableta
blister, 30 po (4 mg +
1,25 mg)
Pharmanova d.o.o.
Republika Srbija
417,60
1 tableta
13,92
35%
1401251
C09BA04
perindopril,
indapamid
CO-PRENESSA
tableta
blister, 30 po (2 mg +
0,625 mg)
Krka Tovarna Zdravil
d.d.
Slovenija
233,40
1 tableta
7,78
35%
1401252
C09BA04
perindopril,
indapamid
CO-PRENESSA
tableta
blister, 30 po (4 mg +
1,25 mg)
Krka Tovarna Zdravil
d.d.
Slovenija
417,60
1 tableta
13,92
35%
Lista A1 - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1401917
ATC
C09BA04
INN
perindopril,
indapamid
=DãWLüHQRLPH
leka
PREXANIL COMBI
LD
FO
film tableta
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
kontejner, 30 po (2,5 mg
+ 0,625 mg)
Les Laboratoires
Servier Industrie;
Servier (Ireland)
Industries LTD
Francuska; Irska
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
1401606
C09BA04
perindopril,
indapamid
PREXANIL COMBI
film tableta
kontejner, 30 po (5 mg +
1,25 mg)
Les Laboratoires
Servier Industrie;
Servier (Ireland)
Industries LTD
1401190
C09BA04
perindopril,
indapamid
PERIGARD PLUS
tableta
blister, 30 po (4
mg+1,25 mg)
PharmaSwiss d.o.o.
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
291,80
1 tableta
9,73
35%
Francuska; Irska
644,10
1 tableta
21,47
45%
Republika Srbija
417,60
1 tableta
13,92
35%
=DOHþHQMHHVHQFLMDOQHDUWHULMVNHKLSHUWHQ]LMH,XNROLNRVHWURPHVHþQROHþHQMHSRMHGLQDþQLPOHNRYLPDNRMLVHNRULVWH]DOHþHQMHKLSHUWHQ]LMHXNOMXþXMXüLOHþHQMH
INDIKACIJE
VDYLãHSRMHGLQDþQLKOHNRYDLVWRYUHPHQRSRND]DORQHGRYROMQRHILNDVQR
C09BA06 kvinapril, hidrohlortiazid
1401030
1401055
C09BA06
kvinapril,
hidrohlortiazid
HEMOKVIN PLUS
C09BA06
kvinapril,
hidrohlortiazid
KVINAPRIL/HIDRO
HLORTIAZID
film tableta
blister, 20 po (20 mg +
12,5 mg)
Hemofarm a.d.
Republika Srbija
248,70
1 tableta
12,44
20%
film tableta
blister, 28 po (20 mg +
12,5 mg)
Teva Pharmaceutical
Works Private Ltd.
Company
0DÿDUVND
348,10
1 tableta
12,43
20%
=DOHþHQMHHVHQFLMDOQHDUWHULMVNHKLSHUWHQ]LMH,XNROLNRVHWURPHVHþQROHþHQMHSRMHGLQDþQLPOHNRYLPDNRMLVHNRULVWH]DOHþHQMHKLSHUWHQ]LMHXNOMXþXMXüLOHþHQMH
INDIKACIJE
VDYLãHSRMHGLQDþQLKOHNRYDLVWRYUHPHQRSRND]DORQHGRYROMQRHILNDVQR
C09BA08 cilazapril, hidrohlortiazid
1401400
C09BA08
cilazapril,
hidrohlortiazid
PRILAZID PLUS
film tableta
blister, 30 po (5 mg +
12,5 mg)
Galenika a.d.
Republika Srbija
803,40
1 tableta
26,78
50%
1401401
C09BA08
cilazapril,
hidrohlortiazid
INHIBACE PLUS
film tableta
blister, 28 po (5 mg +
12,5 mg)
F. Hoffmann-La Roche
Ltd.
Švajcarska
749,70
1 tableta
26,78
50%
INDIKACIJE
=DOHþHQMHHVHQFLMDOQHDUWHULMVNHKLSHUWHQ]LMH,XNROLNRVHWURPHVHþQROHþHQMHSRMHGLQDþQLPOHNRYLPDNRMLVHNRULVWH]DOHþHQMHKLSHUWHQ]LMHXNOMXþXMXüLOHþHQMH
VDYLãHSRMHGLQDþQLKOHNRYDLVWRYUHPHQRSRND]DORQHGRYROMQRHILNDVQR
Lista A1 - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1401236
=DãWLüHQRLPH
ATC
INN
leka
C09BA09 fosinopril, hidrohlortiazid
C09BA09
fosinopril,
hidrohlortiazid
MONOPRIL PLUS
FO
tableta
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
blister, 28 po (20 mg +
12,5 mg)
PharmaSwiss d.o.o.
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
Republika Srbija
484,10
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1 tableta
17,29
50%
=DOHþHQMHHVHQFLMDOQHDUWHULMVNHKLSHUWHQ]LMH,XNROLNRVHWURPHVHþQROHþHQMHSRMHGLQDþQLPOHNRYLPDNRMLVHNRULVWH]DOHþHQMHKLSHUWHQ]LMHXNOMXþXMXüLOHþHQMH
INDIKACIJE
VDYLãHSRMHGLQDþQLKOHNRYDLVWRYUHPHQRSRND]DORQHGRYROMQRHILNDVQR
C09BB
ACE inhibitori i blokatori kalcijumskih kanala
C09BB03 lizinopril, amlodipin
1103884
C09BB03
lizinopril, amlodipin
LISONORM
tableta
blister, 30 po (10 mg + 5
mg)
Gedeon Richter PLC
0DÿDUVND
439,60
1 tableta
14,65
25%
1103455
C09BB03
lizinopril, amlodipin
LISONORM FORTE
tableta
blister, 30 po (20 mg +
10 mg)
Gedeon Richter PLC
0DÿDUVND
698,90
1 tableta
23,30
25%
=DOHþHQMHHVHQFLMDOQHDUWHULMVNHKLSHUWHQ]LMH,XNROLNRVHWURPHVHþQROHþHQMHSRMHGLQDþQLPOHNRYLPDNRMLVHNRULVWH]DOHþHQMHKLSHUWHQ]LMHXNOMXþXMXüLOHþHQMH
INDIKACIJE
VDYLãHSRMHGLQDþQLKOHNRYDLVWRYUHPHQRSRND]DORQHGRYROMQRHILNDVQR
C09BB04 perindopril, amlodipin
1103112
1103114
1103115
1103116
C09BB04
C09BB04
C09BB04
C09BB04
INDIKACIJE
perindopril, amlodipin PREXANOR
perindopril, amlodipin PREXANOR
perindopril, amlodipin PREXANOR
perindopril, amlodipin PREXANOR
tableta
tableta
tableta
tableta
NRQWHMQHUSODVWLþQL
po (5 mg + 5 mg)
Servier (Ireland)
Industries Ltd.; Les
Laboratoires Servier
Industrie
Irska; Francuska
691,70
1 tableta
23,06
60%
NRQWHMQHUSODVWLþQL
po (5 mg + 10 mg)
Servier (Ireland)
Industries Ltd.; Les
Laboratoires Servier
Industrie
Irska; Francuska
763,90
1 tableta
25,46
60%
NRQWHMQHUSODVWLþQL
po (10 mg + 5 mg)
Servier (Ireland)
Industries Ltd.; Les
Laboratoires Servier
Industrie
Irska; Francuska
853,80
1 tableta
28,46
45%
NRQWHMQHUSODVWLþQL
po (10 mg + 10 mg)
Servier (Ireland)
Industries Ltd.; Les
Laboratoires Servier
Industrie
Irska; Francuska
925,90
1 tableta
30,86
45%
=DOHþHQMHHVHQFLMDOQHDUWHULMVNHKLSHUWHQ]LMH,XNROLNRVHWURPHVHþQROHþHQMHSRMHGLQDþQLPOHNRYLPDNRMLVHNRULVWH]DOHþHQMHKLSHUWHQ]LMHXNOMXþXMXüLOHþHQMH
VDYLãHSRMHGLQDþQLKOHNRYDLVWRYUHPHQRSRND]DORQHGRYROMQRHILNDVQR
Lista A1 - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1403021
1403020
ATC
INN
C09BB05 ramipril, felodipin
C09BB05
C09BB05
ramipril, felodipin
ramipril, felodipin
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
TRIAPIN MITE
tableta sa produženim blister, 28 po (2,5 mg +
RVOREDÿDQMHP
2,5 mg)
Chinoin Pharmaceutical
and Chemical Works
Co. Ltd.
0DÿDUVND
420,90
1 tableta
15,03
40%
TRIAPIN
tableta sa produženim blister, 28 po (5 mg+ 5
RVOREDÿDQMHP
mg)
Chinoin Pharmaceutical
and Chemical Works
Co. Ltd.
0DÿDUVND
448,90
1 tableta
16,03
25%
=DOHþHQMHHVHQFLMDOQHDUWHULMVNHKLSHUWHQ]LMH,XNROLNRVHWURPHVHþQROHþHQMHSRMHGLQDþQLPOHNRYLPDNRMLVHNRULVWH]DOHþHQMHKLSHUWHQ]LMHXNOMXþXMXüLOHþHQMH
INDIKACIJE
VDYLãHSRMHGLQDþQLKOHNRYDLVWRYUHPHQRSRND]DORQHGRYROMQRHILNDVQR
C09C
Antagonisti receptora angiotenzina II, monokomponentni
C09CA
Antagonisti receptora angiotenzina II, monokomponentni
C09CA01 losartan
1103150
C09CA01
losartan
ERYNORM
film tableta
blister, 28 po 50 mg
Hemofarm a.d.
Republika Srbija
337,40
50 mg
12,05
35%
1103151
C09CA01
losartan
ERYNORM
film tableta
blister, 28 po 100 mg
Hemofarm a.d.
Republika Srbija
546,50
50 mg
9,76
35%
1103899
C09CA01
losartan
LOSARTAN
film tableta
blister, 28 po 50 mg
PharmaS d.o.o.
Republika Srbija
337,40
50 mg
12,05
35%
1103594
C09CA01
losartan
LOSAR
film tableta
blister, 30 po 50 mg
Galenika a.d.
Republika Srbija
361,40
50 mg
12,05
35%
1103000
C09CA01
losartan
LOTAR
film tableta
blister, 30 po 50 mg
Alkaloid d.o.o.
Republika Srbija
361,40
50 mg
12,05
35%
1103001
C09CA01
losartan
LOTAR
film tableta
blister, 30 po 100 mg
Alkaloid d.o.o.
Republika Srbija
585,60
50 mg
9,76
35%
1103909
C09CA01
losartan
RASOLTAN
film tableta
blister, 28 po 50 mg
Zdravlje a.d.
Republika Srbija
337,40
50 mg
12,05
35%
INDIKACIJE
NAPOMENA
1. Arterijska hipertenzija (I10; I11; I12; I13; I15);
6UþDQDLQVXILFLMHQFLMDVD()PDQMRPRGNRGEROHVQLNDNRMLQHWROHULãX$&(LQKLELWRUHQDMþHãüH]ERJXSRUQRJVXYRJNDãOMD,
Lek se u terapiju uvodi na osnovu mišljenja interniste ili kardiologa.
Lista A1 - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
C09CA03 valsartan
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1103446
C09CA03
valsartan
VALSACOR
film tableta
blister, 28 po 80 mg
Krka Tovarna Zdravil
d.d.
Slovenija
462,70
80 mg
16,53
50%
1103445
C09CA03
valsartan
VALSACOR
film tableta
blister, 28 po 160 mg
Krka Tovarna Zdravil
d.d.
Slovenija
632,40
80 mg
11,29
50%
1103780
C09CA03
valsartan
TENIVAL
film tableta
blister, 28 po 80 mg
Pharmanova d.o.o.
Republika Srbija
462,70
80 mg
16,53
50%
1103781
C09CA03
valsartan
TENIVAL
film tableta
blister, 28 po 160 mg
Pharmanova d.o.o.
Republika Srbija
632,40
80 mg
11,29
50%
1103438
C09CA03
valsartan
VALSARTAN
SANDOZ
film tableta
blister, 28 po 80 mg
Novartis Farmaceutica
S.A.
Španija
462,70
80 mg
16,53
50%
1103439
C09CA03
valsartan
VALSARTAN
SANDOZ
film tableta
blister, 28 po 160 mg
Novartis Farmaceutica
S.A.
Španija
632,40
80 mg
11,29
50%
INDIKACIJE
1. Esencijalna arterijska hipertenzija (I10);
6UþDQDLQVXILFLMHQFLMDVD()PDQMRPRGNRGEROHVQLNDNRMLQHWROHULãX$&(LQKLELWRUHQDMþHãüH]ERJXSRUQRJVXYRJNDãOMD,
NAPOMENA
Lek se u terapiju uvodi na osnovu mišljenja interniste ili kardiologa.
C09CA04 irbesartan
1103401
C09CA04
irbesartan
IRBENIDA
film tableta
blister, 30 po 150 mg
Hemofarm a.d.
Republika Srbija
1.051,00
0,15 g
35,03
80%
1103403
C09CA04
irbesartan
IRBENIDA
film tableta
blister, 30 po 300 mg
Hemofarm a.d.
Republika Srbija
1.401,60
0,15 g
23,36
80%
1HPDþND
Francuska
555,80
40 mg
19,85
70%
INDIKACIJE
+LSHUWHQ]LMDNRGSDFLMHQDWDVDGLDEHWHVPHOOLWXVRPWLSNRGGLMDEHWLþQHQHIURSDWLMH,
NAPOMENA
Lek se u terapiju uvodi na osnovu mišljenja interniste ili kardiologa.
C09CA07 telmisartan
1103890
C09CA07
telmisartan
MICARDIS
tableta
blister, 28 po 40 mg
Boehringer Ingelheim
Pharma GmbH & Co.
KG; Delpharm Reims
Lista A1 - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
1HPDþND
Francuska
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
957,80
40 mg
17,10
70%
1103891
C09CA07
telmisartan
MICARDIS
tableta
28 po 80 mg
Boehringer Ingelheim
Pharma GmbH & Co.
KG; Delpharm Reims
1103889
C09CA07
telmisartan
TELMITENS
tableta
blister, 30 po 40 mg
PharmaSwiss d.o.o.
Republika Srbija
496,20
40 mg
16,54
55%
1103789
C09CA07
telmisartan
TELMITENS
tableta
blister, 30 po 80 mg
PharmaSwiss d.o.o.
Republika Srbija
855,10
40 mg
14,25
55%
INDIKACIJE
1. Esencijalna arterijska hipertenzija ( I10 );
6UþDQDLQVXILFLMHQFLMDVD()PDQMRPRGNRGEROHVQLNDNRMLQHWROHULãX$&(LQKLELWRUHQDMþHãüH]ERJXSRUQRJVXYRJNDãOMD
Lek se u terapiju uvodi na osnovu mišljenja kardiologa ili interniste.
NAPOMENA
C09D
Antagonisti receptora angiotenzina II, kombinacije
C09DA
Antagonisti receptora angiotenzina II i diuretici
C09DA01 losartan, hidrohlortiazid
1401914
C09DA01
losartan,
hidrohlortiazid
LOSAR PLUS
film tableta
blister, 30 po (50 mg +
12,5 mg)
Galenika a.d.
Republika Srbija
371,00
1 tableta
12,37
35%
1401560
C09DA01
losartan,
hidrohlortiazid
ERYNORM PLUS
film tableta
blister, 28 po (50
mg+12,5 mg)
Hemofarm a.d.
Republika Srbija
346,30
1 tableta
12,37
35%
INDIKACIJE
=DOHþHQMHDUWHULMVNHKLSHUWHQ]LMH,L,XNROLNRVHWURPHVHþQROHþHQMHSRMHGLQDþQLPOHNRYLPDNRMLVHNRULVWH]DOHþHQMHKLSHUWHQ]LMHXNOMXþXMXüLOHþHQMHVDYLãH
SRMHGLQDþQLKOHNRYDLVWRYUHPHQRSRND]DORQHGRYROMQRHILNDVQR
NAPOMENA
Lek se u terapiju uvodi na osnovu mišljenja kardiologa ili interniste.
C09DA03 valsartan, hidrohlortiazid
1401924
C09DA03
valsartan,
hidrohlortiazid
VALSACOMBI
film tableta
blister, 28 po (80 mg +
12,5 mg)
Krka Tovarna Zdravil
d.d.
Slovenija
460,20
1 tableta
16,44
50%
1401926
C09DA03
valsartan,
hidrohlortiazid
VALSACOMBI
film tableta
blister, 28 po (160 mg +
12,5 mg)
Krka Tovarna Zdravil
d.d.
Slovenija
586,80
1 tableta
20,96
50%
Lista A1 - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
C09DA03
valsartan,
hidrohlortiazid
C09DA03
valsartan,
hidrohlortiazid
C09DA03
valsartan,
hidrohlortiazid
1401652
C09DA03
valsartan,
hidrohlortiazid
TENIVAL PLUS
film tableta
blister, 28 (160 mg + 25
mg)
1401045
C09DA03
valsartan,
hidrohlortiazid
VALSARTAN/HCT
SANDOZ
film tableta
blister, 28 po (80 mg +
12,5 mg)
Novartis Farma S.P.A.
Italija
460,20
1 tableta
16,44
50%
C09DA03
valsartan,
hidrohlortiazid
VALSARTAN/HCT
SANDOZ
film tableta
blister, 28 po (160 mg +
12,5 mg)
Novartis Farma S.P.A.
Italija
586,80
1 tableta
20,96
50%
C09DA03
valsartan,
hidrohlortiazid
VALSARTAN/HCT
SANDOZ
film tableta
blister, 28 po (160 mg +
25 mg)
Novartis Farma S.P.A.
Italija
586,80
1 tableta
20,96
50%
1401925
1401650
1401651
1401046
1401047
INDIKACIJE
VALSACOMBI
TENIVAL PLUS
TENIVAL PLUS
film tableta
blister, 28 po (160 mg +
25 mg)
Krka Tovarna Zdravil
d.d.
Slovenija
586,80
1 tableta
20,96
50%
film tableta
blister, 28 (80 mg + 12,5
mg)
Pharmanova d.o.o.
Republika Srbija
460,20
1 tableta
16,44
50%
film tableta
blister, 28 (160 mg +
12,5 mg)
Pharmanova d.o.o.
Republika Srbija
586,80
1 tableta
20,96
50%
Pharmanova d.o.o.
Republika Srbija
586,80
1 tableta
20,96
50%
=DOHþHQMHHVHQFLMDOQHDUWHULMVNHKLSHUWHQ]LMH,XNROLNRVHWURPHVHþQROHþHQMHSRMHGLQDþQLPOHNRYLPDNRMLVHNRULVWH]DOHþHQMHKLSHUWHQ]LMHXNOMXþXMXüL
OHþHQMHVDYLãHSRMHGLQDþQLKOHNRYDLVWRYUHPHQRSRND]DORQHGRYROMQRHILNDVQR
NAPOMENA
Lek se u terapiju uvodi na osnovu mišljenja kardiologa ili interniste.
C09DA04 irbesartan, hidrohlortiazid
1401662
C09DA04
irbesartan,
hidrohlortiazid
IRBENIDA PLUS
film tableta
blister, 30 po (150 mg +
12,5 mg)
Hemofarm a.d.
Republika Srbija
1.051,40
1 tableta
35,05
80%
1401663
C09DA04
irbesartan,
hidrohlortiazid
IRBENIDA PLUS
film tableta
blister, 30 po (300 mg +
12,5 mg)
Hemofarm a.d.
Republika Srbija
1.401,60
1 tableta
46,72
80%
INDIKACIJE
=DOHþHQMHHVHQFLMDOQHDUWHULMVNHKLSHUWHQ]LMH,XNROLNRVHWURPHVHþQROHþHQMHSRMHGLQDþQLPOHNRYLPDNRMLVHNRULVWH]DOHþHQMHKLSHUWHQ]LMHXNOMXþXMXüL
OHþHQMHVDYLãHSRMHGLQDþQLKOHNRYDLVWRYUHPHQRSRND]DORQHGRYROMQRHILNDVQR
NAPOMENA
Lek se u terapiju uvodi na osnovu mišljenja kardiologa ili interniste.
C09DA07 telmisartan, hidrohlortiazid
1401053
C09DA07
telmisartan,
hidrohlortiazid
MICARDIS PLUS
tableta
28 po (80 mg + 12.5
mg)
Boehringer Ingelheim
Pharma GmbH & Co.
KG
1HPDþND
1.024,80
1 tableta
36,60
70%
INDIKACIJE
=DOHþHQMHHVHQFLMDOQHDUWHULMVNHKLSHUWHQ]LMH,XNROLNRVHWURPHVHþQROHþHQMHSRMHGLQDþQLPOHNRYLPDNRMLVHNRULVWH]DOHþHQMHKLSHUWHQ]LMHXNOMXþXMXüL
OHþHQMHVDYLãHSRMHGLQDþQLKOHNRYDLVWRYUHPHQRSRND]DORQHGRYROMQRHILNDVQR
NAPOMENA
Lek se u terapiju uvodi na osnovu mišljenja kardiologa ili interniste.
Lista A1 - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
C10
C10A
C10AA
C10AA01 simvastatin
=DãWLüHQRLPH
leka
Cena leka
Država
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
za
FO
leka
leka
leka
pakovanje
SREDSTVA KOJA SMANJUJU LIPIDE U SERUMU ( HIPOLIPEMICI )
Lekovi koji smanjuju nivo holesterola i triglicerida
Inhibitori HMG CoA reduktaze
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1104510
C10AA01
simvastatin
CHOLIPAM
film tableta
20 po 10 mg
Hemofarm a.d.
Republika Srbija
162,10
30 mg
24,32
80%
1104511
C10AA01
simvastatin
CHOLIPAM
film tableta
20 po 20 mg
Hemofarm a.d.
Republika Srbija
283,10
30 mg
21,23
80%
1104440
C10AA01
simvastatin
ZOCOR
film tableta
28 po 10 mg
Merck Sharp & Dohme
Holandija
226,90
30 mg
24,31
80%
1104441
C10AA01
simvastatin
ZOCOR
film tableta
28 po 20 mg
Merck Sharp & Dohme
Holandija
396,30
30 mg
21,23
80%
1104445
C10AA01
simvastatin
ZOCOR
film tableta
28 po 40 mg
Merck Sharp & Dohme
Holandija
585,00
30 mg
15,67
80%
1104490
C10AA01
simvastatin
VASILIP
film tableta
blister, 28 po 10 mg
Slaviamed d.o.o.
Republika Srbija
226,90
30 mg
24,31
80%
1104491
C10AA01
simvastatin
VASILIP
film tableta
blister, 28 po 20 mg
Slaviamed d.o.o.
Republika Srbija
396,30
30 mg
21,23
80%
1104492
C10AA01
simvastatin
VASILIP
film tableta
blister, 28 po 40 mg
Slaviamed d.o.o.
Republika Srbija
585,00
30 mg
15,67
80%
1104610
C10AA01
simvastatin
HOLLESTA
film tableta
blister, 30 po 10 mg
Alkaloid d.o.o.
Republika Srbija
243,20
30 mg
24,32
80%
1104611
C10AA01
simvastatin
HOLLESTA
film tableta
blister, 30 po 20 mg
Alkaloid d.o.o.
Republika Srbija
424,50
30 mg
21,23
80%
1104612
C10AA01
simvastatin
HOLLESTA
film tableta
blister, 30 po 40 mg
Alkaloid d.o.o.
Republika Srbija
626,70
30 mg
15,67
80%
1104613
C10AA01
simvastatin
SIMVASTATIN
PHARMAS
film tableta
blister 28 po 10 mg
PharmaS d.o.o.
Republika Srbija
226,90
30 mg
24,31
80%
1104614
C10AA01
simvastatin
SIMVASTATIN
PHARMAS
film tableta
blister 28 po 20 mg
PharmaS d.o.o.
Republika Srbija
396,30
30 mg
21,23
80%
$NXWQLLQIDUNWPLRNDUGD,NDRKURQLþQDWHUDSLMDQDNRQSUHOHåDQRJDNXWQRJLQIDUNWDPLRNDUGDNDRSUHYHQFLMDSRQRYQRJLQIDUNWDPLRNDUGD
INDIKACIJE
2. Infarkt mozga ( I63 ) - samo za pacijente koji su imali infarkt mozga kao prevencija ponovljenog infarkta mozga.
Lek se uvodi u terapiju na osnovu mišljenja kardiologa ili interniste ili neurologa/neuropsihijatra.
NAPOMENA
C10AA03 pravastatin
1104482
C10AA03
pravastatin
PRAVACOR
tableta
30 po 20 mg
PharmaSwiss d.o.o.
Republika Srbija
297,20
30 mg
14,86
75%
Lista A1 - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1104483
C10AA03
pravastatin
PRAVACOR
tableta
blister, 30 po 40 mg
PharmaSwiss d.o.o.
Republika Srbija
982,90
30 mg
24,57
75%
1104485
C10AA03
pravastatin
PRALIP
tableta
blister, 30 po 20 mg
Lek farmacevtska
družba d.d.
Slovenija
297,20
30 mg
14,86
75%
1104486
C10AA03
pravastatin
PRALIP
tableta
blister, 30 po 40 mg
Lek farmacevtska
družba d.d.
Slovenija
982,90
30 mg
24,57
75%
1104454
C10AA03
pravastatin
PRAVAPRES
tableta
blister, 30 po 20 mg
Sopharma PLC
Bugarska
297,20
30 mg
14,86
75%
INDIKACIJE
$NXWQLLQIDUNWPLRNDUGD,NDRKURQLþQDWHUDSLMDQDNRQSUHOHåDQRJDNXWQRJLQIDUNWDPLRNDUGDNDRSUHYHQFLMDSRQRYQRJLQIDUNWDPLRNDUGD
2. Infarkt mozga ( I63 ) - samo za pacijente koji su imali infarkt mozga kao prevencija ponovnog infarkta mozga.
Lek se uvodi u terapiju na osnovu mišljenja kardiologa ili interniste ili neurologa/neuropsihijatra.
NAPOMENA
C10AA05 atorvastatin
1104460
C10AA05
atorvastatin
SORTIS
film tableta
blister, 30 po 10 mg
Pfizer Manufacturing
Deutschland GmbH
1HPDþND
440,50
20 mg
29,37
85%
1104462
C10AA05
atorvastatin
SORTIS
film tableta
blister, 30 po 20 mg
Pfizer Manufacturing
Deutschland GmbH
1HPDþND
778,00
20 mg
25,93
85%
1104464
C10AA05
atorvastatin
SORTIS
film tableta
blister, 30 po 40 mg
Pfizer Manufacturing
Deutschland GmbH
1HPDþND
1.156,80
20 mg
19,28
85%
1104465
C10AA05
atorvastatin
SORTIS
film tableta
blister, 30 po 80 mg
Pfizer Manufacturing
Deutschland GmbH
1HPDþND
2.405,20
20 mg
20,04
85%
1104125
C10AA05
atorvastatin
ATACOR
film tableta
blister, 30 po 10 mg
Zdravlje a.d.
Republika Srbija
440,50
20 mg
29,37
85%
1104126
C10AA05
atorvastatin
ATACOR
film tableta
blister, 30 po 20 mg
Zdravlje a.d.
Republika Srbija
778,00
20 mg
25,93
85%
1104127
C10AA05
atorvastatin
ATACOR
film tableta
blister, 30 po 40 mg
Zdravlje a.d.
Republika Srbija
1.156,80
20 mg
19,28
85%
1104520
C10AA05
atorvastatin
ATORIS
film tableta
blister, 30 po 10 mg
Slaviamed d.o.o.
Republika Srbija
440,50
20 mg
29,37
85%
Lista A1 - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1104522
C10AA05
atorvastatin
ATORIS
film tableta
blister, 30 po 20 mg
Slaviamed d.o.o.
Republika Srbija
778,00
20 mg
25,93
85%
1104759
C10AA05
atorvastatin
DISLIPAT
film tableta
blister, 30 po 10 mg
Medico Uno d.o.o.
Republika Srbija
440,50
20 mg
29,37
85%
1104760
C10AA05
atorvastatin
DISLIPAT
film tableta
blister, 30 po 20 mg
Medico Uno d.o.o.
Republika Srbija
778,00
20 mg
25,93
85%
1104551
C10AA05
atorvastatin
ATOLIP
film tableta
blister, 30 po 10 mg
Galenika a.d.
Republika Srbija
440,50
20 mg
29,37
85%
1104552
C10AA05
atorvastatin
ATOLIP
film tableta
blister, 30 po 20 mg
Galenika a.d.
Republika Srbija
778,00
20 mg
25,93
85%
blister, 30 po 10 mg
Ufar d.o.o. u saradnji
sa Sandoz
Pharmaceuticals d.d.
Slovenija
Republika Srbija
440,50
20 mg
29,37
85%
Republika Srbija
778,00
20 mg
25,93
85%
1104601
C10AA05
atorvastatin
TULIP
film tableta
1104600
C10AA05
atorvastatin
TULIP
film tableta
blister, 30 po 20 mg
Ufar d.o.o. u saradnji
sa Sandoz
Pharmaceuticals d.d.
Slovenija
1104555
C10AA05
atorvastatin
HIPOLIP
film tableta
blister, 30 po 10 mg
Hemofarm a.d.
Republika Srbija
440,50
20 mg
29,37
85%
1104556
C10AA05
atorvastatin
HIPOLIP
film tableta
blister, 30 po 20 mg
Hemofarm a.d.
Republika Srbija
778,00
20 mg
25,93
85%
1104557
C10AA05
atorvastatin
HIPOLIP
film tableta
blister, 30 po 40 mg
Hemofarm a.d.
Republika Srbija
1.156,80
20 mg
19,28
85%
1104790
C10AA05
atorvastatin
HIPOLIP
film tableta
blister, 30 po 80 mg
Hemofarm a.d.
Republika Srbija
2.405,20
20 mg
20,04
85%
Lista A1 - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1104605
C10AA05
atorvastatin
ATORVASTATIN
PHARMAS
film tableta
blister, 30 po 10 mg
PharmaS d.o.o.
Republika Srbija
440,50
20 mg
29,37
85%
1104606
C10AA05
atorvastatin
ATORVASTATIN
PHARMAS
film tableta
blister, 30 po 20 mg
PharmaS d.o.o.
Republika Srbija
778,00
20 mg
25,93
85%
1104607
C10AA05
atorvastatin
ATORVASTATIN
PHARMAS
film tableta
blister, 30 po 40 mg
PharmaS d.o.o.
Republika Srbija
1.156,80
20 mg
19,28
85%
$NXWQLLQIDUNWPLRNDUGD,NDRKURQLþQDWHUDSLMDQDNRQSUHOHåDQRJDNXWQRJLQIDUNWDPLRNDUGDNDRSUHYHQFLMDSRQRYQRJLQIDUNWDPLRNDUGD
INDIKACIJE
2. Infarkt mozga ( I63 ) - samo za pacijente koji su imali infarkt mozga kao prevencija ponovnog infarkta mozga.
Lek se uvodi u terapiju na osnovu mišljenja kardiologa ili interniste ili neurologa/neuropsihijatra.
NAPOMENA
C10AA07 rosuvastatin
1104727
1104725
1104728
C10AA07
C10AA07
C10AA07
rosuvastatin
rosuvastatin
rosuvastatin
ROXERA
ROXERA
ROXERA
film tableta
film tableta
film tableta
blister, 28 po 5 mg
Slaviamed d.o.o. u
saradnji sa Krka
Tovarna Zdravil d.d,
Slovenija
Republika Srbija
396,20
10 mg
28,30
85%
blister, 28 po 10 mg
Slaviamed d.o.o. u
saradnji sa Krka
Tovarna Zdravil d.d,
Slovenija
Republika Srbija
738,60
10 mg
26,38
85%
blister, 28 po 20 mg
Slaviamed d.o.o. u
saradnji sa Krka
Tovarna Zdravil d.d,
Slovenija
Republika Srbija
1.332,60
10 mg
23,80
85%
Republika Srbija
1.910,40
10 mg
17,06
85%
1104726
C10AA07
rosuvastatin
ROXERA
film tableta
blister, 28 po 40 mg
Slaviamed d.o.o. u
saradnji sa Krka
Tovarna Zdravil d.d,
Slovenija
1104771
C10AA07
rosuvastatin
ROSUHOL
film tableta
blister, 30 po 10 mg
PharmaSwiss d.o.o.
Republika Srbija
791,40
10 mg
26,38
85%
1104772
C10AA07
rosuvastatin
ROSUHOL
film tableta
blister, 30 po 20 mg
PharmaSwiss d.o.o.
Republika Srbija
1.304,00
10 mg
21,73
85%
Lista A1 - Grupa C. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1104720
C10AA07
rosuvastatin
ROVESTA
film tableta
blister, 28 po 10 mg
Pharmanova d.o.o.
Republika Srbija
738,60
10 mg
26,38
85%
1104721
C10AA07
rosuvastatin
ROVESTA
film tableta
blister, 28 po 20 mg
Pharmanova d.o.o.
Republika Srbija
1.332,60
10 mg
23,80
85%
1104722
C10AA07
rosuvastatin
ROVESTA
film tableta
blister, 28 po 40 mg
Pharmanova d.o.o.
Republika Srbija
1.910,40
10 mg
17,06
85%
$NXWQLLQIDUNWPLRNDUGD,NDRKURQLþQDWHUDSLMDQDNRQSUHOHåDQRJDNXWQRJLQIDUNWDPLRNDUGDNDRSUHYHQFLMDSRQRYQRJLQIDUNWDPLRNDUGD
INDIKACIJE
2. Infarkt mozga ( I63 ) - samo za pacijente koji su imali infarkt mozga kao prevencija ponovnog infarkta mozga.
Lek se uvodi u terapiju na osnovu mišljenja kardiologa ili interniste ili neurologa/neuropsihijatra.
NAPOMENA
C10AB
Fibrati
C10AB05 fenofibrat
1104232
C10AB05
NAPOMENA
fenofibrat
FENOLIP
kapsula, tvrda
blister, 30 po 160 mg
PharmaSwiss d.o.o.
Republika Srbija
537,20
/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDLQWHUQLVWHDNRQDNRQWURPHVHþQHGLMHWHWULJOLFHULGLXNUYLQLVXPDQMLRGPPROO
0,2 g
22,38
50%
Lista A1 - Grupa D. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
4155571
4155570
ATC
D
D05
D05A
D05AX
D05AX05
D05AX05
D05AX05
INDIKACIJE
INN
Cena leka
Država
na veliko
=DãWLüHQRLPH
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
za
leka
FO
leka
SURL]YRÿDþDOHND
leka
pakovanje
DDD
.2ä$,327.2ä127.,92/(.29,=$/(ý(1-(%2/(67,.2ä(,327.2ä12*7.,9$'(50$7,&,
/(.29,=$/(ý(1-(3625,-$=($17,3625,-$7,&,
Antipsorijatici za lokalnu primenu
Ostali antipsorijatici za lokalnu primenu
Cena leka Participacija
na veliko osiguranog
po DDD
lica
tazaroten
tazaroten
tazaroten
ZORAC
ZORAC
gel
gel
tuba, 15 g 0,05%
Pierre Fabre
Medicament
Production
Francuska
601,60
-
-
50%
tuba, 15 g 0,1%
Pierre Fabre
Medicament
Production
Francuska
713,10
-
-
50%
1. Psoriasis vulgaris ( L40.0)
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja dermatologa.
D05B
Antipsorijatici za sistemsku primenu
D05BB
Retinoidi za terapiju psorijaze
D05BB02 acitretin
1155512
D05BB02
acitretin
NEOTIGASON
kapsula, tvrda
blister, 30 po 25 mg
Cenexi SAS
Francuska
3.449,60
35 mg
160,98
50%
1155511
D05BB02
acitretin
NEOTIGASON
kapsula, tvrda
blister, 100 po 10 mg
Cenexi SAS
Francuska
5.452,50
35 mg
190,84
50%
-
-
50%
INDIKACIJE
3VRULMD]D///////1LMHLQGLNRYDQ]DOHþHQMHSVRULDVLVJXWWDWD
NAPOMENA
D06
D06A
D06AX
D06AX07
/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDGHUPDWRORJDLNDRQDVWDYDNEROQLþNRJOHþHQMD
ANTIBIOTICI I HEMIOTERAPEUTICI ZA DERMATOLOŠKU PRIMENU
Antibiotici za lokalnu primenu
Ostali antibiotici za lokalnu primenu
gentamicin
4150400
D06AX07
gentamicin
GENTAMICIN
mast
tuba,1 po 15 g 0,1% (1
mg/1 g)
Galenika a.d.
Republika Srbija
122,50
Lista A1 - Grupa D. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
=DãWLüHQRLPH
leka
ATC
INN
D06B
D06BB
D06BB03 aciklovir
FO
4139180
D06BB03
aciklovir
ACIKLOVIR
mast
4139160
D06BB03
aciklovir
ACIKLOVIR
krem
D07
D07A
D07AB
D07AB10 alklometazon
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
Hemioterapeutici za lokalnu primenu
Antivirusni lekovi
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
tuba, 1 po 5 g (50 mg/g)
5%
Jugoremedija a.d.
Republika Srbija
266,50
-
-
50%
tuba, 1 po 5 g 5 %
Zdravlje a.d.
Republika Srbija
266,50
-
-
50%
KORTIKOSTEROIDI, DERMATOLOŠKI PREPARATI
Kortikosteroidi, monokomponentni
Kortikosteroidi srednje jakog delovanja (grupa II)
4152104
D07AB10
alklometazon
AFLODERM
krem
tuba, 20 g (0,5 mg/1 g)
Belupo Lijekovi i
kozmetika d.d.
Hrvatska
268,30
-
-
75%
4152100
D07AB10
alklometazon
AFLODERM
mast
tuba, 20 g (0,5 mg/1 g)
Belupo Lijekovi i
kozmetika d.d.
Hrvatska
268,30
-
-
75%
D07AC
D07AC03 dezoksimetazon
Kortikosteroidi jakog delovanja (grupa III)
4152255
D07AC03
dezoksimetazon
ESPERSON MITE
krem
1 po 30 g 0,05%
Jugoremedija a.d.
Republika Srbija
114,90
-
-
50%
4152254
D07AC03
dezoksimetazon
ESPERSON
krem
1 po 30 g 0,25% (M)
Jugoremedija a.d.
Republika Srbija
373,10
-
-
50%
4152253
D07AC03
dezoksimetazon
ESPERSON M
mast
1 po 30 g 0,25% (M)
Jugoremedija a.d.
Republika Srbija
373,10
-
-
50%
D07AC13 mometazon
4153440
D07AC13
mometazon
ELOCOM
krem
tuba, 1 po 15 g (0,1%)
Schering Plough
Labo N.V.
Belgija
282,50
80%
4153441
D07AC13
mometazon
ELOCOM
mast
tuba, 1 po 15 g (0,1%)
Schering Plough
Labo N.V.
Belgija
282,50
80%
277,20
-
-
50%
D09
D09A
D09AA
D09AA02 fusidinska kiselina
9150024
D09AA02
fusidinska kiselina
STANICID
LEKOVITI ZAVOJI
Lekoviti zavoji
Zavoji sa masnom podlogom i antiinfektivima
impregnirana
kompresa
aluminijumska folija, 10
po 30 mg
Hemofarm a.d.
Republika Srbija
Lista A1 - Grupa D. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1155442
ATC
INN
D10
D10B
D10BA
D10BA01 izotretinoin
D10BA01
izotretinoin
=DãWLüHQRLPH
leka
ROACCUTANE
FO
kapsula, meka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Švajcarska
1.049,20
30 mg
3DNRYDQMHLMDþLQD
Naziv
leka
SURL]YRÿDþDOHND
PREPARATI PROTIV AKNI
Preparati protiv akni za sistemsku primenu
5HWLQRLGL]DOHþHQMHDNQL
blister, 30 po 10 mg
INDIKACIJE
1. Akne conglobata ( L70.1).
NAPOMENA
Samo za decu. Lek se uvodi u terapiju na osnovu mišljenja dermatologa.
F. Hoffmann-La
Roche Ltd.
Cena leka Participacija
na veliko osiguranog
po DDD
lica
104,92
25%
Lista A1 - Grupa G. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
6137312
Cena leka
Država
na veliko
Cena leka Participacija
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
za
na veliko osiguranog
ATC
INN
=DãWLüHQRLPHOHND
FO
leka
leka
leka
pakovanje
DDD
po DDD
lica
*(1,7285,1$51,6,67(0,32/1,+25021,/(.29,=$/(ý(1-(*(1,7285,1$512*6,67(0$,32/1,+25021,
G
GINEKOLOŠKI ANTIINFEKTIVI I ANTISEPTICI
G01
$QWLLQIHNWLYLLDQWLVHSWLFLLVNOMXþXMXüLNRPELQDFLMDVDNRUWLNRVWHURLGLPD
G01A
Antibiotici
G01AA
G01AA51 nistatin, neomicin, polimiksin b
G01AA51
nistatin, neomicin,
polimiksin b
POLYGYNAX
vaginalna kapsula,
meka
INDIKACIJE
1. Vaginalna infekcija (N76).
NAPOMENA
G01AF
G01AF05
Lek se uvodi u terapiju na osnovu mišljenja ginekologa.
6137320
G01AF05
INDIKACIJE
NAPOMENA
G01AF12
6137510
G01AF12
INDIKACIJE
blister, 12 po (100000 i.j.
+ 35000 i.j. + 35000 i.j.)
Innothera Chouzy
Francuska
585,60
-
-
70%
Derivati imidazola
ekonazol
ekonazol
ECALIN
vagitorija
3 po 150 mg
Jugoremedija a.d.
Republika Srbija
224,40
0,1 g
49,87
85%
1 po 600 mg
Catalent Italy S.P.A.
Italija
294,20
0,1 g
49,03
85%
1. Vaginalna infekcija (N76).
Lek se uvodi u terapiju na osnovu mišljenja ginekologa.
fentikonazol
fentikonazol
LOMEXIN
vaginalna kapsula
1. Vaginalna infekcija (N76).
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja ginekologa.
G02
G02C
G02CB
G02CB04 kvinagolid
OSTALI GINEKOLOŠKI LEKOVI
Ostali ginekološki lekovi
Inhibitori prolaktina
1149080
G02CB04
kvinagolid
NORPROLAC
tableta
blister, 3 po 25 mcg i 3
po 50 mcg
Ferring GmbH
1HPDþND
425,90
75 mcg
141,97
75%
1149081
G02CB04
kvinagolid
NORPROLAC
tableta
blister, 30 po 75 mcg
Ferring GmbH
1HPDþND
2.464,00
75 mcg
82,13
75%
INDIKACIJE
1. Hiperprolaktinemija (E22.1)
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja endokrinologa zdravstvene ustanove sekundarnog ili tercijarnog nivoa zdravstvene zaštite.
Lista A1 - Grupa G. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPHOHND
G03
G03A
G03AA
G03AA09 dezogestrel, etinilestradiol
1135231
G03AA09
dezogestrel,
etinilestradiol
MERCILON
1135232
G03AA09
dezogestrel,
etinilestradiol
NOVYNETTE
INDIKACIJE
FO
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
POLNI HORMONI I MODULATORI GENITALNOG SISTEMA
Hormonski kontraceptivi za sistemsku primenu
Progestogeni i estrogeni, fiksne kombinacije
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
tableta
blister, 1 po 21 (0,15 mg
+ 0,02 mg)
Organon Ireland Ltd.
Irska
353,00
0,75 tabl.
12,61
75%
film tableta
blister, 1 po 21 (0,15 mg
+ 0,02 mg)
Gedeon Richter PLC
0DÿDUVND
353,00
0,75 tabl.
12,61
75%
blister, 1 po 21 (75 mcg +
20 mcg)
Gedeon Richter PLC
0DÿDUVND
364,80
0,75 tabl.
13,03
75%
1HPDþND
720,40
0,75 tabl.
25,73
85%
1HPDþND
864,60
1 tableta
30,88
85%
0DÿDUVND
720,40
0,75 tabl.
25,73
85%
Holandija
1.478,20
2,5 mg
52,79
75%
1. Hormonska kontracepcija (Z30).
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja ginekologa ili endokrinologa.
G03AA10 gestoden, etinilestradiol
1135300
G03AA10
gestoden,
etinilestradiol
LINDYNETTE 20
obložena tableta
INDIKACIJE
1. Hormonska kontracepcija (Z30).
Lek se uvodi u terapiju na osnovu mišljenja ginekologa ili endokrinologa.
NAPOMENA
G03AA12 drospirenon, etinilestradiol
1135276
G03AA12
drospirenon,
etinilestradiol
YASMIN
film tableta
1135277
G03AA12
drospirenon,
etinilestradiol
YAZ
film tableta
1135280
G03AA12
drospirenon,
etinilestradiol
MIDIANA
film tableta
blister, 21 po (3 mg +
0,03 mg)
Bayer Schering
Pharma AG
blister, 28 po (3 mg +
Schering GmbH & Co.
0,02 mg) (24 + 4 placebo)
Produktions KG
blister, 21 po (3 mg +
0,03 mg)
Gedeon Richter PLC
INDIKACIJE
1. Hormonska kontracepcija (Z30).
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja ginekologa ili endokrinologa.
G03C
G03CX
Ostali estrogeni
G03CX01 tibolon
1049210
G03CX01
INDIKACIJE
NAPOMENA
tibolon
LIVIAL
tableta
28 po 2,5 mg
1. Menopauza (N95).
Lek se uvodi u terapiju na osnovu mišljenja ginekologa ili endokrinologa.
N.V. Organon
Lista A1 - Grupa G. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1048463
1048462
ATC
INN
G03D
G03DA
G03DA04 progesteron
G03DA04
G03DA04
INDIKACIJE
progesteron
progesteron
=DãWLüHQRLPHOHND
UTROGESTAN
UTROGESTAN
FO
kapsula, meka
kapsula, meka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
blister, 30 po 100 mg
Laboratoires Besins
International; Besins
Manufacturing
Belgium
Francuska;
Belgija
532,70
300 mg
53,27
45%
blister, 14 po 200 mg
Laboratoires Besins
International; Besins
Manufacturing
Belgium
Francuska;
Belgija
532,70
300 mg
57,08
45%
Holandija
455,00
10 mg
22,75
70%
1.223,30
1 tableta
43,69
85%
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Progestogeni
Derivati pregnena
Cena leka Participacija
na veliko osiguranog
po DDD
lica
1. Primarni ili sekundarni sterilitet, usled parcijalne ili totalne progesteronske insuficijencije (N97);
2. Potpora lutealne faze u toku IVF kao i u programu donacije oocita (N98);
3UHWHüLSREDþDM2
3UHYUHPHQLSRURÿDM2
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja urologa ili ginekologa ili endokrinologa.
G03DB
Derivati pregnadiena
G03DB01 didrogesteron
1048293
G03DB01
INDIKACIJE
NAPOMENA
G03F
G03FA
G03FA17
1048790
G03FA17
INDIKACIJE
NAPOMENA
didrogesteron
DUPHASTON
film tableta
blister, 20 po 10 mg
Abbott Biologicals B.V.
1. Menopauza (N95).
Lek se uvodi u terapiju na osnovu mišljenja ginekologa ili endokrinologa.
Progestogeni i estrogeni u kombinaciji
Progestogeni i estrogeni, fiksne kombinacije
drospirenon, estradiol
drospirenon,
estradiol
ANGELIQ
film tableta
28 po (2 mg +1 mg)
1. Menopauza ( N95 ).
Lek se uvodi u terapiju na osnovu mišljenja ginekologa ili endokrinologa.
Bayer Schering
Pharma AG
1HPDþND
Lista A1 - Grupa G. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1048781
norgestrel, estradiol
G03FB01
norgestrel, estradiol CYCLO-PROGYNOVA
INDIKACIJE
INN
=DãWLüHQRLPHOHND
ATC
G03FB
G03FB01
FO
obložena tableta
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
Progestogeni i estrogeni, sekvencijalni preparati
1 po 21 (11 belih + 10
VPHÿLK
Schering GmbH & Co.
Produktions KG
1HPDþND
Cena leka
na veliko
za
pakovanje
DDD
248,80
0,75 tabl.
8,89
25%
0,1 g
0,1 g
87,42
87,42
25%
Cena leka Participacija
na veliko osiguranog
po DDD
lica
1. Menopauza (N95).
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja ginekologa ili endokrinologa.
G03H
Antiandrogeni
G03HA
Antiandrogeni, monokomponentni
G03HA01 ciproteron
1048331
1048333
G03HA01
G03HA01
INDIKACIJE
ciproteron
ANDROCUR
tableta
50 po 50 mg
Delpharm Lille Sas;
Schering AG
Francuska;
1HPDþND
2.185,40
ciproteron
CYPROCUR
tableta
blister, 90 po 50 mg
PharmaSwiss d.o.o.
Republika Srbija
3.933,70
25%
1. Maligni tumor prostate (C61).
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja tri lekara - urologa zdravstvene ustanove koja obavlja zdravstvenu delatnost na tercijarnom nivou.
G03H
Antiandrogeni
G03HB
Antiandrogeni i estrogeni
G03HB01 ciproteron, etinilestradiol
1048176
G03HB01
INDIKACIJE
ciproteron,
etinilestradiol
DIANE–35
obložena tableta
blister,1 po 21 (2 mg +
0,035 mg)
Bayer Schering
Pharma AG
1HPDþND
395,70
0,75 tabl.
14,13
15%
Delpharm Lille Sas
Francuska
606,10
0,75 tabl.
21,65
70%
1. Idiopatski hirzutizam (L68). Kod žena generativne dobi uz dismenoreju;
2. Ozbiljne akne koje ne reaguju na antimikrobnu terapiju (L70).
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja ginekologa ili endokrinologa.
G03HB01 ciproteron, estradiol
1048720
G03HB01
INDIKACIJE
NAPOMENA
ciproteron, estradiol CLIMEN
obložena tableta
blister, 1 po 21 (1 mg + 2
mg)
1. Menopauza (N95).
Lek se uvodi u terapiju na osnovu mišljenja ginekologa ili endokrinologa.
Lista A1 - Grupa G. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1139173
ATC
INN
G04
G04B
G04BD
G04BD07 tolterodin
G04BD07
INDIKACIJE
tolterodin
=DãWLüHQRLPHOHND
DETRUSITOL
FO
film tableta
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Italija
988,00
4 mg
70,57
70%
Holandija
973,00
5 mg
97,30
80%
Holandija
2.919,10
5 mg
97,30
80%
Holandija
2.984,90
5 mg
49,75
80%
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
UROLOŠKI LEKOVI
2VWDOLXURORãNLOHNRYLXNOMXþXMXüLVSD]PROLWLNH
Urinarni spazmolitici
blister, 28 po 2 mg
Pfizer Italia S.R.L.
Cena leka Participacija
na veliko osiguranog
po DDD
lica
1. Iritabilna bešika (N39.4);
2. Urinarna inkontinencija (N39.3).
Lek se uvodi u terapiju na osnovu mišljenja urologa ili ginekologa ili neurologa.
NAPOMENA
G04BD08 solifenacin
1139022
G04BD08
solifenacin
VESICARE
film tableta
blister, 10 po 5 mg
1139020
G04BD08
solifenacin
VESICARE
film tableta
blister, 30 po 5 mg
1139021
G04BD08
solifenacin
VESICARE
film tableta
blister, 30 po 10 mg
INDIKACIJE
Astellas Pharma
Europe B.V.
Astellas Pharma
Europe B.V.
Astellas Pharma
Europe B.V.
1. Iritabilna bešika (N39.4);
2. Urinarna inkontinencija (N39.3).
Lek se uvodi u terapiju na osnovu mišljenja urologa ili ginekologa ili neurologa.
NAPOMENA
G04C
Lekovi u terapiji benigne hipertrofije prostate
Antagonisti alfa adrenoreceptora
G04CA
G04CA02 tamsulosin
1134230
1134240
G04CA02
G04CA02
tamsulosin
tamsulosin
TAMSOL
kapsula sa
produženim
RVOREDÿDQMHPWYUGD
blister, 30 po 0,4 mg
PharmaSwiss d.o.o.
Republika Srbija
418,40
0,4 mg
13,95
25%
BETAMSAL
kapsula sa
modifikovanim
RVOREDÿDQMHPWYUGD
blister, 30 po 0,4 mg
Hemofarm a.d.
Republika Srbija
418,40
0,4 mg
13,95
25%
Lista A1 - Grupa G. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1134260
ATC
G04CA02
INDIKACIJE
INN
tamsulosin
=DãWLüHQRLPHOHND
TAMSULOSIN
PHARMAS
FO
kapsula sa
modifikovanim
RVOREDÿDQMHPWYUGD
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Republika Srbija
418,40
0,4 mg
13,95
25%
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
blister, 30 po 0,4 mg
PharmaS d.o.o.
Cena leka Participacija
na veliko osiguranog
po DDD
lica
1. Benigna hiperplazija prostate (N40).
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja urologa.
G04CB
G04CB01 finasterid
1134205
G04CB01
finasterid
PROSCAR
1134220
G04CB01
finasterid
G04CB01
Inhibitori testosteron-5-alfa reduktaze
tableta
28 po 5 mg
Merck Sharp & Dohme
Holandija
650,30
5 mg
23,23
60%
ZERLON
film tableta
blister, 30 po 5 mg
Hemofarm a.d.
Republika Srbija
580,50
5 mg
19,35
50%
finasterid
BENEPROST
film tableta
blister, 30 po 5 mg
,YDQþLüLVLQRYLGRR
Republika Srbija
580,50
5 mg
19,35
50%
finasterid
FINASTERID
PHARMAS
film tableta
blister, 28 po 5 mg
PharmaS d.o.o.
Republika Srbija
541,90
5 mg
19,35
50%
blister, 30 po 0,5 mg
GlaxoSmithKline S.A.
Poljska
1.758,50
0,5 mg
58,62
80%
1134225*
1134228
1134212
G04CB01
INDIKACIJE
1. Benigna hiperplazija prostate (N40).
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja urologa.
G04CB02 dutasterid
1134305
G04CB02
dutasterid
AVODART
kapsula, meka
INDIKACIJE
1. Benigna hiperplazija prostate (N40).
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja urologa.
* Lek je obrisan sa Liste lekova 30. juna 2013. godine.
Lista A1 - Grupa H. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
H
H03
H03B
H03BB
INN
=DãWLüHQRLPH
leka
Cena leka
Država
na veliko
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
za
FO
leka
SURL]YRÿDþDOHND
leka
pakovanje
+25021,=$6,67(06.835,0(18,6./-8ý8-8û,32/1(+25021(,,168/,1(
TERAPIJA BOLESTI TIREOIDEE
Antitireoidni preparati
Derivati imidazola sa sumporom
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
H03BB02 tiamazol
1040251
H03BB02
tiamazol
THYROZOL
film tableta
H05
H05A
H05AA
H05AA02 teriparatid
0040240
H05AA02
teriparatid
blister, 20 po 20 mg
Merck KGaA
1HPDþND
216,90
10 mg
5,42
25%
Francuska
35.954,70
20 mcg
1.284,10
35%
Homeostaza kalcijuma
Paratireoidni hormoni i analozi
Paratireoidni hormoni i analozi
FORTEO
rastvor za injekciju,
pen sa uloškom
28 doza po 20 mcg/80
mcl
Lilly France S.A.S.
1. Za sekundarnu prevenciju osteoporotiþnih preloma kod pacijenata u postmenopauzi koji su imali bar jedan prelom uzrokovan traumom malog intenziteta uz verifikovanu
INDIKACIJE
osteoporozu (osteodenzitometrijski nalaz DEXA T vrednost ” - 2,5 SD na kuku ili lumbalnoj kiþmi),
2. Za sekundarnu prevenciju osteoporotiþnih preloma kod pacijenata u postmenopauzi sa verifikovanim prelomom kod kojih je nakon upotrebe bisfosfonata tokom najmanje
godinu dana leþenja došlo do novog preloma i pada vrednosti DEXA T u odnosu na vredost pre poþetka leþenja.
NAPOMENA
=DLQGLNDFLMXSRGWDþNRPLOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDLWRUHXPDWRORJDHQGRNULQRORJDLRUWRSHGD]GUDYVWYHQHXVWDQRYHNRMD
obavlja zdravstvenu delatnost na tercijarnom nivou.
Lista A1 - Grupa J. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPH
leka
J
J01
J01C
J01CR
J01CR02
amoksicilin, klavulanska kiselina
J01CR02
amoksicilin,
klavulanska kiselina
1021601
J01CR02
amoksicilin,
klavulanska kiselina
1021607
J01CR02
1021566
Cena leka
Država
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
za
FO
leka
leka
leka
pakovanje
ANTIINFEKTIVNI LEKOVI ZA SISTEMSKU PRIMENU
ANTIBAKTERIJSKI LEKOVI ZA SISTEMSKU PRIMENU
Beta-laktam antibakterijski lekovi, penicilini
.RPELQDFLMHSHQLFLOLQDXNOMXþXMXüLLNRPELQDFLMHVDLQKLELWRULPDEHWDODNWDPD]H
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
film tableta
ERþLFDVWDNOHQDSR
375 mg (250 mg + 125
mg)
Hemofarm a.d.
Republika Srbija
435,70
1g
116,19
50%
PANKLAV
film tableta
ERþLFDVWDNOHQDSR
625 mg (500 mg + 125
mg)
Hemofarm a.d.
Republika Srbija
808,70
1g
80,87
50%
amoksicilin,
klavulanska kiselina
PANKLAV 2X
film tableta
teglica, 14 po 1000 mg
(875 mg + 125 mg)
Hemofarm a.d.
Republika Srbija
647,60
1g
52,87
50%
J01CR02
amoksicilin,
klavulanska kiselina
AMOKSIKLAV 2X
film tableta
blister, 10 po
(500 mg + 125 mg)
Lek farmacevtska
družba d.d.
Slovenija
404,40
1g
80,88
50%
1021567
J01CR02
amoksicilin,
klavulanska kiselina
AMOKSIKLAV 2X
film tableta
blister, 10 po
(875 mg + 125 mg)
Lek farmacevtska
družba d.d.
Slovenija
462,60
1g
52,87
50%
1021560
J01CR02
amoksicilin,
klavulanska kiselina
AMOKSIKLAV
film tableta
ERþLFDVWDNOHQDSR
(500 mg + 125 mg)
Lek farmacevtska
družba d.d.
Slovenija
606,50
1g
80,87
50%
1021632
J01CR02
amoksicilin,
klavulanska kiselina
AUGMENTIN
film tableta
14 po (875 mg + 125
mg)
SmithKline Beecham
Pharmaceuticals
Velika Britanija
647,60
1g
52,87
50%
1021600
INDIKACIJE
PANKLAV
1. Infekcije gornjeg i donjeg respiratornog trakta (J00- J06.8; J20; J32; J40; J41; J42),
2. Infekcije urogenitalnog trakta ( N30, N34; N36; N37; N39 ),
3. Infekcije srednjeg uha ( H65; H66 ).
Lista A1 - Grupa J. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
cefuroksim
1321976
J01DC02
cefuroksim
CEROXIM
tableta
blister, 10 po 250 mg
Medico Uno d.o.o.
Republika Srbija
403,00
0,5 g
80,60
50%
1321977
J01DC02
cefuroksim
CEROXIM
tableta
blister, 10 po 500 mg
Medico Uno d.o.o.
Republika Srbija
515,00
0,5 g
51,50
50%
Corden Pharma Latina
S.P.A.
Italija
1.301,00
1g
260,20
85%
Alkaloid a.d.
Republika
Makedonija
1.198,70
0,4 g
119,87
65%
599,30
0,4 g
119,86
65%
1321950
J01DC10
INDIKACIJE
J01DD
J01DD08
1321620
J01DD08
FO
Cena leka
na veliko
za
pakovanje
ATC
J01D
J01DC
J01DC02
INDIKACIJE
J01DC10
INN
=DãWLüHQRLPH
leka
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
Ostali beta-laktam antibakterijski lekovi
Cefalosporini, II generacija
1. Infekcije donjeg respiratornog trakta (J13; J14; J15; J20; J32; J40; J41; J42),
2. Infekcije kože i i mekog tkiva ( L00-L08 ),
,QIHNFLMHPRNUDüQHEHãLNHLPRNUDüQLKSXWHYD11
4. Lajmska bolest (A69.2).
cefprozil
cefprozil monohidrat
CEFZIL
tableta
10 po 500 mg
1. Infekcije donjeg respiratornog trakta (J13; J14; J15; J20; J32; J40; J41; J42),
2. Infekcije kože i i mekog tkiva ( L00-L08 ),
,QIHNFLMHPRNUDüQHEHãLNHLPRNUDüQLKSXWHYD11
Cefalosporini, III generacija
cefiksim
cefiksim
PANCEF
film tableta
blister, 10 po 400 mg
1321622
J01DD08
cefiksim
PANCEF
film tableta
blister, 5 po 400 mg
Alkaloid a.d.
Republika
Makedonija
1321627
J01DD08
cefiksim
CEFEXIN
film tableta
blister, 10 po 400 mg
Pliva Hrvatska d.o.o.
Hrvatska
1.198,70
0,4 g
119,87
65%
Republika
Makedonija
296,20
0,4 g
118,48
65%
1. Infekcije donjeg respiratornog trakta (J13; J14; J15; J20; J32; J40; J41; J42);
2. Zapaljenje srednjeg uha (H66);
INDIKACIJE
3. Urinarne infekcije (N00; N10; N30; N34).
J01DD13 cefpodoksim
1321521
J01DD13
cefpodoksim
TRIDOX
film tableta
blister, 10 po 100 mg
Alkaloid a.d.
Lista A1 - Grupa J. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
ATC
1321522
J01DD13
cefpodoksim
TRIDOX
film tableta
blister, 20 po 100 mg
Alkaloid a.d.
Republika
Makedonija
592,50
0,4 g
118,50
65%
1321523
J01DD13
cefpodoksim
TRIDOX
film tableta
blister, 10 po 200 mg
Alkaloid a.d.
Republika
Makedonija
592,50
0,4 g
118,50
65%
1321524
J01DD13
cefpodoksim
TRIDOX
film tableta
blister, 20 po 200 mg
Alkaloid a.d.
Republika
Makedonija
1.185,00
0,4 g
118,50
65%
1325300
J01FA06
INDIKACIJE
J01FA09
2325625
J01FA09
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Cena leka
na veliko
za
pakovanje
JKL
INDIKACIJE
J01F
J01FA
J01FA06
INN
=DãWLüHQRLPH
leka
Država
proizvodnje
leka
1. Infekcije donjeg respiratornog trakta (J13; J14; J15; J20; J32; J40; J41; J42);
2. Zapaljenje srednjeg uha (H66);
3. Urinarne infekcije (N00; N10; N30; N34).
Makrolidi, linkozamidi i streptogramini
Makrolidi
roksitromicin
roksitromicin
ROXIMISAN
film tableta
blister, 10 po 150 mg
Slaviamed d.o.o.
Republika Srbija
386,90
0,3 g
77,38
50%
granule za oralnu
suspenziju
boca, 1 po 60 ml (125
mg/5 ml)
Abbott S.R.L.
Italija
294,40
0,5 g
98,13
20%
,QIHNFLMHPRNUDüQLKSXWHYD1
klaritromicin
klaritromicin
KLACID
INDIKACIJE
1. Infekcije respiratornog trakta (J00-J06; J15.7; J16.0; J20-J32; J40; J41-J42),
2. Infekcije srednjeg uha (H65; H66),
3. Infekcije kože i mekog tkiva (L00-L08).
NAPOMENA
J01FA09
Sirup samo za decu.
6LUXS]DRVREHVDSRUHPHüHQLPDNWRPJXWDQMD
klaritromicin
1325056
J01FA09
klaritromicin
ZYMBAKTAR
film tableta
14 po 250 mg
Hemofarm a.d.
Republika Srbija
205,10
0,5 g
29,30
50%
1325055
J01FA09
klaritromicin
ZYMBAKTAR
film tableta
14 po 500 mg
Hemofarm a.d.
Republika Srbija
654,50
0,5 g
46,75
50%
Lista A1 - Grupa J. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
1325611
J01FA09
1325651
J01FA09
INN
klaritromicin
klaritromicin
=DãWLüHQRLPH
leka
FROMILID
FO
film tableta
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
blister, 14 po 500 mg
Slaviamed d.o.o.
Republika Srbija
654,50
0,5 g
46,75
50%
blister, 7 po 500 mg
Slaviamed d.o.o. u
saradnji sa Krka
Tovarna Zdravil d.d,
Slovenija
Republika Srbija
363,60
0,5 g
51,94
50%
Republika Srbija
727,10
0,5 g
51,94
50%
FROMILID UNO
tableta sa
produženim
RVOREDÿDQMHP
tableta sa
produženim
RVOREDÿDQMHP
blister, 14 po 500 mg
Slaviamed d.o.o. u
saradnji sa Krka
Tovarna Zdravil d.d,
Slovenija
film tableta
blister, 14 po 500 mg
Abbott S.R.L.
Italija
785,40
0,5 g
56,10
60%
film tableta sa
modifikovanim
RVOREDÿDQMHP
blister, 7 po 500 mg
Abbott S.R.L.
Italija
436,30
0,5 g
62,33
60%
1325653
J01FA09
klaritromicin
FROMILID UNO
1325525
J01FA09
klaritromicin
KLACID
1325527
J01FA09
klaritromicin
KLACID MR
1325600
J01FA09
klaritromicin
KLARITROMICIN
film tableta
blister, 14 po 250 mg
PharmaS d.o.o.
Republika Srbija
205,10
0,5 g
29,30
50%
1325601
J01FA09
klaritromicin
KLARITROMICIN
film tableta
blister, 14 po 500 mg
PharmaS d.o.o.
Republika Srbija
654,50
0,5 g
46,75
50%
INDIKACIJE
J01FA10
1. Infekcije respiratornog trakta ( J00-J06; J15.7; J16.0; J20-J32; J41-J42 ),
2. Infekcije srednjeg uha ( H65; H66 ),
3. Infekcije kože i i mekog tkiva ( L00-L08 ),
,QIHNFLMHåHOXFDLGYDQDHVWRSDODþQRJFUHYDVD+HOLFREDFWHUS\ORUL.
5. Infekcije izazvane Mycobacterium ( A31 ).
azitromicin
1325480
J01FA10
azitromicin
HEMOMYCIN
kapsula, tvrda
blister, 6 po 250 mg
Hemofarm a.d.
Republika Srbija
475,30
0,3 g
95,06
80%
1325482
J01FA10
azitromicin
HEMOMYCIN
film tableta
blister, 3 po 500 mg
Hemofarm a.d.
Republika Srbija
348,50
0,3 g
69,70
80%
Lista A1 - Grupa J. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
1325470
J01FA10
1325472
3325100
1325541
J01FA10
J01FA10
J01FA10
INDIKACIJE
J01FF
J01FF01
azitromicin
SUMAMED KAPSULE
kapsula, tvrda
blister, 6 po 250 mg
Pliva Hrvatska d.o.o.
Hrvatska
475,30
0,3 g
95,06
80%
azitromicin
SUMAMED
TABLETE 500
film tableta
blister, 3 po 500 mg
Pliva Hrvatska d.o.o.
Hrvatska
348,50
0,3 g
69,70
80%
Portoriko
633,80
0,3 g
95,07
80%
Republika Srbija
348,50
0,3 g
69,70
80%
1HPDþND
241,50
1,2 g
80,50
25%
1HPDþND
453,70
1,2 g
75,62
25%
1HPDþND
1.131,90
1,2 g
75,46
25%
azitromicin
azitromicin
ZMAX
AZIBIOT
granule sa
produženim
RVOREDÿDQMHP]D
oralnu suspenziju
film tableta
ERþLFDSRPO Pfizer Pharmaceuticals
g/60 ml )
LLC
blister, 3 po 500 mg
klindamicin
CLINDAMYCIN-MIP
film tableta
blister, 12 po 300 mg
1326228
J01FF01
klindamicin
CLINDAMYCIN-MIP
film tableta
blister, 12 po 600 mg
1326222
J01FF01
klindamicin
CLINDAMYCIN-MIP
film tableta
blister, 30 po 600 mg
1329371
J01M
J01MA
J01MA01
ofloksacin
J01MA01
ofloksacin
J01MA12
Slaviamed d.o.o. u
saradnji sa Krka
Tovarna Zdravil d.d,
Slovenija
1. Infekcije respiratornog trakta (J00-J06; J15.7; J16.0; J20-J32; J40; J41-J42),
2. Infekcije srednjeg uha (H65; H66),
3. Infekcije kože i i mekog tkiva (L00-L08),
4. Infekcije izazvane Chlamydia-ma (A55; A56),
5. Negonokokni uretritis (N34.1),
6. Cervicitis (N72).
Linkozamidi
klindamicin
J01FF01
NAPOMENA
J01MA12
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
FO
1326226
1329350
Cena leka
na veliko
za
pakovanje
=DãWLüHQRLPH
leka
INN
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Chephasaar Chem.
Pharm.
Chephasaar Chem.
Pharm.
Chephasaar Chem.
Pharm.
Hinolonski antibakterijski lekovi
Fluorohinoloni
VISIREN
tableta
10 po 200 mg
Jugoremedija a.d.
Republika Srbija
819,00
0,4 g
163,80
50%
blister, 10 po 500 mg
PharmaSwiss d.o.o.
Republika Srbija
793,00
0,5 g
79,30
25%
Lek se uvodi u terapiju na osnovu antibiograma.
levofloksacin
levofloksacin
LEVOMAX
film tableta
Lista A1 - Grupa J. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
1329380
J01MA12
1329381
J01MA12
levofloksacin,
hemihidrat
levofloksacin,
hemihidrat
1329455
J01MA12
1329456
J01MA12
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
LOFOCIN
film tableta
blister, 10 po 250 mg
Pharmanova d.o.o.
Republika Srbija
475,60
0,5 g
95,12
25%
LOFOCIN
film tableta
blister, 10 po 500 mg
Pharmanova d.o.o.
Republika Srbija
793,00
0,5 g
79,30
25%
levofloksacin
FORTECA
film tableta
blister, 10 po 250 mg
Hemofarm a.d.
Republika Srbija
475,60
0,5 g
95,12
25%
levofloksacin
FORTECA
film tableta
blister, 10 po 500 mg
Hemofarm a.d.
Republika Srbija
793,00
0,5 g
79,30
25%
,QIHNFLMDUHVSLUDWRUQRJWUDNWDL]D]YDQDX]URþQLNRP0\FRSODVPDSQHXPRQLDH-
2. Infekcije urinarnog trakta (N30; N34; N36; N37; N39);
3. Akutni bakterijski sinuzitis (J01);
$NXWQDEDNWHULMVNDHJ]DFHUEDFLMDKURQLþQRJEURQKLWLVD-
INDIKACIJE
9DQEROQLþNDSQHXPRQLMD--
J01MB
Ostali hinoloni
J01MB04 pipemidinska kiselina
1132320
J01MB04
pipemidinska kiselina
PIPEM
kapsula
1132300
J01MB04
pipemidinska kiselina
PIPEGAL
kapsula
20 po 200 mg
Hemofarm a.d.
Republika Srbija
363,50
0,8 g
72,70
25%
20 po 200 mg
Galenika a.d.
Republika Srbija
363,50
0,8 g
72,70
25%
J02
J02A
J02AC
J02AC01
flukonazol
1327356
J02AC01
flukonazol
FLUCONAL
kapsula, tvrda
blister, 1 po 150 mg
Hemofarm a.d.
Republika Srbija
251,50
0,2 g
335,33
75%
1327355
J02AC01
flukonazol
FLUCONAL
kapsula, tvrda
blister, 7 po 50 mg
Hemofarm a.d.
Republika Srbija
251,50
0,2 g
143,71
75%
1327311
J02AC01
flukonazol
DIFLUCAN
kapsula, tvrda
blister, 7 po 50 mg
Pfizer PGM
Francuska
251,50
0,2 g
143,71
75%
1327310
J02AC01
flukonazol
DIFLUCAN
kapsula, tvrda
blister, 1 po 150 mg
Pfizer PGM
Francuska
251,50
0,2 g
335,33
75%
Slaviamed d.o.o.
Republika Srbija
658,70
0,2 g
131,74
30%
NAPOMENA
J02AC02
1327402
J02AC02
ANTIMIKOTICI ZA SISTEMSKU PRIMENU
Antimikotici za sistemsku primenu
Derivati triazola
Lek se uvodi u terapiju na osnovu mišljenja infektologa ili hematologa.
itrakonazol
itrakonazol
KANAZOL
kapsula, tvrda
NRQWHMQHUSODVWLþQL
po 100 mg
Lista A1 - Grupa J. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
JKL
ATC
1327507
J02AC02
itrakonazol
OMICRAL
kapsula, tvrda
blister, 4 po 100 mg
Medico Uno d.o.o.
Republika Srbija
263,50
0,2 g
131,75
30%
1327505
J02AC02
itrakonazol
OMICRAL
kapsula, tvrda
blister, 15 po 100 mg
Medico Uno d.o.o.
Republika Srbija
988,10
0,2 g
131,75
30%
1327506
J02AC02
itrakonazol
OMICRAL
kapsula, tvrda
blister, 28 po 100 mg
Medico Uno d.o.o.
Republika Srbija
1.844,40
0,2 g
131,74
30%
INDIKACIJE
NAPOMENA
INN
=DãWLüHQRLPH
leka
Država
proizvodnje
leka
1. Tinea corporis disseminata ( B35.4 ),
2. Onychomycosis-pulsna terapija ( B35.1 ),
3. Tinea capitis rezistentna na druge oblike terapije ( B35.0 ),
4. Pityriasis versicolor ( B36.0 ).
Lek se uvodi u terapiju na osnovu mišljenja dermatologa.
Lista A1 - Grupa L. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1037200
ATC
L
L02
L02B
L02BB
L02BB01
INN
flutamid
L02BB01
flutamid
=DãWLüHQRLPHOHND
FLUTASIN
FO
tableta
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
ANTINEOPLASTICI I IMUNOMODULATORI
ENDOKRINOLOŠKA TERAPIJA
Hormonski antagonisti i srodni lekovi
Antiandrogeni
90 po 250 mg
S.C. Sindan-Pharma
S.R.L.
Rumunija
Cena leka
na veliko
za
pakovanje
DDD
2.825,20
0,75 g
Cena leka Participacija
na veliko osiguranog
po DDD
lica
94,17
INDIKACIJE
Lek se primenjuje u kompletnoj androgenoj blokadi uz medikamentoznu (LH-RH analozima) ili hiruršku kastraciju (C61).
NAPOMENA
L02BG
L02BG04
Lek se uvodi u terapiju na osnovu mišljenja tri lekara - urologa zdravstvene ustanove koja obavlja zdravstvenu delatnost na tercijarnom nivou.
Inhibitori enzima aromataze
letrozol
1039330
L02BG04
letrozol
FEMARA
film tableta
blister, 30 po 2,5 mg
Novartis Pharma Stein
AG
Švajcarska
3.018,70
2,5 mg
100,62
20%
20%
Karcinom dojke:
1. Rani steroid-receptor pozitivni karcinom dojke u postmenopauznih bolesnica, PS 0 ili 1, sekvencijalno, posle tri godine primene adjuvantne hormonske
WHUDSLMHWDPRNVLIHQRPNDRQDVWDYDNDGMXYDQWQRJOHþHQMDGRXNXSQRJRGLQD2GRYRJDVHL]X]LPDMXEROHVQLFHVD
DUDQLPVWHURLGUHFHSWRUSR]LWLYQLPNDUFLQRPRPGRMNHNRGSRVWPHQRSDX]QLKåHQDVDQLVNLPUL]LNRP]DUHODSVEROHVWLNRGNRMLKüHVHVSURYRGLWLWHUDSLMD
tamoksifenom do 5 godina;
b) ranim steroid-receptor pozitivnim karcinomom dojke u postmenopauznih bolesnica, sa visokim rizikom od relapsa bolesti, kod bolesnica koje nisu podobne
]DSULPHQXDGMXYDWQHKHPLRWHUDSLMHLELORãNHWHUDSLMH.RGRYLKEROHVQLFDüHVHSULPHQMLYDWLLQKLELWRULDURPDWD]HRGSRþHWNDDGMXYDQWQRJKRUPRQVNRJOHþHQMDX
trajanju do 5 godina;
INDIKACIJE
2. Postmenopauzne bolesnice sa steroid-receptor pozitivnim metastatskim karcinomom dojke, pri pojavi prvog relapsa bolesti na adjuvantno ili sistemski
primenjen tamoksifen;
3. Kao prva linija sistemske ili adjuvantne terapije kod bolesnica koje imaju kontraindikacije za primenu tamoksifena (glaukom, duboka venska tromboza, CVI ili
embolija u anamnezi) ili pojavu neželjenih reakcija na tamoksifen (dokazana medikamentna alergija, hiperplazija i/ili polip endometrijuma dokazani histopatološki,
ponavaljanje metroragije.
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja tri lekara zdravstvene ustanove koja obavlja zdravstvenu delatnost na tercijarnom nivou zdravstvene zaštite, a
nastavak terapije na osnovu mišljenja lekara specijaliste zdravstvene ustanove koja obavlja zdravstvenu delatnost na sekundarnom ili tercijarnom nivou
zdravstvene zaštite.
Lista A1 - Grupa L. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
INN
=DãWLüHQRLPHOHND
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
IMUNOSUPRESIVNA SREDSTVA
Imunosupresivi
Selektivni imunosupresivi
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
ATC
L04
L04A
L04AA
L04AA13
leflunomid
1014301
L04AA13
leflunomid
ARAVA
film tableta
ERþLFDSRPJ
Aventis Intercontinental
Francuska
4.407,70
20 mg
146,92
10%
1014302
L04AA13
leflunomid
ARAVA
film tableta
blister, 3 po 100 mg
Aventis Intercontinental
Francuska
2.284,30
20 mg
152,29
10%
INDIKACIJE
$NWLYQLUHXPDWRLGQLDUWULWLV0L0NRGRGUDVOLKEROHVQLNDNRGNRMLKMHSULPHQDPHWRWUHNVDWDGRYHODGRQHåHOMHQLKGRJDGMDMDJDVWULþQD
QHSRGQRãOMLYRVWKHSDWRWRNVLþQRVWKHPDWRORãNDWRNVLþQRVWDOHUJLMVNHUHDNFLMHLGUXJRLOLPHWRWUHNVDWQHSRND]XMHRGJRYDUDMXüXHILNDVQRVWXGR]DPDYHüLPLOL
jednakim 15 mg nedeljno u toku najmanje šest meseci terapije;
$NWLYDQSVRULMD]QLDUWULWLV0NRGRGUDVOLKEROHVQLNDNRGNRMLKMHSULPHQDPHWRWUHNVDWDGRYHODGRQHåHOMHQLKGRJDGMDMDJDVWULþQDQHSRGQRãOMLYRVW
KHSDWRWRNVLþQRVWKHPDWRORãNDWRNVLþQRVWDOHUJLMVNHUHDNFLMHLGUXJRLOLPHWRWUHNVDWQHSRND]XMHRGJRYDUDMXüXHILNDVQRVWXGR]DPDYHüLPLOLMHGQDNLPPJ
nedeljno u toku najmanje šest meseci terapije.
NAPOMENA
/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDOHNDUDVSHFLMDOLVWHRGJRYDUDMXüHJUDQHPHGLFLQH]GUDYVWYHQHXVWDQRYHNRMDREDYOMD]GUDYVWYHQXGHODWQRVWQD
sekundarnom ili tercijarnom nivou zdravstvene zaštite.
Lista A1 - Grupa M. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1165100
ATC
M
M03
M03B
M03BX
M03BX04
tolperison
M03BX04
tolperison
INDIKACIJE
NAPOMENA
M03BX07
1082121
M03BX07
INN
=DãWLüHQRLPH
leka
MYDOCALM
Cena leka
Država
na veliko
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
za
FO
leka
SURL]YRÿDþDOHND
leka
pakovanje
0,â,û12.2671,6,67(0/(.29,=$%2/(67,0,â,û12.26712*6,67(0$
0,â,û1,5(/$.6$16,0,25(/$.6$16,
Miorelaksansi sa centralnim delovanjem
Ostali miorelaksansi sa centralnim delovanjem
film tableta
blister, 30 po 150 mg
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
Gedeon Richter Ltd.
0DÿDUVND
275,90
0,2 g
12,26
85%
Chephasaar Chem.
Pharm.
1HPDþND
301,40
50 mg
15,07
90%
Simptomatska terapija spasticiteta nakon moždanog udara kod odraslih.
Lek se propisuje na osnovu mišljenja neurologa ili neuropsihijatra ili fizijatra.
tetrazepam
tetrazepam
TETRAZEPAM-MIP
tableta
blister, 20 po 50 mg
INDIKACIJE
7HUDSLMDEROQLKPLãLüQLKVSD]DPD000
NAPOMENA
M05
M05B
M05BA
M05BA04
Lek se propisuje na osnovu mišljenja neurologa ili psihijatra ili neuropsihijatra ili fizijatra ili reumatologa ili ortopeda.
LEKOVI U TERAPIJI OBOLJENJA KOSTIJU
Lekovi koji deluju na strukturu kosti i mineralizaciju
Bifosfonati
alendronat
1059079
M05BA04
alendronska kiselina
BONAP
tableta
blister, 4 po 70 mg
Hemofarm a.d.
Republika Srbija
643,80
10 mg
22,99
35%
1059908
M05BA04
alendronska kiselina
ALEFOSS
tableta
blister, 4 po 70 mg
Pharmanova d.o.o.
Republika Srbija
643,80
10 mg
22,99
35%
1059909
M05BA04
alendronska kiselina
ALEFOSS
tableta
blister, 8 po 70 mg
Pharmanova d.o.o.
Republika Srbija
1.287,60
10 mg
22,99
35%
1059907
M05BA04
alendronska kiselina
ALEFOSS
tableta
blister, 12 po 70 mg
Pharmanova d.o.o.
Republika Srbija
1.931,40
10 mg
22,99
35%
Lista A1 - Grupa M. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
INN
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD
Naziv
leka
SURL]YRÿDþDOHND
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
JKL
ATC
1059902
M05BA04
alendronska kiselina
FOROSA
film tableta
blister, 2 po 70 mg
Ufar d.o.o.
Republika Srbija
321,90
10 mg
22,99
35%
1059903
M05BA04
alendronska kiselina
FOROSA
film tableta
blister, 4 po 70 mg
Ufar d.o.o.
Republika Srbija
643,80
10 mg
22,99
35%
1059904
M05BA04
alendronska kiselina
FOROSA
film tableta
blister, 8 po 70 mg
Ufar d.o.o.
Republika Srbija
1.287,60
10 mg
22,99
35%
INDIKACIJE
=DOHþHQMHRVWHRSRUR]Hkod pacijenata posle menopauze radi primarne i sekundarne prevencijeRVWHRSRURWLþQLKIUDNWXUD00
NAPOMENA
M05BA06
Lek se uvodi u terapiju na osnovu mišljenja specijɚOLVWHLQWHUQLVWDLOLUHXPDWRORJLOLIL]LMDWDULOLRUWRSHGLOLJLQHNRORJNDGDMHRVWHRSRUR]DYHULILNRYDQD'(;$7
vrednost u L 1- 4 ”LOL”X7RWDO1HFN
ibandronska kiselina
1059092
M05BA06
ibandronska kiselina
ALVODRONIC
film tableta
blister, 1 po 150 mg
Alvogen d.o.o.
Republika Srbija
621,00
5 mg
20,70
35%
1059090
M05BA06
ibandronska kiselina
IBANDRONAT
PHARMAS
film tableta
blister, 1 po 150 mg
PharmaS d.o.o.
Republika Srbija
621,00
5 mg
20,70
35%
INDIKACIJE
=DOHþHQMHRVWHRSRUR]Hkod pacijenata posle menopauze radi primarne i sekundarne prevencijeRVWHRSRURWLþQLKIUDNWXUD00
NAPOMENA
M05BB
M05BB03
Lek se uvodi u terapiju na osnovu mišljenja specijɚOLVWHLQWHUQLVWDLOLUHXPDWRORJLOLIL]LMDWDULOLRUWRSHGLOLJLQHNRORJNDGDMHRVWHRSRUR]DYHULILNRYDQD'(;$7
vrednost u L 1- 4 ”LOL”X7RWDO1HFN
Bifosfonati, kombinacije
alendronska kiselina, holekalciferol
1059121
M05BB03
alendronska kiselina,
holekalciferol
FOSAVANCE
tableta
blister, 4 po (70 mg +
5600 i.j.)
Merck Sharp &
Dohme S.P.A.
Italija
869,50
10 mg
31,05
50%
INDIKACIJE
=DOHþHQMHRVWHRSRUR]Hkod pacijenata posle menopauze radi primarne i sekundarne prevencijeRVWHRSRURWLþQLKIUDNWXUD00
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja specijɚOLVWHLQWHUQLVWDLOLUHXPDWRORJLOLIL]LMDWDULOLRUWRSHGLOLJLQHNRORJNDGDMHRVWHRSRUR]DYHULILNRYDQD'(;$7
vrednost u L 1- 4 ”LOL”X7RWDO1HFN
Lista A1 - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
N
N02
N02A
N02AB
N02AB03 fentanil
=DãWLüHQRLPH
leka
FO
Država
Cena leka na
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
veliko za
leka
leka
leka
pakovanje
NERVNI SISTEM (LEKOVI KOJI DELUJU NA NERVNI SISTEM)
ANALGETICI
Opioidi
Derivafi fenilpiperidina
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
9087565
N02AB03
fentanil
DUROGESIC
transdermalni
flaster
5 po 25 mcg/h ( 5 po
4,2 mg )
Janssen
Pharmaceutica N.V.
Belgija
1.093,90
1,2 mg
62,51
75%
9087566
N02AB03
fentanil
DUROGESIC
transdermalni
flaster
5 po 50 mcg/h ( 5 po
8,4 mg )
Janssen
Pharmaceutica N.V.
Belgija
2.187,90
1,2 mg
62,51
75%
9087568
N02AB03
fentanil
DUROGESIC
transdermalni
flaster
5 po 75 mcg/h (5 po
12,6 mg)
Janssen
Pharmaceutica N.V.
Belgija
3.428,10
1,2 mg
65,30
75%
9087567
N02AB03
fentanil
DUROGESIC
transdermalni
flaster
5 po 100 mcg/h ( 5 po
16,8 mg )
Janssen
Pharmaceutica N.V.
Belgija
3.666,30
1,2 mg
52,38
75%
transedermalni
flaster
kesica, 5 po 25 mcg/h
(5 po 5,78 mg/10,5
cm²)
Hexal AG
1HPDþND
1.084,40
1,2 mg
45,03
75%
transedermalni
flaster
kesica, 5 po 50 mcg/h
(5 po 11,56 mg/21
cm²)
Hexal AG
1HPDþND
2.168,80
1,2 mg
45,03
75%
transedermalni
flaster
kesica, 5 po 100 mcg/h
(5 po 23,12 mg/42
cm²)
Hexal AG
1HPDþND
3.634,20
1,2 mg
37,73
75%
Actavis Nordic A/S
Danska
1.084,40
1,2 mg
63,09
75%
9087805
9087808
9087802
N02AB03
N02AB03
N02AB03
fentanil
fentanil
fentanil
FENTANYL SANDOZ
MAT
FENTANYL SANDOZ
MAT
FENTANYL SANDOZ
MAT
9087201
N02AB03
fentanil
VICTANYL
transdermalni
flaster
kesica, 5 po 25 mcg/h
(5 po 4,125 mg/7,5
cm²)
9087202
N02AB03
fentanil
VICTANYL
transdermalni
flaster
kesica, 5 po 50 mcg/h
(5 po 8,25 mg/15 cm²)
Actavis Nordic A/S
Danska
2.168,80
1,2 mg
63,09
75%
VICTANYL
transdermalni
flaster
kesica, 5 po 75 mcg/h
(5 po 12,375 mg/22,5
cm²)
Actavis Nordic A/S
Danska
3.311,40
1,2 mg
64,22
75%
9087203
N02AB03
fentanil
Lista A1 - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
9087200
ATC
N02AB03
INDIKACIJE
INN
fentanil
=DãWLüHQRLPH
leka
VICTANYL
FO
transdermalni
flaster
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
kesica, 5 po 100 mcg/h
(5 po 16,5 mg/30 cm²)
Actavis Nordic A/S
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Danska
3.634,20
1,2 mg
Cena leka Participacija
na veliko osiguranog
po DDD
lica
52,86
75%
=DOHþHQMHWHãNRJQHXURSDWVNRJEROD
QHVSHFLILþQDQHXUDOJLMD0
SRVWKHUSHWLþNDLSRVWUDXPDWVNDQHXUDOJLMD*
- trigeminalna neuralgija ( G50 )
GLMDEHWLþNDDPLRWURILMD*
- bolna oftalmoplegija ( H47.0 ),
- kauzalgija ( R52.1 ),
- spondilodiscitis ( M50.1; M51.1 ),
GHUPDWRSROLRPLR]LWLV00NRMLVHWRNRPGYRPHVHþQHSULPHQHGUXJLKDQDOJHWLþNLKVUHGVWDYDWULFLNOLþNLDQWLGHSUHVLYLQHVWHURLGQLDQWLUHXPDWLFL
neopioidni analgetici, kortikosteroidi, antiepileptici) pokazao rezistentnim uz participaciju osiguranika 75%.
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja lekara specijaliste neurologa/neuropsihijatra.
N02C
Antimigrenici
N02CC
Selektivni agonisti serotonina ( 5-HT1 )
N02CC01 sumatriptan
film tableta
blister, 2 po 50 mg
GlaxoSmithKline
Pharmaceuticals S.A.
Poljska
283,30
50 mg
141,65
60%
SUMATRIPTAN
tableta
blister, 2 po 50 mg
Slaviamed d.o.o.
Republika Srbija
239,60
50 mg
119,80
50%
sumatriptan
SUMATRIPTAN
tableta
blister, 6 po 50 mg
Slaviamed d.o.o.
Republika Srbija
718,80
50 mg
119,80
50%
N02CC01
sumatriptan
SUMATRIPTAN
tableta
blister, 2 po 100 mg
Slaviamed d.o.o.
Republika Srbija
244,90
50 mg
61,23
50%
N02CC01
sumatriptan
SUMATRIPTAN
tableta
blister, 6 po 100 mg
Slaviamed d.o.o.
Republika Srbija
734,80
50 mg
61,23
50%
1086710
N02CC01
sumatriptan
IMIGRAN
1086876
N02CC01
sumatriptan
1086878
N02CC01
1086877
1086879
INDIKACIJE
1. Migrena ( G43 ).
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja neurologa/neuropsihijatra.
Lista A1 - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1084750
1084612
ATC
N03
N03A
N03AX
INN
N03AX12
gabapentin
N03AX12
gabapentin
N03AX12
INDIKACIJE
NAPOMENA
N03AX16
gabapentin
=DãWLüHQRLPH
leka
KATENA
NEURONTIN
FO
kapsula, tvrda
kapsula, tvrda
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
ANTIEPILEPTICI
Antiepileptici
Ostali antiepileptici
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
blister, 50 po 300 mg
Belupo Lijekovi i
kozmetika d.d.
Hrvatska
1.031,20
1,8 g
123,74
85%
blister, 50 po 300 mg
Pfizer Manufacturing
Deutschland GmbH
1HPDþND
1.031,20
1,8 g
123,74
85%
1. Neuropatski bol (G50; G51; G53 - G63 ).
Lek se uvodi u terapiju na osnovu mišljenja neurologa ili neuropsihijatra zdravstvene ustanove koja obavlja zdravstvenu delatnost na tercijarnom nivou.
pregabalin
1084736
N03AX16
pregabalin
LYRICA
kapsula, tvrda
56 po 75 mg
Pfizer Manufacturing
Deutschland GmbH
1HPDþND
2.095,50
0,3 g
149,68
85%
1084738
N03AX16
pregabalin
LYRICA
kapsula, tvrda
56 po 150 mg
Pfizer Manufacturing
Deutschland GmbH
1HPDþND
3.151,20
0,3 g
112,54
85%
1084745
N03AX16
pregabalin
LYRICA
kapsula, tvrda
56 po 300 mg
Pfizer Manufacturing
Deutschland GmbH
1HPDþND
6.302,40
0,3 g
112,54
85%
Velika Britanija
1.587,00
6 mg
181,37
20%
Velika Britanija
380,10
6 mg
108,60
20%
Velika Britanija
758,10
6 mg
108,30
20%
INDIKACIJE
1. Neuropatski bol ( G50; G51; G53 - G63)
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja neurologa/neuropsihijatra.
N04
ANTIPARKINSONICI
N04B
'RSDPLQHUJLþNLOHNRYL
N04BC
Agonisti dopamina
N04BC04 ropinirol
1085340
N04BC04
ropinirol
REQUIP
film tableta
210 po 0,25 mg
1085341
N04BC04
ropinirol
REQUIP
film tableta
21 po 1 mg
1085342
N04BC04
ropinirol
REQUIP
film tableta
21 po 2 mg
SmithKline Beecham
Pharmaceuticals
SmithKline Beecham
Pharmaceuticals
SmithKline Beecham
Pharmaceuticals
Lista A1 - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1085343
1085344
1085348
1085349
1085360
1085361
ATC
N04BC04
N04BC04
N04BC04
N04BC04
N04BC04
N04BC04
INN
ropinirol
ropinirol
ropinirol
ropinirol
ropinirol
ropinirol
=DãWLüHQRLPH
leka
REQUIP
FO
film tableta
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
21 po 5 mg
SmithKline Beecham
Pharmaceuticals
Velika Britanija
1.583,00
6 mg
90,46
20%
blister, 28 po 2 mg
SmithKline Beecham
Pharmaceuticals; Glaxo
Wellcome S.A.
Velika Britanija;
Španija
1.012,70
6 mg
108,50
30%
blister, 28 po 4 mg
SmithKline Beecham
Pharmaceuticals; Glaxo
Wellcome S.A.
Velika Britanija;
Španija
1.971,90
6 mg
105,64
30%
Velika Britanija;
Španija
3.432,30
6 mg
91,94
30%
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Cena leka Participacija
na veliko osiguranog
po DDD
lica
REQUIP MODUTAB
tableta sa
produženim
RVOREDÿDQMHP
REQUIP MODUTAB
tableta sa
produženim
RVOREDÿDQMHP
REQUIP MODUTAB
tableta sa
produženim
RVOREDÿDQMHP
blister, 28 po 8 mg
SmithKline Beecham
Pharmaceuticals; Glaxo
Wellcome S.A.
REPIROL
tableta sa
produženim
RVOREDÿDQMHP
blister, 30 po 2 mg
PharmaSwiss d.o.o.
Republika Srbija
935,50
6 mg
93,55
20%
REPIROL
tableta sa
produženim
RVOREDÿDQMHP
blister, 30 po 4 mg
PharmaSwiss d.o.o.
Republika Srbija
1.821,20
6 mg
91,06
20%
blister, 30 po 8 mg
PharmaSwiss d.o.o.
Republika Srbija
3.170,20
6 mg
79,26
20%
1085362
N04BC04
ropinirol
REPIROL
tableta sa
produženim
RVOREDÿDQMHP
1085354
N04BC04
ropinirol
NYPERO
film tableta
blister, 21 po 0,25 mg
Alkaloid a.d.
Republika
Makedonija
158,70
6 mg
181,37
20%
1085355
N04BC04
ropinirol
NYPERO
film tableta
blister, 21 po 0,5 mg
Alkaloid a.d.
Republika
Makedonija
316,20
6 mg
180,69
20%
1085356
N04BC04
ropinirol
NYPERO
film tableta
blister, 21 po 1 mg
Alkaloid a.d.
Republika
Makedonija
380,10
6 mg
108,60
20%
1085357
N04BC04
ropinirol
NYPERO
film tableta
blister, 21 po 2 mg
Alkaloid a.d.
Republika
Makedonija
758,10
6 mg
108,30
20%
1085358
N04BC04
ropinirol
NYPERO
film tableta
blister, 21 po 5 mg
Alkaloid a.d.
Republika
Makedonija
1.583,00
6 mg
90,46
20%
INDIKACIJE
1. Parkinsonova bolest ( G20; G21; G22 ).
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja neurologa/neuropsihijatra.
Lista A1 - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
N04BC05 pramipeksol
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
1085290
N04BC05
pramipeksol
MIRAPEXIN
tableta
blister, 30 po 0,25 mg
Boehringer Ingelheim
Pharma GmbH
1HPDþND
406,10
2,5 mg
135,37
25%
1085291
N04BC05
pramipeksol
MIRAPEXIN
tableta
blister, 30 po 1 mg
Boehringer Ingelheim
Pharma GmbH
1HPDþND
1.604,80
2,5 mg
133,73
25%
MIRAPEXIN
tableta sa
produženim
RVOREDÿDQMHP
blister, 10 po 0,375 mg
Boehringer Ingelheim
Pharma GmbH
1HPDþND
300,70
2,5 mg
200,47
25%
MIRAPEXIN
tableta sa
produženim
RVOREDÿDQMHP
blister, 30 po 0,75 mg
Boehringer Ingelheim
Pharma GmbH
1HPDþND
1.551,40
2,5 mg
172,38
25%
MIRAPEXIN
tableta sa
produženim
RVOREDÿDQMHP
blister, 30 po 1,5 mg
Boehringer Ingelheim
Pharma GmbH
1HPDþND
3.133,80
2,5 mg
174,10
25%
blister, 30 po 3 mg
Boehringer Ingelheim
Pharma GmbH
1HPDþND
6.266,80
2,5 mg
174,08
25%
1085081
1085082
1085084
N04BC05
N04BC05
N04BC05
pramipeksol
pramipeksol
pramipeksol
1085083
N04BC05
pramipeksol
MIRAPEXIN
tableta sa
produženim
RVOREDÿDQMHP
1085292
N04BC05
pramipeksol
OPRYMEA
tableta
blister, 30 po 0,18 mg
Krka Tovarna Zdravil
d.d.
Slovenija
406,10
2,5 mg
135,37
25%
1085293
N04BC05
pramipeksol
OPRYMEA
tableta
blister, 30 po 0,7 mg
Krka Tovarna Zdravil
d.d.
Slovenija
1.604,80
2,5 mg
133,73
25%
1086297
N04BC05
pramipeksol
PANARAK
tableta
blister, 30 po 0,18 mg
Hemofarm a.d.
Republika Srbija
406,10
2,5 mg
135,37
25%
1086296
N04BC05
pramipeksol
PANARAK
tableta
blister, 30 po 0,7 mg
Hemofarm a.d.
Republika Srbija
1.604,80
2,5 mg
133,73
25%
INDIKACIJE
NAPOMENA
1. Parkinsonova bolest ( G20; G21; G22 ).
Lek se uvodi u terapiju na osnovu mišljenja neurologa/neuropsihijatra.
Lista A1 - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1085080
ATC
INN
N04BD
N04BD02 rasagilin
N04BD02
INDIKACIJE
NAPOMENA
N04BX
N04BX02
1085284
N04BX02
INDIKACIJE
NAPOMENA
N05
N05A
N05AE
rasagilin
=DãWLüHQRLPH
leka
AZILECT
FO
tableta
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
Inhibitori monoaminooksidaze tipa B (MAO-B)
Teva Pharmaceuticals
Europe B.V.
blister, 28 po 1 mg
Holandija
Cena leka na
veliko za
pakovanje
DDD
7.148,50
1 mg
Cena leka Participacija
na veliko osiguranog
po DDD
lica
255,30
75%
1. Novodijagnostifikovani pacijenti oboleli od Parkinsonove bolesti ( G20 ), najduže tokom prvih pet godina trajanja bolesti.
Lek se uvodi u terapiju na osnovu mišljenja tri lekara neurologa/neuropsihijatra u zdravstvenoj ustanovi koja obavlja zdravstvenu delatnost na tercijarnom
nivou.
2VWDOLGRSDPLQHUJLþNLOHNRYL
entakapon
entakapon
COMTAN
film tableta
ERþLFDVWDNOHQDSR
200 mg
Novartis
Pharmaceuticals UK
Ltd.
Velika Britanija
2.265,70
1g
377,62
60%
1. Parkinsonova bolest ( G20; G21; G22 ).
Lek se uvodi u terapiju na osnovu mišljenja neurologa/neuropsihijatra.
PSIHOLEPTICI
Antipsihotici
Derivati indola
N05AE04
ziprasidon
1070961
N05AE04
ziprasidon
ZELDOX
kapsula
30 po 40 mg
Pfizer Manufacturing
Deutschland GmbH
1HPDþND
2.711,00
80 mg
180,73
65%
1070650
N05AE04
ziprasidon
ZELDOX
kapsula, tvrda
30 po 60 mg
Pfizer Manufacturing
Deutschland GmbH
1HPDþND
3.040,40
80 mg
135,13
65%
1070651
N05AE04
ziprasidon
ZELDOX
kapsula, tvrda
30 po 80 mg
Pfizer Manufacturing
Deutschland GmbH
1HPDþND
4.778,50
80 mg
159,28
65%
INDIKACIJE
âL]RIUHQLMDLGUXJLSVLKRWLþQLSRUHPHüDML]DSDFLMHQWHVDQH]DGRYROMDYDMXüLPRGJRYRURPQDGYDSUHWKRGQRSULPHQMHQDDQWLSVLKRWLND))
0DQLþQHLPHãRYLWHHSL]RGHSRYH]DQHVDELSRODUQLPSRUHPHüDMLPDVDLOLEH]SVLKRWLþQLKVLPSWRPD)))
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja tri lekara psihijatra/neuropsihijatra u zdravstvenoj ustanovi koja obavlja zdravstvenu delatnost na sekundarnom ili
tercijarnom nivou zdravstvene zaštite.
Lista A1 - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
INN
=DãWLüHQRLPH
leka
ATC
N05AF
N05AF05
FO
zuklopentiksol
1070970
N05AF05
zuklopentiksol
CLOPIXOL
film tableta
1070971
N05AF05
zuklopentiksol
CLOPIXOL
film tableta
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
H. Lundbeck A/S
Danska
605,90
30 mg
36,35
50%
H. Lundbeck A/S
Danska
1.478,30
30 mg
35,48
50%
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Derivati tioksantena
kontejner za tablete, 50
po 10 mg
kontejner za tablete, 50
po 25 mg
Cena leka Participacija
na veliko osiguranog
po DDD
lica
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja psihijatra/neuropsihijatra.
Diazepini, oksazepini I tiazepini
N05AH
N05AH02 klozapin
1070965
N05AH02
klozapin
CLOZAPINE
tableta
blister, 50 po 100 mg
Remedica Ltd.
Kipar
1.618,10
0,3 g
97,09
20%
1070963
N05AH02
klozapin
CLOZAPINE
tableta
blister, 50 po 25 mg
Remedica Ltd.
Kipar
468,90
0,3 g
112,54
20%
1070022
N05AH02
klozapin
CLOZAPIN SANDOZ
tableta
50 po 100 mg
Salutas Pharma GmbH
1HPDþND
1.618,10
0,3 g
97,09
20%
1070020
N05AH02
klozapin
CLOZAPIN SANDOZ
tableta
blister, 50 po 25 mg
Salutas Pharma GmbH
1HPDþND
468,90
0,3 g
112,54
20%
blister, 50 po 100 mg
Novartis
Pharmaceuticals UK
Ltd.
Velika Britanija
1.618,10
0,3 g
97,09
20%
blister, 50 po 25 mg
Novartis
Pharmaceuticals UK
Ltd.
Velika Britanija
507,90
0,3 g
121,90
30%
1070606
1070605
N05AH02
N05AH02
INDIKACIJE
klozapin
klozapin
LEPONEX
LEPONEX
tableta
tableta
âL]RIUHQLMD))LGUXJLSVLKRWLþQLSRUHPHüDML))VDQH]DGRYROMDYDMXüLPRGJRYRURPQDGYDSUHWKRGQRSULPHQMHQDDQWLSVLKRWLNDX]
SHULRGLþQLPRQLWRULQJOHXNRFLWDUQHIRUPXOHSUHPDXSXWVWYXSURL]YRÿDþD
3VLKRWLþQLSRUHPHüDMLNRMLVHMDYOMDMXXRNYLUX3DUNLQVRQRYHEROHVWLLGUXJLKREOLNDSDUNLQVRQL]PD**
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja psihijatra/neuropsihijatra/neurologa
N05AH04 kvetiapin
1070944
1070938
N05AH04
N05AH04
kvetiapin
kvetiapin
SEROQUEL XR
tableta sa
produženim
RVOREDÿDQMHP
blister, 60 po 50 mg
AstraZeneca UK
Limited
Velika Britanija
2.392,10
0,4 g
318,95
70%
SEROQUEL XR
tableta sa
produženim
RVOREDÿDQMHP
blister, 60 po 200 mg
AstraZeneca UK
Limited
Velika Britanija
7.499,90
0,4 g
250,00
70%
Lista A1 - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1070937
ATC
N05AH04
INN
kvetiapin
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
SEROQUEL XR
tableta sa
produženim
RVOREDÿDQMHP
blister, 60 po 300 mg
tableta sa
produženim
RVOREDÿDQMHP
blister, 60 po 400 mg
AstraZeneca UK
Limited
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Velika Britanija
9.309,70
0,4 g
206,88
70%
Velika Britanija
14.604,20
0,4 g
243,40
70%
Slovenija
755,30
0,4 g
201,41
55%
Slovenija
1.944,10
0,4 g
129,61
55%
Slovenija
2.813,90
0,4 g
125,06
55%
Cena leka Participacija
na veliko osiguranog
po DDD
lica
1070939
N05AH04
kvetiapin
SEROQUEL XR
1070945
N05AH04
kvetiapin
KVENTIAX
film tableta
blister, 60 po 25 mg
1070946
N05AH04
kvetiapin
KVENTIAX
film tableta
blister, 60 po 100 mg
1070947
N05AH04
kvetiapin
KVENTIAX
film tableta
blister, 60 po 150 mg
1070948
N05AH04
kvetiapin
KVENTIAX
film tableta
blister, 60 po 200 mg
AstraZeneca UK
Limited
Krka Tovarna Zdravil
d.d.
Krka Tovarna Zdravil
d.d.
Krka Tovarna Zdravil
d.d.
Krka Tovarna Zdravil
d.d.
Slovenija
3.354,20
0,4 g
111,81
55%
Slovenija
3.925,20
0,4 g
87,23
55%
1070949
1070859
1070858
1070857
1070856
N05AH04
N05AH04
N05AH04
N05AH04
N05AH04
kvetiapin
KVENTIAX
film tableta
blister, 60 po 300 mg
Krka Tovarna Zdravil
d.d.
kvetiapin
KVETIAPIN
PHARMAS
film tableta
blister, 60 po 25 mg
PharmaS d.o.o.
Republika Srbija
755,30
0,4 g
201,41
55%
kvetiapin
KVETIAPIN
PHARMAS
film tableta
blister, 60 po 100 mg
PharmaS d.o.o.
Republika Srbija
1.944,10
0,4 g
129,61
55%
kvetiapin
KVETIAPIN
PHARMAS
film tableta
blister, 60 po 200 mg
PharmaS d.o.o.
Republika Srbija
3.354,20
0,4 g
111,81
55%
kvetiapin
KVETIAPIN
PHARMAS
film tableta
blister, 60 po 300 mg
PharmaS d.o.o.
Republika Srbija
3.925,20
0,4 g
87,23
55%
5 mg
133,37
25%
INDIKACIJE
âL]RIUHQLMDLGUXJLSVLKRWLþQLSRUHPHüDML))
0DQLþQHGHSUHVLYQHLPHãRYLWHHSL]RGHSRYH]DQHVDELSRODUQLPSRUHPHüDMLPDVDLOLEH]SVLKRWLþQLKVLPSWRPD)
NAPOMENA
N05AX
N05AX08
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra.
Ostali antipsihotici
risperidon
2070924
N05AX08
risperidon
RISPOLEPT
rastvor za oralnu
upotrebu
boca staklena,100 ml
(1 mg/ml)
Janssen
Pharmaceutica N.V.
Belgija
2.667,30
Lista A1 - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
2070936
ATC
N05AX08
INDIKACIJE
INN
risperidon
=DãWLüHQRLPH
leka
RISPOLEPT
FO
oralni rastvor
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
ERþLFDVWDNOHQDSR
30 ml (1 mg/ml)
Janssen
Pharmaceutica N.V.
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Belgija
1.235,80
5 mg
205,97
25%
Cena leka Participacija
na veliko osiguranog
po DDD
lica
âL]RIUHQLMDãL]RWLSVNLSRUHPHüDMLLSRUHPHüDMLVDVXPDQXWRãüX))
%LSRODUQLDIHNWLYQLSRUHPHüDM)
3UROD]QDSVLKRWLþQDVWDQMDNRGRUJDQVNLKSRUHPHüDMD))))
=DLQGLNDFLMHSRGLVDPR]DRVREHVWDULMHRGJRGLQD
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra ili neurologa.
NAPOMENA
N05B
Anksiolitici
N05BA
Derivati benzodiazepina
N05BA06 lorazepam
1071710
N05BA06
lorazepam
LORAZEPAM
tableta
30 po 1 mg
Hemofarm a.d.
Republika Srbija
104,10
2,5 mg
8,68
90%
1071711
N05BA06
lorazepam
LORAZEPAM
tableta
20 po 2,5 mg
Hemofarm a.d.
Republika Srbija
115,40
2,5 mg
5,77
90%
/HNSURSLVXMHL]DEUDQLOHNDUEH]PLãOMHQMDOHNDUDVSHFLMDOLVWHRGUHÿHQHJUDQHPHGLFLQHGRWULPHVHFDXWRNXPHVHFLDQDVWDYDNWHUDSLMHX]PLãOMHQMHOHNDUD
NAPOMENA
VSHFLMDOLVWHRGUHÿHQHJUDQHPHGLFLQHSVLKLMDWUDLOLQHXURSVLKLMDWUDLOLQHXURORJD
N05BA08 bromazepam
1071720
N05BA08
bromazepam
BROMAZEPAM
tableta
blister, 30 po 1,5 mg
Hemofarm a.d.
Republika Srbija
74,10
10 mg
16,47
90%
1071721
N05BA08
bromazepam
BROMAZEPAM
tableta
blister, 30 po 3 mg
Hemofarm a.d.
Republika Srbija
99,10
10 mg
11,01
90%
1071722
N05BA08
bromazepam
BROMAZEPAM
tableta
blister, 20 po 6 mg
Hemofarm a.d.
Republika Srbija
81,80
10 mg
6,82
90%
blister, 30 po 1,5 mg
Alkaloid a.d. u saradnji
sa F. Hoffmann-La
Roche Ltd.
Republika
Makedonija
74,10
10 mg
16,47
90%
Republika
Makedonija
99,10
10 mg
11,01
90%
Slovenija
74,10
10 mg
16,47
90%
1071624
N05BA08
bromazepam
LEXILIUM
tableta
1071626
N05BA08
bromazepam
LEXILIUM
tableta
blister, 30 po 3 mg
Alkaloid a.d. u saradnji
sa F. Hoffmann-La
Roche Ltd.
1071320
N05BA08
bromazepam
LEXAURIN
tableta
blister, 30 po 1,5 mg
Krka Tovarna Zdravil
d.d.
Lista A1 - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
1071322
N05BA08
bromazepam
LEXAURIN
tableta
blister, 30 po 3 mg
Krka Tovarna Zdravil
d.d.
Slovenija
99,10
10 mg
11,01
90%
1071324
N05BA08
bromazepam
LEXAURIN
tableta
blister, 30 po 6 mg
Krka Tovarna Zdravil
d.d.
Slovenija
122,80
10 mg
6,82
90%
/HNSURSLVXMHL]DEUDQLOHNDUEH]PLãOMHQMDOHNDUDVSHFLMDOLVWHRGUHÿHQHJUDQHPHGLFLQHGRWULPHVHFDXWRNXPHVHFLDQDVWDYDNWHUDSLMHX]PLãOMHQMHOHNDUD
NAPOMENA
VSHFLMDOLVWHRGUHÿHQHJUDQHPHGLFLQHSVLKLMDWUDLOLQHXURSVLKLMDWUDLOLQHXURORJD
N05BA12 alprazolam
1071750
N05BA12
alprazolam
KSALOL
tableta
blister, 30 po 0,25 mg
Galenika a.d.
Republika Srbija
83,00
1 mg
11,07
90%
1071751
N05BA12
alprazolam
KSALOL
tableta
blister, 30 po 0,50 mg
Galenika a.d.
Republika Srbija
135,40
1 mg
9,03
90%
1071752
N05BA12
alprazolam
KSALOL
tableta
blister, 30 po 1 mg
Galenika a.d.
Republika Srbija
192,70
1 mg
6,42
90%
1071330
N05BA12
alprazolam
XANAX
tableta
blister, 30 po 0,25 mg
Pfizer Italia S.R.L.
Italija
83,00
1 mg
11,07
90%
1071331
N05BA12
alprazolam
XANAX
tableta
blister, 30 po 0,5 mg
Pfizer Italia S.R.L.
Italija
135,40
1 mg
9,03
90%
/HNSURSLVXMHL]DEUDQLOHNDUEH]PLãOMHQMDOHNDUDVSHFLMDOLVWHRGUHÿHQHJUDQHPHGLFLQHGRWULPHVHFDXWRNXPHVHFLDQDVWDYDNWHUDSLMHX]PLãOMHQMHOHNDUD
NAPOMENA
VSHFLMDOLVWHRGUHÿHQHJUDQHPHGLFLQHSVLKLMDWUDLOLQHXURSVLKLMDWUDLOLQHXURORJD
N05C
Hipnotici i sedativi
N05CD
Derivati benzodiazepina
N05CD02 nitrazepam
1077260
N05CD02
nitrazepam
NIPAM
tableta
blister, 10 po 5 mg
1077196
N05CD02
nitrazepam
CERSON
tableta
blister, 10 po 5 mg
Bosnalijek d.d.
Belupo Lijekovi i
kozmetika d.d.
Bosna i
Hercegovina
60,10
5 mg
6,01
90%
Hrvatska
60,10
5 mg
6,01
90%
/HNSURSLVXMHL]DEUDQLOHNDUEH]PLãOMHQMDOHNDUDVSHFLMDOLVWHRGUHÿHQHJUDQHPHGLFLQHGRWULPHVHFDXWRNXPHVHFLDQDVWDYDNWHUDSLMHX]PLãOMHQMHOHNDUD
NAPOMENA
VSHFLMDOLVWHRGUHÿHQHJUDQHPHGLFLQHSVLKLMDWUDLOLQHXURSVLKLMDWUDLOLQHXURORJD
N05CD08 midazolam
1071461
N05CD08
NAPOMENA
midazolam
FLORMIDAL
tableta
30 po 15 mg
Galenika a.d. u saradnji
sa F.Hoffmann-La
Roche Ltd, Švajcarska
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra ili neurologa.
Republika Srbija
742,10
15 mg
24,74
90%
Lista A1 - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
zolpidem
1077151
N05CF02
zolpidem
STILNOX
film tableta
blister, 20 po 10 mg
1077301
N05CF02
zolpidem
SANVAL
film tableta
blister, 20 po 5 mg
1077300
N05CF02
zolpidem
SANVAL
film tableta
blister, 20 po 10 mg
Sanofi Winthrop
Industrie
Lek farmacevtska
družba d.d.
Lek farmacevtska
družba d.d.
1077302
N05CF02
zolpidem
BELBIEN
film tableta
blister, 20 po 10 mg
Hemofarm a.d.
1077401
1077400
N05CF03
N05CF03
FO
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
Lekovi srodni benzodiazepinima
ATC
N05CF
N05CF02
NAPOMENA
N05CF03
INN
=DãWLüHQRLPH
leka
Cena leka na
veliko za
pakovanje
DDD
Francuska
172,90
10 mg
8,65
90%
Slovenija
96,40
10 mg
9,64
90%
Slovenija
172,90
10 mg
8,65
90%
Republika Srbija
172,90
10 mg
8,65
90%
Cena leka Participacija
na veliko osiguranog
po DDD
lica
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra ili neurologa.
zaleplon
zaleplon
zaleplon
ZAN
ZAN
kapsula, tvrda
kapsula, tvrda
blister, 14 po 5 mg
Belupo Lijekovi i
kozmetika d.d.
Hrvatska
141,20
10 mg
20,17
90%
blister, 14 po 10 mg
Belupo Lijekovi i
kozmetika d.d.
Hrvatska
276,60
10 mg
19,76
90%
279,30
0,1 g
37,24
75%
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra ili neurologa.
PSIHOANALEPTICI
N06
N06A
Antidepresivi
N06AA
Neselektivni inhibitori preuzimanja monoamina
N06AA04 klomipramin
1072740
N06AA04
NAPOMENA
klomipramin
ANAFRANIL
obložena tableta
30 po 25 mg
Novartis Farma S.P.A.
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra ili neurologa.
Italija
Lista A1 - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1072910
ATC
INN
N06AB
N06AB05 paroksetin
N06AB05
INDIKACIJE
paroksetin
=DãWLüHQRLPH
leka
SEROXAT
FO
film tableta
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
Selektivni inhibitori preuzimanja serotonina
blister, 30 po 20 mg
Glaxo Wellcome
Production; S.C.
Europharm S.A.
Cena leka na
veliko za
pakovanje
DDD
Francuska;
Rumunija
397,20
20 mg
13,24
15%
Cena leka Participacija
na veliko osiguranog
po DDD
lica
1. Depresivna epizoda (F32),
5HNXUHQWQLGHSUHVLYQLSRUHPHüDM)
3. Agorafobija (F40.0),
'UXJLDQNVLR]QLSRUHPHüDML)
2SVHVLYQRNRPSXOVLYQLSRUHPHüDML)
3RVWWUDXPDWVNLVWUHVQLSRUHPHüDM)
2UJDQVNLDQNVLR]QLSRUHPHüDM)
Samo za osobe starije od 18 godina.
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra ili neurologa.
N06AB08 fluvoksamin
1072137
N06AB08
fluvoksamin
FEVARIN
film tableta
blister, 15 po 100 mg
Abbott Healthcare SAS
Francuska
527,00
0,1 g
35,13
75%
1072138
N06AB08
fluvoksamin
FEVARIN
film tableta
blister, 30 po 100 mg
Abbott Healthcare SAS
Francuska
1.053,90
0,1 g
35,13
75%
Danska
400,40
10 mg
14,30
20%
INDIKACIJE
1. Teška depresivna epizoda (F32.2),
2SVHVLYQRNRPSXOVLYQLSRUHPHüDM)
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja tri lekara psihijatra ili neuropsihijatra ili neurologa.
N06AB10 escitalopram
1072613
N06AB10
escitalopram
CIPRALEX
film tableta
blister, 28 po 10 mg
H. Lundbeck A/S
INDIKACIJE
1. Depresivna epizoda (F32),
5HNXUHQWQLGHSUHVHYQLSRUHPHüDM)
3DQLþQLSRUHPHüDM)
4. Socijalna fobija (F40.1);
2SVHVLYQRNRPSXOVLYQLSRUHPHüDM)
NAPOMENA
Samo za osobe starije od 18 godina.
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra ili neurologa.
Lista A1 - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1072141
1072782
ATC
INN
N06AG
N06AG02 moklobemid
N06AG02
N06AG02
NAPOMENA
N06AX
N06AX03
1072750
N06AX03
moklobemid
moklobemid
=DãWLüHQRLPH
leka
AURORIX
AURORIX
FO
film tableta
film tableta
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
Inhibitori monoaminooksidaze tipa A (MAO-A)
1HPDþND
Francuska
1.104,50
0,3 g
36,82
65%
Meda Pharma GmbH &
Co.KG; Cenexi S.A.S;
F. Hoffmann-La Roche
blister, 30 po 300 mg
Ltd.
1HPDþND
Francuska,
Švajcarska
1.401,90
0,3 g
46,73
65%
Holandija
561,00
60 mg
37,40
65%
Italija
480,70
0,3 g
48,07
75%
Lek se uvodi u terapiju na osnovu mišljenja psihijatra/neuropsihijatra.
Ostali antdepresivi
mianserin
mianserin
TOLVON
film tableta
blister, 30 po 30 mg
N.V. Organon
1. Akutna depresivna epizoda (F32);
2. Rekurentna depresivna epizoda (F33).
NAPOMENA
N06AX05
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra ili neurologa.
trazodon
N06AX05
INDIKACIJE
NAPOMENA
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
Meda Pharma GmbH &
Co.KG; Cenexi S.A.S
60 po 150 mg
INDIKACIJE
1072631
Cena leka na
veliko za
pakovanje
trazodon
TRITTICO Retard
tableta sa
produženim
RVOREDÿDQMHP
20 po 150 mg
Aziende Chimiche
Riunite Angelini
Francesco S.P.A.
1. Depresija ( F32 )
2. Rekurentna depresivna epizoda ( F33 ).
/HNVHXYRGLXWHUDSLMX]DLQGLNDFLMHSRGWDþNRPLQDRVQRYXPLãOMHQMDSVLKLMDWUDQHXURSVLKLMDWUD
N06AX11
mirtazapin
1072705
N06AX11
mirtazapin
CALIXTA
film tableta
blister, 30 po 30 mg
Belupo Lijekovi i
kozmetika d.d.
Hrvatska
478,50
30 mg
15,95
50%
1072860
N06AX11
mirtazapin
REMIRTA
film tableta
blister, 30 po 15 mg
Zdravlje a.d.
Republika Srbija
303,00
30 mg
20,20
50%
Lista A1 - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
1072861
N06AX11
mirtazapin
REMIRTA
film tableta
blister, 30 po 30 mg
Zdravlje a.d.
Republika Srbija
478,50
30 mg
15,95
50%
1072901
N06AX11
mirtazapin
REMERON
film tableta
30 po 30 mg
N.V. Organon
Holandija
478,50
30 mg
15,95
50%
INDIKACIJE
NAPOMENA
N06AX12
1089141
1089140
N06AX12
N06AX12
1. Depresivna epizoda (F32),
5HNXUHQWQLGHSUHVLYQLSRUHPHüDM)
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra ili neurologa.
bupropion
bupropion
bupropion
WELLBUTRIN XR
tableta sa
modifikovanim
RVOREDÿDQMHP
ERþLFDSRPJ
Glaxo Wellcome GmbH
& Co. KG
1HPDþND
1.179,60
300 mg
78,64
85%
WELLBUTRIN XR
tableta sa
modifikovanim
RVOREDÿDQMHP
ERþLFDSRPJ
Glaxo Wellcome GmbH
& Co. KG
1HPDþND
2.018,90
300 mg
67,30
85%
Francuska
500,70
37,5 mg
50,07
60%
Republika Srbija
311,20
0,1 g
29,64
50%
INDIKACIJE
1. Depresivna epizoda ( F32.0; F32.1; F32.2; F32.4; F32.8; F32,9 ),
5HNXUHQWQLGHSUHVLYQLSRUHPHüDM))))))
NAPOMENA
N06AX14
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra ili neurologa.
tianeptin
1072600
N06AX14
tianeptin
COAXIL
obložena tableta
blister, 30 po 12,5 mg
Les Laboratoires
Servier
INDIKACIJE
1. Akutna depresivna epizoda (F32);
2. Rekurentna depresivna epizoda (F33).
NAPOMENA
N06AX16
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra ili neurologa.
venlafaksin
1072857
N06AX16
venlafaksin
VELAHIBIN
film tableta
blister, 28 po 37,5 mg
Zdravlje a.d.
Lista A1 - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
1072858
1072992
1072990
1072489
1072488
1072487
1072828
1072832
ATC
N06AX16
N06AX16
N06AX16
N06AX16
N06AX16
N06AX16
N06AX16
N06AX16
INDIKACIJE
NAPOMENA
INN
venlafaksin
venlafaksin
venlafaksin
venlafaksin
venlafaksin
venlafaksin
venlafaksin
venlafaksin
=DãWLüHQRLPH
leka
VELAHIBIN
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
film tableta
blister, 28 po 75 mg
Zdravlje a.d.
Republika Srbija
603,70
0,1 g
28,75
50%
ALVENTA
kapsula sa
produženim
oslobadjanjem,
tvrda
blister, 28 po 75 mg
Slaviamed d.o.o.
Republika Srbija
603,70
0,1 g
28,75
50%
ALVENTA
kapsula sa
produženim
oslobadjanjem,
tvrda
blister, 28 po 150 mg
Slaviamed d.o.o.
Republika Srbija
901,30
0,1 g
21,46
50%
VENLAX
kapsula sa
produženim
RVOREDÿDQMHPWYUGD blister, 30 po 37,5 mg
Galenika a.d.
Republika Srbija
333,50
0,1 g
29,64
50%
VENLAX
kapsula sa
produženim
RVOREDÿDQMHPWYUGD
blister, 30 po 75 mg
Galenika a.d.
Republika Srbija
646,80
0,1 g
28,75
50%
VENLAX
kapsula sa
produženim
RVOREDÿDQMHPWYUGD blister, 30 po 150 mg
Galenika a.d.
Republika Srbija
965,70
0,1 g
21,46
50%
EFECTIN ER
kapsula sa
produženim
RVOREDÿDQMHPWYUGD
blister, 28 po 75 mg
Pfizer Ireland
Pharmaceuticals
Irska
603,70
0,1 g
28,75
50%
EFECTIN ER
kapsula sa
produženim
RVOREDÿDQMHPWYUGD blister, 28 po 150 mg
Pfizer Ireland
Pharmaceuticals
Irska
901,30
0,1 g
21,46
50%
1. Depresivna epizoda (F32),
5HNXUHQWQLGHSUHVLYQLSRUHPHüDM)
3. Agorafobija (F40.0),
4. Socijalna fobija (F40.1),
'UXJLDQNVLR]QLSRUHPHüDML)
3RVWWUDXPDWVNLVWUHVQLSRUHPHüDML)
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra ili neurologa.
Lista A1 - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
N06D
N06DA
N06DA02 donepezil
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Lekovi u terapiji demencije
Antiholinesteraze
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
1079010
N06DA02
donepezil
ARICEPT
tableta
blister, 28 po 5 mg
Pfizer PGM
Francuska
2.476,80
7,5 mg
132,69
60%
1079011
N06DA02
donepezil
ARICEPT
tableta
blister, 28 po 10 mg
Pfizer PGM
Francuska
3.097,30
7,5 mg
82,96
60%
1079030
N06DA02
donepezil
YASNAL
film tableta
blister, 28 po 5 mg
Slaviamed d.o.o.
Republika Srbija
2.476,80
7,5 mg
132,69
60%
1079031
N06DA02
donepezil
YASNAL
film tableta
blister, 28 po 10 mg
Slaviamed d.o.o.
Republika Srbija
3.097,30
7,5 mg
82,96
60%
1079051
N06DA02
donepezil
TREGONA
film tableta
blister, 28 po 5 mg
Hemofarm a.d.
Republika Srbija
2.476,80
7,5 mg
132,69
60%
1079050
N06DA02
donepezil
TREGONA
film tableta
blister, 28 po 10 mg
Hemofarm a.d.
Republika Srbija
3.097,30
7,5 mg
82,96
60%
INDIKACIJE
1. Alzheimerova bolest (G30; F00).
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra ili neurologa.
N06DA03 rivastigmin
1088012
N06DA03
rivastigmin
EXELON
kapsula, tvrda
blister, 28 po 1,5 mg
Novartis Farmaceutica
S.A.
Španija
3.247,30
9 mg
695,85
75%
1088013
N06DA03
rivastigmin
EXELON
kapsula, tvrda
blister, 28 po 3 mg
Novartis Farmaceutica
S.A.
Španija
3.247,30
9 mg
347,93
75%
Španija
3.247,30
9 mg
231,95
75%
1088014
N06DA03
rivastigmin
EXELON
kapsula, tvrda
blister, 28 po 4,5 mg
Novartis Farmaceutica
S.A.
1088015
N06DA03
rivastigmin
EXELON
kapsula, tvrda
blister, 28 po 6 mg
Novartis Farmaceutica
S.A.
Španija
3.247,30
9 mg
173,96
75%
oralni rastvor
ERþLFDSRPO
mg/ml)
Novartis Pharma
Services
Francuska
8.103,70
9 mg
303,89
75%
2088016
N06DA03
rivastigmin
EXELON
INDIKACIJE
1. Alzheimerova bolest (G30; F00).
2. Demencija u Parkinsonovoj bolesti (F02.3)
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra ili neurologa.
Lista A1 - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
9088225
9088226
ATC
INN
N06DA03 rivastigmin
N06DA03
N06DA03
rivastigmin
rivastigmin
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
EXELON
transdermalni
flaster
YUHüLFDSRNRP Novartis Pharma Stein
4,6 mg/24 h
AG
Švajcarska
6.959,80
9 mg
453,90
75%
EXELON
transdermalni
flaster
YUHüLFDSRNRP Novartis Pharma Stein
9,5 mg/24 h
AG
Švajcarska
6.959,80
9 mg
219,78
75%
=DãWLüHQRLPH
leka
INDIKACIJE
Blago do umereno teška demencija Alchajmerovog tipa (G30; F00).
NAPOMENA
N06DX
N06DX01
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra ili neurologa.
Ostali lekovi za terapiju demencije
memantin
Cena leka Participacija
na veliko osiguranog
po DDD
lica
1079020
N06DX01
memantin
EBIXA
film tableta
28 po 10 mg
H. Lundbeck A/S
Danska
2.857,30
20 mg
204,09
75%
1079022
N06DX01
memantin
EBIXA
film tableta
56 po 10 mg
H. Lundbeck A/S
Danska
5.714,60
20 mg
204,09
75%
1079027
N06DX01
memantin
EBIXA
film tableta
blister, 28 po 20 mg
H. Lundbeck A/S
Danska
5.714,60
20 mg
204,09
75%
1079045
N06DX01
memantin
MEMANTIN PLIVA
film tableta
blister, 30 po 10 mg
Pliva Hrvatska d.o.o.
Hrvatska
3.061,40
20 mg
204,09
75%
INDIKACIJE
1. Alzheimerova bolest (G30; F00).
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja psihijatra ili neuropsihijatra ili neurologa.
OSTALI LEKOVI KOJI DELUJU NA NERVNI SISTEM
N07
Lekovi koji se upotrebljavaju u bolestima zavisnosti
N07B
N07BB
Lekovi koji se upotrebljavaju u alkoholnoj zavisnosti
N07BB04 naltrekson
1182030
N07BB04
naltrekson
NALTREXONE
film tableta
blister, 7 po 50 mg
Haupt Pharma
Wolfratshausen GmbH
1HPDþND
804,20
50 mg
114,89
75%
1182031
N07BB04
naltrekson
NALTREXONE
film tableta
blister, 28 po 50 mg
Haupt Pharma
Wolfratshausen GmbH
1HPDþND
3.216,50
50 mg
114,88
75%
INDIKACIJE
1. Održavanje opijatske zavisnosti (F11).
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja tri lekara psihijatra ili neuropsihijatra.
Lista A1 - Grupa N. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
N07BC
N07BC01 buprenorfin
=DãWLüHQRLPH
leka
FO
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
Lekovi koji se upotrebljavaju u opioidnoj zavisnosti
Cena leka na
veliko za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
1182051
N07BC01
buprenorfin
BUPRENORFIN
ALKALOID
sublingvalna tableta
blister, 7 po 2 mg
Alkaloid a.d.
Republika
Makedonija
382,20
8 mg
218,40
50%
1182052
N07BC01
buprenorfin
BUPRENORFIN
ALKALOID
sublingvalna tableta
blister, 7 po 8 mg
Alkaloid a.d.
Republika
Makedonija
1.424,80
8 mg
203,54
50%
INDIKACIJE
/HþHQMH]DYLVQRVWLRGRSLMDWD)
NAPOMENA
Za supstituciju, lek se uvodi u terapiju u zdravstvenim ustanovama koje obavljaju zdravstvenu delatnost na primarnom, sekundarnom ili tercijarnom nivou na
osnovu mišljenja psihijatra/neuropsihijatra, a u skladu sa Smernicama za primenu supstitucione terapije. Za detoksikaciju, lek se uvodi i detoksikacija sprovodi
LVNOMXþLYRXVOHGHüLP]GUDYVWYHQLPXVWDQRYDPD
- KC Kragujevac- Klinika za psihijatriju
- KC Vojvodine- Klinika za psihijatriju
- KC Niš- Klinika za psihijatriju
- Specijalna bolnica za bolesti zavisnosti u Beogradu.
Lista A1 - Grupa R. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
7110022
7110023
ATC
INN
R
R01
R01A
R01AD
R01AD01 beklometazon
R01AD01
beklometazon
R01AD01
beklometazon
dipropionat
=DãWLüHQRLPH
leka
BECONASE
sprej za nos,
suspenzija
NASOBEC
sprej za nos,
suspenzija
R03AC12
INDIKACIJE
salmeterol
1 po 200 doza (50
mcg/doza )
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
GlaxoSmithKline
Pharmaceuticals S.A.
Poljska
359,80
0,4 mg
14,39
35%
ERþLFDVDUDVSUãLYDþHP
1 po 30 ml (200 doza po
50 mcg)
Ivax Pharmaceuticals
ýHãND
359,80
0,4 mg
14,39
35%
2.049,50
100 mcg
68,32
35%
/(.29,.2-,6(35,0(1-8-88236758.7,912-3/8û12-%2/(67,
Adrenergici, inhalacioni
Selektivni agonisti beta-2-adrenoreceptora
R03
R03A
R03AC
R03AC12 salmeterol
7114591
Cena leka
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
Država
za
FO
leka
leka
proizvodnje leka pakovanje
5(63,5$7251,6,67(0/(.29,=$/(ý(1-(%2/(67,5(63,5$72512*6,67(0$
Nazalni preparati
Dekongestivi I ostali nazalni preparati za lokalnu primenu
Kortikosteroidi
SEREVENT Inhaler
CFC-Free
suspenzija za
inhalaciju pod
pritiskom
inhalator pod pritiskom
sa dozerom, 1 po 120
doza (25 mcg/doza)
Hemofarm a.d. u
saradnji sa
GlaxoSmithKline
Export Ltd. Velika
Britanija
Republika Srbija
1. Bronhijalna astma, samo uz terapiju inhalacionim kortikosteroidima (J45),
+URQLþQDRSVWUXNWLYQDEROHVWSOXüDNRGRGUDVOLK]DXPHUHQRWHãNHWHãNHLYHRPDWHãNH,,,,,LOL,9VWDGLMXPREOLNHEROHVWL-
/HNVHXYRGLXWHUDSLMX]DLQGLNDFLMHSRGWDþNDPDLQDRVQRYXPLãOMHQMDSXOPRORJDLOLSQHXPRIWL]LRORJDLOLDOHUJRORJDLOLLPXQRORJDLOLLQWHUQLVWHXVOXåEL
pulmologije.
NAPOMENA
R03AC13 formoterol
7114162
R03AC13
formoterol
OXIS TURBUHALER
prašak za inhalaciju
kontejner višedozni, 1 po
60 doza (4,5 mcg/doza)
AstraZeneca AB
Švedska
1.051,20
24 mcg
70,08
35%
Lista A1 - Grupa R. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
7114163
ATC
R03AC13
INDIKACIJE
INN
formoterol
=DãWLüHQRLPH
leka
FO
OXIS TURBUHALER
prašak za inhalaciju
Cena leka
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
Država
za
leka
leka
proizvodnje leka pakovanje
kontejner višedozni, 1 po
60 doza (9 mcg/doza)
AstraZeneca AB
Švedska
2.102,20
DDD
24 mcg
Cena leka Participacija
na veliko osiguranog
po DDD
lica
70,07
35%
1. Bronhijalna astma, samo uz terapiju inhalacionim kortikosteroidima (J45),
+URQLþQDRSVWUXNWLYQDEROHVWSOXüDNRGRGUDVOLK]DXPHUHQRWHãNHWHãNHLYHRPDWHãNH,,,,,LOL,9VWDGLMXPREOLNHEROHVWL-
/HNVHXYRGLXWHUDSLMX]DLQGLNDFLMHSRGWDþNDPDLQDRVQRYXPLãOMHQMDSXOPRORJDLOLSQHXPRIWL]LRORJDLOLDOHUJRORJDLOLLPXQRORJDLOLLQWHUQLVWHXVOXåEL
NAPOMENA
pulmologije.
R03AK
$GUHQHUJLFLLGUXJLOHNRYL]DRSVWUXNWLYQHSOXüQHEROHVWLXNRPELQDFLML
R03AK06 flutikazon propionat, salmeterol
7114670
7114671
7114672
R03AK06
flutikazon,
salmeterol
R03AK06
flutikazon,
salmeterol
R03AK06
flutikazon,
salmeterol
INDIKACIJE
SERETIDE DISCUS
prašak za inhalaciju,
podeljen
diskus, 1 po 60 doza
(100 mcg/doza + 50
mcg/doza)
Glaxo Wellcome
Operations
Velika Britanija
2.338,80
2 inh.
77,96
35%
SERETIDE DISCUS
prašak za inhalaciju,
podeljen
diskus, 1 po 60 doza
(250 mcg/doza + 50
mcg/doza)
Glaxo Wellcome
Operations
Velika Britanija
3.033,40
2 inh.
101,11
35%
SERETIDE DISCUS
prašak za inhalaciju,
podeljen
diskus, 1 po 60 doza
(500 mcg/doza + 50
mcg/doza)
Glaxo Wellcome
Operations
Velika Britanija
3.991,70
2 inh.
133,06
35%
1. Bronhijalna astma (J45).
+URQLþQDRSVWUXNWLYQDEROHVWSOXüDNRGRGUDVOLKNRGNRMLKMHSRVWEURQKRGLODWDWRUQL)(9ч60% (J44).
=DLQGLNDFLMHSRGWDþNRPLOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDSXOPRORJDLOLSQHXPRIWL]LRORJDLOLDOHUJRORJDLOLLPXQRORJDLOLLQWHUQLVWHXVOXåEL
NAPOMENA
SXOPRORJLMH=DLQGLNDFLMXSRGWDþNRPPLãOMHQMHPRUDGDVDGUåLYUHGQRVWSRVWEURQKRGLODWDWRUQRJ)(9
R03AK07 budesonid, formoterol
7114710
R03AK07
budesonid,
formoterol
SYMBICORT
TURBUHALER
prašak za inhalaciju
1 po 60 doza (80 mcg +
4,5 mcg)
AstraZeneca AB
Švedska
1.727,70
4 inh.
115,18
35%
7114711
R03AK07
budesonid,
formoterol
SYMBICORT
TURBUHALER
prašak za inhalaciju
1 po 60 doza (160 mcg +
4,5 mcg)
AstraZeneca AB
Švedska
2.118,10
4 inh.
141,21
35%
Lista A1 - Grupa R. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
7114712
ATC
R03AK07
INDIKACIJE
INN
budesonid,
formoterol
=DãWLüHQRLPH
leka
SYMBICORT
TURBUHALER
FO
prašak za inhalaciju
Cena leka
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
Država
za
leka
leka
proizvodnje leka pakovanje
1 po 60 doza (320 mcg +
9 mcg)
AstraZeneca AB
Švedska
3.991,70
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
2 inh.
133,06
35%
1. Bronhijalna astma (J45).
+URQLþQDRSVWUXNWLYQDEROHVWSOXüDNRGRGUDVOLKNRGNRMLKMHSRVWEURQKRGLODWDWRUQL)(9-
=DLQGLNDFLMHSRGWDþNRPLOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDSXOPRORJDLOLSQHXPRIWL]LRORJDLOLDOHUJRORJDLOLLPXQRORJDLOLLQWHUQLVWHXVOXåEL
NAPOMENA
SXOPRORJLMH=DLQGLNDFLMXSRGWDþNRPPLãOMHQMHPRUDGDVDGUåLYUHGQRVWSRVWEURQKRGLODWDWRUQRJ)(9
R03AK07 beklometazon, formoterol
7114246
R03AK07
INDIKACIJE
beklometazon,
formoterol
FOSTER
rastvor za inhalaciju
pod pritiskom
kontejner pod pritiskom
sa ventilom za doziranje,
1 po 180 doza (100
Chiesi Pharmaceuticals
mcg/doza + 6 mcg/doza)
GmbH
Austrija
4.646,50
4 inh.
103,26
35%
1. Bronhijalna astma (J45).
Lek se uvodi u terapiju na osnovu mišljenja pulmologa ili pneumoftiziologa ili alergologa ili interniste u službi pulmologije.
NAPOMENA
R03B
2VWDOLOHNRYL]DRSVWUXNWLYQHSOXüQHEROHVWLLQKDODFLRQL
R03BA
Glukokortikoidi
R03BA02 budesonid
7114572
R03BA02
budesonid
PULMICORT
TURBUHALER
prašak za inhalaciju
inhaler, 1 po 100 doza
(200 mcg/doza)
AstraZeneca AB
Švedska
925,60
800 mcg
37,02
35%
7114574
R03BA02
budesonid
PULMICORT
TURBUHALER
prašak za inhalaciju
inhaler, 1 po 100 doza
(400 mcg/doza)
AstraZeneca AB
Švedska
1.851,10
800 mcg
37,02
35%
INDIKACIJE
NAPOMENA
1. Bronhijalna astma (J45).
Lek se uvodi u terapiju na osnovu mišljenja pulmologa ili pneumoftiziologa ili alergologa ili imunologa ili interniste u službi pulmologije.
Lista A1 - Grupa R. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
7114722
7114721
ATC
INN
R03BA02 budesonid
R03BA02
R03BA02
INDIKACIJE
=DãWLüHQRLPH
leka
FO
Cena leka
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
Država
za
leka
leka
proizvodnje leka pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
budesonid
BUDELIN
NOVOLIZER
prašak za inhalaciju
Meda Pharma GmbH &
Co. KG; Meda
Manufacturing GmbH
1HPDþND
1HPDþND
1.303,20
800 mcg
26,06
35%
budesonid
BUDELIN
NOVOLIZER
Meda Pharma GmbH &
inhalator i uložak, 1 po
Co. KG; Meda
prašak za inhalaciju 200 doza (200 mcg/doza) Manufacturing GmbH
1HPDþND
1HPDþND
1.485,70
800 mcg
29,71
35%
uložak, 1 po 200 doza
(200 mcg/doza)
1. Bronhijalna astma (J45).
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja pulmologa ili pneumoftiziologa ili alergologa ili imunologa ili interniste u službi pulmologije.
R03BA08 ciklesonid
7114744
7114741
R03BA08
R03BA08
INDIKACIJE
ciklesonid
ciklesonid
VSUHMERþLFDVD
dozerom,1 po 60 doza
(160 mcg/doza)
ALVESCO 160
rastvor za inhalaciju
pod pritiskom
ALVESCO 80
sprej-boca sa dozerom, 1
rastvor za inhalaciju po 10 ml (120 doza po 80
pod pritiskom
mcg)
Nycomed GmbH
1HPDþND
1.741,60
0,16 mg
29,03
20%
Nycomed GmbH
1HPDþND
3.088,10
0,16 mg
51,47
20%
108,91
35%
1. Bronhijalna astma (J45).
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja pulmologa ili pneumoftiziologa ili alergologa ili imunologa ili interniste u službi pulmologije.
R03BB
Antiholinergici
R03BB04 tiotropium-bromid
7114730
R03BB04
tiotropium-bromid
SPIRIVA
prašak za inhalaciju,
tvrda kapsula
blister, 30 po 18 mcg
Boehringer Ingelheim
Pharma GmbH
1HPDþND
3.267,40
18 mcg
Lista A1 - Grupa R. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
7114732
ATC
R03BB04
INDIKACIJE
INN
tiotropijum-bromid
=DãWLüHQRLPH
leka
SPIRIVA RESPIMAT
FO
rastvor za inhalaciju
Cena leka
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
Država
za
leka
leka
proizvodnje leka pakovanje
uložak i inhaler, 1 po 60
potisaka (30 doza) (2.5
mcg/potisak)
Boehringer Ingelheim
Pharma GmbH & Co.
KG
1HPDþND
3.251,10
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
5 mcg
108,37
35%
+URQLþQDRSVWUXNWLYQDEROHVWSOXüDNRGRGUDVOLK]DXPHUHQRWHãNHWHãNHLYHRPDWHãNH,,,,,LOL,9VWDGLMXPREOLNHEROHVWL-
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja pulmologa ili pneumoftiziologa ili alergologa ili imunologa ili interniste u službi pulmologije.
R03D
'UXJLOHNRYL]DVLVWHPVNXSULPHQXXRSVWUXNWLYQLPSOXüQLPEROHVWLPD
R03DC
Antagonisti receptora leukotriena
R03DC03 montelukast
1114643
R03DC03
montelukast
SINGULAIR
film tableta
28 po 10 mg
Merck Sharp & Dohme
Holandija
1.856,40
10 mg
66,30
35%
1114554
R03DC03
montelukast
film tableta
blister, 28 po 10 mg
Alvogen d.o.o.
Republika Srbija
1.856,40
10 mg
66,30
35%
1114560
R03DC03
montelukast
ALVOKAST
MONTELUKAST
PHARMAS
tableta
blister, 28 po 10 mg
PharmaS d.o.o.
Republika Srbija
1.856,40
10 mg
66,30
35%
1114645
R03DC03
montelukast
TELUKA
film tableta
blister, 28 po 10 mg
Galenika a.d.
Republika Srbija
1.856,40
10 mg
66,30
35%
134,74
60%
INDIKACIJE
1. Bronhijalna astma (J45).
NAPOMENA
R03DX
R03DX07
/HNVHXYRGLXWHUDSLMXNDRGRGDWQDWHUDSLMDNDGDSULPHQDLQKDODFLRQLKNRUWLNRVWHURLGDQHREH]EHÿXMHRGJRYDUDMXüXNRQWUROXEROHVWL
Lek se uvodi u terapiju na osnovu mišljenja pulmologa ili pneumoftiziologa ili alergologa ili imunologa ili interniste u službi pulmologije.
2VWDOLOHNRYL]DVLVWHPVNXSULPHQXXRSVWUXNWLYQLPSOXüQLPEROHVWLPD
roflumilast
1119220
R03DX07
INDIKACIJE
roflumilast
DAXAS
film tableta
blister, 30 po 500 mcg
Nycomed GmbH
1HPDþND
4.042,10
0,5 mg
+URQLþQDRSVWUXNWLYQDEROHVWSOXüDNDRGRGDWQDWHUDSLMDNRGRGUDVOLK]DWHãNHLYHRPDWHãNH,,,LOL,9VWDGLMXPREOLNHEROHVWLVDþHVWLPHJ]DFHUEDFLMDPDGYH
ili više godišnje) (J44).
Lista A1 - Grupa R. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
NAPOMENA
R06
R06A
R06AX
R06AX13
3058293
3058282
R06AX13
R06AX13
INN
=DãWLüHQRLPH
leka
FO
loratadin
loratadin
LORATADIN
PRESSING
sirup
1 po 120 ml ( 5 mg/5 ml)
Jugoremedija a.d.
Republika Srbija
231,10
10 mg
19,26
50%
sirup
ERþLFDVWDNOHQDSR
ml (5 mg/5 ml)
Hemofarm a.d.
Republika Srbija
231,10
10 mg
19,26
50%
1 po 100 ml (1 mg/5 ml)
Galenika a.d.
Republika Srbija
154,60
2 mg
15,46
50%
1. Alergijski rinitis (J30.1-J30.4),
+URQLþQDYD]RPRWRUQDXUWLNDULMD/
NAPOMENA
R06AX17
Samo za decu stariju od 2 godine.
ketotifen
R06AX17
NAPOMENA
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
Lek se uvodi u terapiju na osnovu mišljenja pulmologa ili pneumoftiziologa ili alergologa ili imunologa ili interniste u službi pulmologije.
ANTIHISTAMINICI ZA SISTEMSKU PRIMENU
Antihistaminici za sistemsku primenu
Ostali antihistaminici za sistemsku upotrebu
loratadin
INDIKACIJE
3114450
Cena leka
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
Država
za
leka
leka
proizvodnje leka pakovanje
ketotifen
GALITIFEN
Samo za decu stariju od 2 godine.
sirup
Lista A1 - Grupa S. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
4090290
ATC
S
S01
S01A
S01AD
S01AD03
aciklovir
S01AD03
aciklovir
NAPOMENA
S01AX
S01AX11
INN
=DãWLüHQRLPHOHND
ZOVIRAX
FO
Cena leka
Država
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
za
leka
leka
leka
pakovanje
SENZORNI ORGANI - LEKOVI KOJI DELUJU NA OKO I UHO
LEKOVI KOJI DELUJU NA OKO
Antiinfektivi
Antivirusni lekovi
PDVW]DRþL
tuba, 1 po 4,5 g (30
mg/g)
Glaxo Operations UK
Limited
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
Velika Britanija
747,20
-
-
50%
Lek se uvodi u terapiju na osnovu mišljenja oftalmologa.
Ostali antiinfektivi
ofloksacin
7090852
S01AX11
ofloksacin
FLOXAL
NDSL]DRþL
1 po 5 ml (3 mg/ml)
Dr Gerhard Mann Chem.
Pharm. Fabrik GmbH
1HPDþND
247,30
-
-
75%
4090851
S01AX11
ofloksacin
FLOXAL
PDVW]DRþL
1 po 3 g (3 mg/g)
Dr Gerhard Mann Chem.
Pharm. Fabrik GmbH
1HPDþND
371,20
-
-
75%
Francuska;
1HPDþND
500,50
-
-
75%
6ORYDþND
Republika
470,80
-
-
75%
104,90
-
-
50%
1. Bakterijski keratitis ( H16 ),
2. Bakterijski konjuktivitis ( H10.0 ),
3. Bakterijski blefaritis ( H01.0).
INDIKACIJE
S01B
S01BC
S01BC01 indometacin
7099200
S01BC01
indometacin
Antiinflamatorni lekovi
Nesteroidni antiinflamatorni lekovi
INDOCOLLYRE
NDSL]DRþL
UNICLOPHEN 0.1%
NDSL]DRþL
rastvor
1 po 5 ml (1 mg/ml)
Laboratoire Chauvin S.A.;
Dr Gerhard Mann, Chem. Pharm. Fabrik GMBH
S01BC03 diklofenak
7099150
7090790
S01BC03
diklofenak
S01C
S01CA
S01CA01
deksametazon, neomicin
S01CA01
deksametazon,
neomicin
ERþLFDVDNDSDOMNRP
po 10 ml (0,1%)
Unimed Pharma S.R.O.
Antiinflamatorni lekovi u kombinaciji sa antiinfektivima
Kortikosteroidi i antiinfektivi u kombinaciji
DEXAMETHASONNEOMYCIN
NDSL]DXãLRþL
rastvor
ERþLFDVWDNOHQDPO
(0,1% + 0,35%)
Galenika a.d.
Republika Srbija
Lista A1 - Grupa S. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
ATC
INN
=DãWLüHQRLPHOHND
7090791
S01CA01
deksametazon,
neomicin
DEXAMETHASONNEOMYCIN
7090813
S01CA01
deksametazon,
neomicin
NEODEKSACIN
S01CA01
deksametazon, gentamicin
S01CA01
deksametazon,
gentamicin
4090921
DEXAMYTREX
FO
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Galenika a.d.
Republika Srbija
204,40
-
-
50%
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
NDSL]DXãLRþL ERþLFDVWDNOHQDPO
rastvor
(0,1% + 0,35%)
Cena leka Participacija
na veliko osiguranog
po DDD
lica
NDSL]DRþL
rastvor
ERþLFDPO
0,35%)
Hemomont d.o.o.
Republika Crna
Gora
204,40
-
-
50%
PDVW]DRþL
tuba, 1 po 3 g (0,3
mg/g + 5 mg/g)
Dr Gerhard Mann Chem.
Pharm. Fabrik GmbH
1HPDþND
260,20
-
-
50%
Lekovi u terapiji glaukoma i miotici
Adrenomimetici u terapiji glaukoma
S01E
S01EA
S01EA05
brimonidin
7094070
S01EA05
brimonidin
ALPHAGAN
NDSL]DRþL
rastvor
ERþLFDVDNDSDOMNRP Allergan Pharmaceuticals
po 5 ml 0,2%
Ireland
Irska
505,90
0,2 ml
20,24
40%
7094080
S01EA05
brimonidin
BRIMONAL 0,2%
NDSL]DRþL
rastvor
ERþLFDVDNDSDOMNRP
po 10 ml (0,2%)
Unimed Pharma S.R.O.
6ORYDþND
843,20
0,2 ml
16,86
25%
Irska
1.460,40
0,1 ml
48,68
35%
NAPOMENA
S01ED
S01ED51
7099090
S01ED51
INDIKACIJE
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja oftalmologa.
%HWDDGUHQHUJLþNLEORNDWRUL
timolol, bimatoprost
timolol,
bimatoprost
GANFORT
NDSL]DRþL
rastvor
ERþLFDVDNDSOMNRP
po 3 ml (5 mg/ml + 300 Allergan Pharmaceuticals
mcg/ml)
Ireland
=DOHþHQMHJODXNRPD+NDRGUXJDLOLWUHüDWHUDSLMVNDOLQLMD
=DOHþHQMHJODXNRPD+NRGREROHOLKNRGNRMLKMHUDQLMHGLMDJQRVWLNRYDQDEROHVWLNRMLVHYHüQDOD]HQDOHþHQMXNDRQDVWDYDNWHUDSLMHRYLPOHNRPQD
osnovu mišljenja oftalmologa.
Lek se uvodi u terapiju na osnovu mišljenja oftalmologa.
Lista A1 - Grupa S. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
JKL
7099145
ATC
S01EE
S01EE03
INN
bimatoprost
S01EE03
bimatoprost
=DãWLüHQRLPHOHND
LUMIGAN
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Analozi prostaglandina
NDSL]DRþL
rastvor
ERþLFDVDNDSDOMNRP Allergan Pharmaceuticals
po 3 ml, 0,01%
Ireland
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Irska
1.311,60
0,1 ml
Cena leka Participacija
na veliko osiguranog
po DDD
lica
43,72
25%
INDIKACIJE
=DOHþHQMHJODXNRPD+NDRGUXJDLOLWUHüDWHUDSLMVNDOLQLMDRGQRVQRSUYDLOLGUXJDNDGDSRVWRMLNRQWUDLQGLNDFLMDQDSULPHQXEHWDDGUHQHUJLþNLK
blokatora).
=DOHþHQMHJODXNRPD+NRGREROHOLKNRGNRMLKMHUDQLMHGLMDJQRVWLNRYDQDEROHVWLNRMLVHYHüQDOD]HQDOHþHQMXNDRQDVWDYDNWHUDSLMHRYLPOHNRPQD
osnovu mišljenja oftalmologa.
NAPOMENA
S01EE04
Lek se uvodi u terapiju na osnovu mišljenja oftalmologa.
travoprost
7099190
S01EE04
travoprost
TRAVATAN
NDSL]DRþL
rastvor
ERþLFDVDNDSDOMNRP
2,5 ml 40 mcg/ml
Alcon-Couvreur N.V.
Belgija
1.201,60
0,1 ml
48,06
35%
INDIKACIJE
=DOHþHQMHJODXNRPD+NDRGUXJDLOLWUHüDWHUDSLMVNDOLQLMDRGQRVQRSUYDLOLGUXJDNDGDSRVWRMLNRQWUDLQGLNDFLMDQDSULPHQXEHWDDGUHQHUJLþNLK
blokatora).
=DOHþHQMHJODXNRPD+NRGREROHOLKNRGNRMLKMHUDQLMHGLMDJQRVWLNRYDQDEROHVWLNRMLVHYHüQDOD]HQDOHþHQMXNDRQDVWDYDNWHUDSLMHRYLPOHNRPQD
osnovu mišljenja oftalmologa.
NAPOMENA
S01EE05
Lek se uvodi u terapiju na osnovu mišljenja oftalmologa.
tafluprost
7099195
S01EE05
tafluprost
SAFLUTAN
NDSL]DRþL
rastvor
kontejner jednodozni,
30 po 0,3 ml (15
mcg/ml)
Merck Sharp & Dohme
B.V.
Holandija
1.439,20
0,3 ml
47,97
35%
INDIKACIJE
=DOHþHQMHJODXNRPD+NDRGUXJDLOLWUHüDWHUDSLMVNDOLQLMDRGQRVQRSUYDLOLGUXJDNDGDSRVWRMLNRQWUDLQGLNDFLMDQDSULPHQXEHWDDGUHQHUJLþNLK
blokatora).
=DOHþHQMHJODXNRPD+NRGREROHOLKNRGNRMLKMHUDQLMHGLMDJQRVWLNRYDQDEROHVWLNRMLVHYHüQDOD]HQDOHþHQMXNDRQDVWDYDNWHUDSLMHRYLPOHNRPQD
osnovu mišljenja oftalmologa.
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja oftalmologa.
Lista A1 - Grupa V. Lekovi koji se propisuju i izdaju na obrascu lekarskog recepta
ŠIFRA
N002303
=DãWLüHQRLPH
leka
ATC
V
V06
V06D
V06DX
V06DX..
INN
bezglutensko brašno
V06DX..
bezglutensko brašno
MIX B I MIX C
BRAŠNO
FO
prašak
3DNRYDQMHLMDþLQD
Naziv
leka
SURL]YRÿDþDOHND
OSTALO
OPŠTI NUTRIJENSI
Ostali nutrijensi
Ostali nutrijensi
1 kg
Dr Schär GmbH
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Italija
585,00
-
INDIKACIJE
&HOLMDþQDEROHVW.
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja gastroenterologa ili gastroenterologa-pedijatra ili pedijatra u službi gastroenterologije.
/HNVHPRåHSURSLVDWLXNROLþLQLGRNJQDMHGDQOHNDUVNLUHFHSW]DSHULRGGRGDQD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
-
10%
/LVWD%*UXSD$/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
ATC
INN
A
A02
A02B
A02BA
A02BA02 ranitidin
Cena leka
Država
na veliko
Cena leka
=DãWLüHQRLPH
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
za
na veliko
leka
FO
leka
SURL]YRÿDþDOHND
leka
pakovanje
DDD
po DDD
$/,0(17$51,75$.7,0(7$%2/,=$0/(.29,=$/(ý(1M(%2/(67,',*(67,912*6,67(0$,0(7$%2/,=0$
/(.29,=$325(0(û$-($&,',7(7$
/HNRYL]DOHþHQMHSHSWLþNRJXONXVDLJDVWURH]RIDJXVQRJUHIOXNVD
Antagonisti H2 ( H2-histaminskih ) receptora
Participacija
osiguranog
lica
0128432
A02BA02
ranitidin
RANISAN
rastvor za
injekciju/infuziju
ampula, 5 po 5 ml (10
mg/1 ml)
Zdravlje a.d.
Republika Srbija
193,10
0,3 g
231,72
-
0128620
A02BA02
ranitidin
RANITIDIN
rastvor za
injekciju/infuziju
ampula, 5 po 2 ml (50
mg/2 ml)
Hemofarm a.d.
Republika Srbija
193,10
0,3 g
231,72
-
Portugalija
328,40
20 mg
164,20
-
A02BC
A02BC01 omeprazol
0122120
A02BC01
omeprazol
Inhibitori protonske pumpe
OMEPROL
prašak za rastvor za
infuziju
ERþLFDSRPJ
Sofarimex-Industria
Quimica E
Farmaceutica, LDA
INDIKACIJE
67$&=DOHþHQMHDNXWQRJQHYDULNVQRJNUYDUHQMDVDRJUDQLþHQMHPGRWULGDQDSUYLGDQGRDPSXODDVOHGHüDGYDGDQDGRDPSXOHQDGDQ
A02BC02 pantoprazol
0122751
0122927
0122928
A02BC02
A02BC02
A02BC02
pantoprazol
pantoprazol
pantoprazol
CONTROLOC
prašak za rastvor za
injekciju
1 po 40 mg
Nycomed GmbH
1HPDþND
345,70
40 mg
345,70
-
Španija;
Slovenija
345,70
40 mg
345,70
-
Španija;
Slovenija
1.728,50
40 mg
345,70
-
NOLPAZA
prašak za rastvor za
injekciju
ERþLFDVWDNOHQDSR
40 mg
Laboratorios Alcala
Farma S.L.; Krka
Tovarna Zdravil d.d.
NOLPAZA
prašak za rastvor za
injekciju
ERþLFDVWDNOHQDSR
40 mg
Laboratorios Alcala
Farma S.L.; Krka
Tovarna Zdravil d.d.
INDIKACIJE
67$&=DOHþHQMHDNXWQRJQHYDULNVQRJNUYDUHQMDVDRJUDQLþHQMHPGRWULGDQDSUYLGDQGRDPSXODDVOHGHüDGYDGDQDGRDPSXOHQDGDQ
A02BC05 esomeprazol
0122812
A02BC05
esomeprazol
NEXIUM
prašak za rastvor za
injekciju/infuziju
ERþLFDVWDNOHQDSR
40 mg
AstraZeneca AB
Švedska
541,30
30 mg
405,98
-
/LVWD%*UXSD$/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0122813
ATC
A02BC05
INN
esomeprazol
=DãWLüHQRLPH
leka
NEXIUM
FO
prašak za rastvor za
injekciju/infuziju
3DNRYDQMHLMDþLQD
Naziv
leka
SURL]YRÿDþDOHND
ERþLFDVWDNOHQDSR
40 mg
AstraZeneca AB
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
Švedska
5.412,70
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
30 mg
405,95
-
INDIKACIJE
67$&=DOHþHQMHDNXWQRJQHYDULNVQRJNUYDUHQMDVDRJUDQLþHQMHPGRWULGDQDSUYLGDQGRDPSXODDVOHGHüDGYDGDQDGRDPSXOHQDGDQ
/(.29,.2-,5(*8/,â8)81.&,21$/1(*$6752,17(67,1$/1(325(0(û$-(
A03
Alkaloidi beladone i derivati, monokomponentni
A03B
A03BB
Alkaloidi beladone, polusintetski, kvaternerna amonijum jedinjenja (kvaternerni amini)
A03BB01 hioscin-butilbromid
0123140
A03BB01
hioscin-butilbromid BUSCOPAN
rastvor za injekciju
1123141
A03BB01
hioscin-butilbromid BUSCOPAN
obložena tableta
5123143
A03BB01
hioscin-butilbromid BUSCOPAN
supozitorija
ampula, 6 po 1 ml (20 Boehringer Ingelheim
mg/1 ml)
Espana S.A.
Španija
193,90
60 mg
96,95
-
blister, 20 po 10 mg
Boehringer Ingelheim
France
Francuska
301,30
60 mg
90,39
-
strip, 6 po 10 mg
Istituto De Angeli
S.R.L.
Italija
211,40
60 mg
211,40
-
Republika Srbija
111,20
о
о
-
Republika Srbija
169,90
30 mg
50,97
-
Spazmolitici u kombinaciji sa analgeticima
A03D
A03DA
Sintetski antiholinergici u kombinaciji sa analgeticima
A03DA02 pitofenon, fenpiverinijum-bromid, metamizol-natrijum
0123560
0124302
A03DA02
pitofenon,
fenpiverinijumbromid, metamizolnatrijum
BARALGETAS
A03F
A03FA
A03FA01
metoklopramid
A03FA01
metoklopramid
rastvor za injekciju
ampula, 5 po 5 ml (10
mg + 0,1 mg +
2500mg)
Jugoremedija a.d.
Propulzivi
Propulzivi
KLOMETOL
rastvor za injekciju
ampula,10 po 10 mg/2
ml
Galenika a.d.
/LVWD%*UXSD$/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0124530
ATC
INN
A04
A04A
A04AA
A04AA01 ondansetron
A04AA01
ondansetron
=DãWLüHQRLPH
leka
ONDASAN
FO
rastvor za injekciju
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
ANTIEMETICI I SREDSTVA PROTIV NAUZEJE
Antiemetici i sredstva protiv nauzeje
Antagonisti serotonina (5HT3)
ampula, 5 po 4 mg/2
ml
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
Slaviamed d.o.o.
Republika Srbija
1.585,40
16 mg
1.268,32
-
NAPOMENA
/HNVHXYRGLXWHUDSLMXNRGSRYUDüDQMDX]KHPLRLOLUDGLRWHUDSLMX
A04AA02 granisetron
0124584
0124573
0124570
A04AA02
A04AA02
A04AA02
granisetron
KYTRIL
koncentrat za rastvor
za injekciju/infuziju
ampula, 5 po 1 mg/1
ml
F. Hoffmann-La
Roche Ltd.
Švajcarska
2.030,00
3 mg
1.218,00
-
granisetron
GRANISETRONTEVA
koncentrat za rastvor
za injekciju/infuziju
ampula, 5 po 1 ml, 1
mg/1 ml
Teva Pharmaceutical
Works Private Ltd.
Company
0DÿDUVND
2.030,00
3 mg
1.218,00
-
granisetron
GRANISETRONTEVA
koncentrat za rastvor
za injekciju/infuziju
ampula, 5 po 3 ml, 3
mg/3 ml
Teva Pharmaceutical
Works Private Ltd.
Company
0DÿDUVND
3.213,30
3 mg
642,66
-
5.055,10
0,25 mg
5.055,10
-
NAPOMENA
67$&/HNVHXYRGLXWHUDSLMXNRGSRYUDüDQMDX]KHPLRLOLUDGLRWHUDSLMX
A04AA05 palonosetron
0124574
A04AA05
palonosetron
ALOXI
rastvor za injekciju
Helsinn Birex
ERþLFDVWDNOHQDSR Pharmaceuticals Ltd; Irska; Republika
ml (0,25 mg/5 ml)
PharmaSwiss d.o.o.
Srbija
67$&3UHYHQFLMDDNXWQHLRGORåHQHPXþQLQHLSRYUDüDQMDNRGRGUDVOLKNRMLVXSRYH]DQLVDL]UD]LWRHPHWRJHQRPKHPLRWHUDSLMRPNDUFLQRPD]DVQRYDQRP
NAPOMENA
na cisplatinu u toku tri dana hemioterapije kod svakog ciklusa.
Ostali antiemetici
A04AD
A04AD12 aprepitant
1124587
A04AD12
NAPOMENA
aprepitant
EMEND
kapsula, tvrda
blister, 1 po 125 mg, 2
po 80 mg
Merck Sharp &
Dohme B.V.
Holandija
5.777,00
95 mg
1.925,67
67$&3UHYHQFLMDDNXWQHLRGORåHQHPXþQLQHLSRYUDüDQMDNRGRGUDVOLKNRMLVXSRYH]DQLVDL]UD]LWRHPHWRJHQRPKHPLRWHUDSLMRPNDUFLQRPD]DVQRYDQRP
na cisplatinu u toku tri dana hemioterapije kod svakog ciklusa.
/LVWD%*UXSD$/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0127452
ATC
A05
A05B
A05BA
A05BA..
INN
ornitinaspartat
A05BA..
ornitinaspartat
=DãWLüHQRLPH
leka
HEPA-MERZ
Cena leka
Država
na veliko
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
za
FO
leka
SURL]YRÿDþDOHND
leka
pakovanje
7(5$3,-$%2/(67,ä8ý1,+387(9$%,/,-$512*75$.7$,-(75(
Terapija bolesti jetre, lipotropni lekovi
Preparati u terapiji bolesti jetre
rastvor za infuziju
NAPOMENA
STAC
A06
A06A
A06AB
A06AB02 bisakodil
5125072
A06AB02
bisakodil
A06AD65
NAPOMENA
A07
A07E
A07EC
A07EC02
5129473
A07EC02
makrogol 4000
Merz Pharma GmbH
Participacija
osiguranog
lica
1HPDþND
6.406,20
-
-
-
Italija
275,90
10 mg
45,98
-
Francuska
728,10
-
-
-
1,5 g
166,91
-
50 mg
19,05
-
LAKSATIVI
Laksativi
Kontaktni laksativi
DULCOLAX
supozitorija
blister, 6 po 10 mg
Istituto De Angeli
S.R.L.
Osmotski laksativi
A06AD
A06AD65 makrogol 4000
3125300
10 po (5 g/10 ml)
DDD
Cena leka
na veliko
po DDD
FORTRANS
prašak za oralni rastvor
kesica, 4 po 74 g
Beaufour Ipsen
Industrie
STAC; Hospitalna priprema pacijenata za kolonoskopiju i irigografiju.
ANTIDIJAROICI, INTESTINALNI ANTIINFLAMATORNI / ANTIINFEKTIVNI LEKOVI
Intestinalni antiinflamatorni lekovi
$PLQRVDOLFLOQDNLVHOLQDLVOLþQLOHNRYL
mesalazin
mesalazin
SALOFALK
rektalna suspenzija
ERþLFDSRPO
g/60 ml)
Dr Falk Pharma
GmbH
1HPDþND
3.115,60
INDIKACIJE
/HþHQMHXOFHUR]QRJNROLWLVD.NDRPRQRWHUDSLMDLOLXNRPELQDFLMLVDNRUWLNRVWHURLGRP
A11
VITAMINI
A11D
Vitamin B1 monokomponentni i u kombinaciji sa vitaminima B6 i B12
A11DA
Vitamin B1, monokomponentni
A11DA01 tiamin (aneurin, vitamin B1)
0051750
A11DA01
tiamin
VITAMIN B1
ALKALOID
rastvor za injekciju
ampula, 50 po 1 ml
(100 mg/1 ml)
Alkaloid a.d.
Republika
Makedonija
1.905,10
/LVWD%*UXSD$/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0052184
INN
=DãWLüHQRLPH
leka
ATC
A11E
A11EA
A11EA..
vitamini B-kompleksa
A11EA..
vitamini Bkompleksa
BEVIPLEX
FO
A11GA01
askorbinska
kiselina
VITAMIN C
5 po 2 ml (40 mg + 4
mg +8 mg + 100 mg +
10 mg +0,004 mg)
injekcija
injekcija
A11H
A11HA
A11HA02 piridoksin (vitamin B6)
0051351
0050150
0050151
A11HA02
piridoksin (vitamin
B6)
BEDOXIN
Republika Srbija
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
437,40
-
-
-
50 po 500 mg/5 ml
Galenika a.d.
Republika Srbija
1.783,30
0,2 g
14,27
-
616,00
0,16 g
39,42
-
Ostali monokomponentni vitaminski preparati
Ostali monokomponentni vitaminski preparati
injekcija
50 po 50 mg/2 ml
Galenika a.d.
Republika Srbija
Ostali vitaminski proizvodi, kombinacije
Kombinacije vitamina
A11J
A11JA
A11JA..
retinol, fitomenadion, ergokalciferol, tokoferol
A11JA..
retinol,
fitomenadion,
ergokalciferol,
tokoferol
A11JA..
retinol,
fitomenadion,
ergokalciferol,
tokoferol
INDIKACIJE
Galenika a.d.
Cena leka
na veliko
za
pakovanje
$VNRUELQVNDNLVHOLQDYLWDPLQ&XNOMXþXMXüLNRPELQDFLMH
Askorbinska kiselina (vitamin C), monokomponentni
A11G
A11GA
A11GA01 askorbinska kiselina
0051845
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
9LWDPLQL%NRPSOHNVDXNOMXþXMXüLNRPELQDFLMH
Vitamini B kompleksa, ostale kombinacije
ampula, 10 po 10 ml
(135,3 mcg/ml + 20
mcg/ml + 1 mcg/ml +
0,64 mg/ml)
VITALIPID N
INFANT
koncentrat za emulziju
za infuziju
VITALIPID N
ADULT
ampula, 10 po 10 ml
(194,1 mcg/ml + 15
koncentrat za emulziju mcg/ml + 0,5 mcg/ml +
za infuziju
0,91 mg/ml)
Fresenius Kabi AB
Švedska
2.750,80
-
-
-
Fresenius Kabi AB
Švedska
2.187,80
-
-
-
'HILFLWOLSRVROXELOQLKYLWDPLQD$'(.X]URNRYDQUD]OLþLWLPREROMHQMLPDNRMLXRVQRYLLPDMXPDODSVRUSFLMXLOLPDOQXWULFLMX.,QIDQWVDPRNRGGHFHGR
11 godina starosti.
/LVWD%*UXSD$/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
1174015
A16AA..
Cena leka
Država
na veliko
Cena leka Participacija
=DãWLüHQRLPH
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
za
na veliko osiguranog
INN
leka
FO
leka
SURL]YRÿDþDOHND
leka
pakovanje
DDD
po DDD
lica
OSTALI PROIZVODI KOJI DELUJU NA BOLESTI DIGESTIVNOG SISTEMA I METABOLIZAM
Ostali proizvodi koji deluju na bolesti digestivnog sistema i metabolizam
Amino kiseline i derivati
alfa-okso-(R,S)-izoleucin, kalcijumova so, alfa-okso-leucin, kalcijumova so, alfa-okso-fenilalanin, kalcijumova so, alfa-okso-valin, kalcijumova so, alfa-hidroksi(R,S)-metionin, kalcijumova so, lizin, treonin, triptofan, histidin, tirozin
A16AA..
alfa-okso-(R,S)izoleucin,
kalcijumova so,
alfa-okso-leucin,
kalcijumova so,
alfa-oksofenilalanin,
kalcijumova so,
alfa-okso-valin,
kalcijumova so,
alfa-hidroksi-(R,S)metionin,
kalcijumova so,
lizin, treonin,
triptofan, histidin,
tirozin
KETOSTERIL
ATC
A16
A16A
A16AA
INDIKACIJE
film tableta
Fresenius Kabi
Deutschland GmbH
blister, 100 po (67 mg
Beijng; Fresenius
+ 101 mg + 68 mg + 86 Kabi Pharmaceutical
mg + 59 mg + 75 mg + Co. Ltd; Labesfal53 mg + 23 mg + 38
Laboratorios Almiro
mg + 30 mg
S.A.
1HPDþND.LQD
Portugalija
6.269,30
-
-
-
3UHYHQFLMDLWHUDSLMDRãWHüHQMDQDVWDOLKXVOHGSRUHPHüDMDPHWDEROL]PDSURWHLQDXKURQLþQRMEXEUHåQRMLQVXILFLMHQFLMLX]VPDQMHQLXQRVSURWHLQDSXWHPKUDQH
RGJGDQ]DRGUDVOHLPDQMHWMNRGSDFLMHQDWDVDEU]LQRPJORPHUXODUQHILOWUDFLMH*)5L]PHÿXLPOPLQ1HRSKRGQDMHSULPHQD.HWRVWHULOWDEOHWDVYH
dok je GFR ispod 25 ml/min.
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
Participacija
Cena leka na osiguranog
veliko po DDD
lica
ATC
B
B01
B01A
B01AB
B01AB01
heparin
0062035
B01AB01
heparin
HEPARIN
rastvor za injekciju
ampula, 5 po 5000
i.j./0,25 ml
Galenika a.d.
Republika Srbija
359,00
10000 i.j.
143,60
-
0062036
B01AB01
heparin
HEPARIN
rastvor za injekciju
ampula, 5 po 5000 i.j./1
ml
Galenika a.d.
Republika Srbija
359,00
10000 i.j.
143,60
-
rastvor za injekciju
ampula, 10 po 25000
i.j./5 ml
Galenika a.d.
Republika Srbija
2.907,50
10000 i.j.
116,30
-
1 po 10 ml (500 i.j./10
ml)
Baxter AG
Austrija
24.321,30
2100 i.j.
102.149,46
-
1 po 20 ml (1000 i.j./20
ml)
Baxter AG
Austrija
48.642,30
2100 i.j.
102.148,83
-
1HPDþND
24.321,30
2100 i.j.
102.149,46
-
rastvor za injekciju
napunjen injekcioni
špric,10 po 2500 i.j./0.2 Pfizer Manufacturing
ml
Belgium NV
Belgija
1.578,10
2500 i.j.
157,81
-
rastvor za injekciju
napunjen injekcioni
špric,10 po 5000 i.j./0.2 Pfizer Manufacturing
ml
Belgium NV
Belgija
2.923,90
2500 i.j.
146,20
-
0062037
INN
Država
Cena leka na
=DãWLüHQRLPH
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
veliko za
leka
FO
leka
SURL]YRÿDþDOHND
leka
pakovanje
DDD
.59,.59279251,25*$1,/(.29,=$/(ý(1M(%2/(67,.59,,.59279251,+25*$1$
$17,7520%27,ý.$65('679$$17,.2$*8/$16,
$QWLWURPERWLþNDVUHGVWYDDQWLNRDJXODQVL
Heparinska grupa
B01AB01
heparin
B01AB02
antitrombin III
HEPARIN
0062161
B01AB02
antitrombin III
ANTITROMBIN III
BAXTER
0062162
B01AB02
antitrombin III
ANTITROMBIN III
BAXTER
SUDãDNLUDVWYDUDþ
za rastvor za
infuziju
SUDãDNLUDVWYDUDþ
za rastvor za
infuziju
KYBERNIN P 500
SUDãDNLUDVWYDUDþ
za rastvor za
OLRERþLFDVD
injekciju/infuziju UDVWYDUDþHPSRLM CSL Behring GmbH
0062170
B01AB02
INDIKACIJE
B01AB04
0062210
0062211
B01AB04
B01AB04
antitrombin III
3URILODNVDLOHþHQMHWURPERHPEROLMVNLKNRPSOLNDFLMDXURÿHQRJQHGRVWDWNDDQWLWURPELQD,,,
dalteparin
dalteparin- natrijum
dalteparin- natrijum
FRAGMIN
FRAGMIN
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0062212
ATC
B01AB04
INDIKACIJE
B01AB05
0062200
0062201
0062202
B01AB05
B01AB05
B01AB05
INN
dalteparin- natrijum
=DãWLüHQRLPH
leka
FRAGMIN
FO
rastvor za
injekciju/infuziju
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
napunjen injekcioni
špric,10 po 10000 i.j./1
ml
Pfizer Manufacturing
Belgium NV
Belgija
Cena leka na
veliko za
pakovanje
DDD
4.546,40
2500 i.j.
Participacija
Cena leka na osiguranog
veliko po DDD
lica
113,66
-
3UHLSRVWRSHUDWLYQDSURILODNVDWURPERHPEROLMHNRGYLVRNRUL]LþQLKKLUXUãNLKLQWHUYHQFLMDXNXSQRGRGDQD
/HþHQMHWURPER]DGXERNLKYHQDXDPEXODQWQLPXVORYLPDGRSRVWL]DQMDWHUDSLMVNRJ,15X]SDUDOHOQXSULPHQXRUDOQLKDQWLNRDJXODQDVDQDSUHGORJ
VSHFLMDOLVWHXEROQLþNLPXVORYLPDLGXåHX]DYLVQRVWLRGSURFHQHRGJRYDUDMXüHJVSHFLMDOLVWH
3URILODNVDNRGEROHVQLNDVD]QDþDMQRSRYHüDQLPUL]LNRPRGQDVWDQNDYHQVNHWURPERHPEROLMHNRMLVXSULYUHPHQRLPRELOL]LUDQL]ERJDNXWQHEROHVWL]DWDMLYDQMD
srca, respiratorne insuficijencije, teških infekcija)
/HþHQMHQHVWDELOQHDQJLQHSHNWRULVQRQ4LQIDUNWDPLRNDUGDLXVNORSXSURWRNRODSHUNXWDQLKNRURQDUQLKLQWHUYHQFLMD3&,37&$
3URILODNVDYHQVNHWURPERHPEROLMVNHEROHVWLNRGWUXGQLFDVDYLVRNLPUL]LNRPWRNRPWUXGQRüHLQHGHOMDSRVWSDUWDOQR3URILODNVDSRQRYOMHQLKJXELWDNDSORGDNRG
WUXGQLFDVDSUHWKRGQLPKDELWXDOQLPSREDþDMLPDLXWYUÿHQLPQDVOHGQRPWURPERILOLMRPLOLDQWLIRVIROLSLGQLPVLQGURPRP
enoksaparin
enoksaparin
enoksaparin
enoksaparin
CLEXANE
CLEXANE
CLEXANE
napunjen injekcioni špric,
2 po 20 mg (2000 i.j./0,2
rastvor za injekciju
ml)
Sanofi Winthrop
Industrie; Chinoin
Pharmaceutical
Chemical Works
Co.Ltd.
Francuska;
0DÿDUVND
403,80
2000 i.j.
201,90
-
napunjen injekcioni špric,
2 po 40 mg (4000 i.j./0,4
rastvor za injekciju
ml)
Sanofi Winthrop
Industrie; Chinoin
Pharmaceutical
Chemical Works
Co.Ltd.
Francuska;
0DÿDUVND
743,70
2000 i.j.
185,93
-
napunjen injekcioni špric,
2 po 60 mg (6000 i.j./0,6
rastvor za injekciju
ml)
Sanofi Winthrop
Industrie; Chinoin
Pharmaceutical
Chemical Works
Co.Ltd.
Francuska;
0DÿDUVND
981,60
2000 i.j.
163,60
-
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0062203
ATC
B01AB05
INDIKACIJE
B01AB06
0062300
0062400
0062302
B01AB06
B01AB06
B01AB06
INDIKACIJE
INN
enoksaparin
=DãWLüHQRLPH
leka
CLEXANE
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
napunjen injekcioni špric,
2 po 80 mg (8000 i.j./0,8
rastvor za injekciju
ml)
Sanofi Winthrop
Industrie; Chinoin
Pharmaceutical
Chemical Works
Co.Ltd.
Francuska;
0DÿDUVND
Cena leka na
veliko za
pakovanje
DDD
1.114,40
2000 i.j.
Participacija
Cena leka na osiguranog
veliko po DDD
lica
139,30
-
3UHLSRVWRSHUDWLYQDSURILODNVDWURPERHPEROLMHNRGYLVRNRUL]LþQLKKLUXUãNLKLQWHUYHQFLMDXNXSQRGRGDQD
/HþHQMHWURPER]DGXERNLKYHQDXDPEXODQWQLPXVORYLPDGRSRVWL]DQMDWHUDSLMVNRJ,15X]SDUDOHOQXSULPHQXRUDOQLKDQWLNRDJXODQDVDQDSUHGORJ
VSHFLMDOLVWHXEROQLþNLPXVORYLPDLGXåHX]DYLVQRVWLRGSURFHQHRGJRYDUDMXüHJVSHFLMDOLVWH
3URILODNVDNRGEROHVQLNDVD]QDþDMQRSRYHüDQLPUL]LNRPRGQDVWDQNDYHQVNHWURPERHPEROLMHNRMLVXSULYUHPHQRLPRELOL]LUDQL]ERJDNXWQHEROHVWL]DWDMLYDQMD
srca, respiratorne insuficijencije, teških infekcija)
/HþHQMHQHVWDELOQHDQJLQHSHNWRULVQRQ4LQIDUNWDPLRNDUGDLXVNORSXSURWRNRODSHUNXWDQLKNRURQDUQLKLQWHUYHQFLMD3&,37&$
3URILODNVDYHQVNHWURPERHPEROLMVNHEROHVWLNRGWUXGQLFDVDYLVRNLPUL]LNRPWRNRPWUXGQRüHLQHGHOMDSRVWSDUWDOQR3URILODNVDSRQRYOMHQLKJXELWDNDSORGDNRG
WUXGQLFDVDSUHWKRGQLPKDELWXDOQLPSREDþDMLPDLXWYUÿHQLPQDVOHGQRPWURPERILOLMRPLOLDQWLIRVIROLSLGQLPVLQGURPRP
8OHþHQMXSDFLMHQDWDVDDNXWQLPLQIDUNWRPPLRNDUGDVDHOHYDFLMRP67VHJPHQWD67(0,
nadroparin
nadroparin kalcijum
nadroparin kalcijum
nadroparin kalcijum
FRAXIPARINE
napunjen injekcioni špric,
10 po 0,3 ml (2850
rastvor za injekciju
i.j./0,3 ml)
Glaxo Wellcome
Production
Francuska
1.793,90
2850 i.j.
179,39
-
FRAXIPARINE
napunjen injekcioni špric,
10 po 0,4 ml (3800
rastvor za injekciju
i.j./0,4 ml)
Glaxo Wellcome
Production
Francuska
1.853,60
2850 i.j.
139,02
-
FRAXIPARINE
napunjen injekcioni špric,
10 po 0,6 ml (5700
rastvor za injekciju
i.j./0,6 ml)
Glaxo Wellcome
Production
Francuska
2.693,60
2850 i.j.
134,68
-
3UHLSRVWRSHUDWLYQDSURILODNVDWURPERHPEROLMHNRGYLVRNRUL]LþQLKKLUXUãNLKLQWHUYHQFLMDXNXSQRGRGDQD
/HþHQMHWURPER]DGXERNLKYHQDXDPEXODQWQLPXVORYLPDGRSRVWL]DQMDWHUDSLMVNRJ,15X]SDUDOHOQXSULPHQXRUDOQLKDQWLNRDJXODQDVDQDSUHGORJ
VSHFLMDOLVWHXEROQLþNLPXVORYLPDLGXåHX]DYLVQRVWLRGSURFHQHRGJRYDUDMXüHJVSHFLMDOLVWH
3URILODNVDNRGEROHVQLNDVD]QDþDMQRSRYHüDQLPUL]LNRPRGQDVWDQNDYHQVNHWURPERHPEROLMHNRMLVXSULYUHPHQRLPRELOL]LUDQL]ERJDNXWQHEROHVWL]DWDMLYDQMD
srca, respiratorne insuficijencije, teških infekcija)
/HþHQMHQHVWDELOQHDQJLQHSHNWRULVQRQ4LQIDUNWDPLRNDUGDLXVNORSXSURWRNRODSHUNXWDQLKNRURQDUQLKLQWHUYHQFLMD3&,37&$
3URILODNVDYHQVNHWURPERHPEROLMVNHEROHVWLNRGWUXGQLFDVDYLVRNLPUL]LNRPWRNRPWUXGQRüHLQHGHOMDSRVWSDUWDOQR3URILODNVDSRQRYOMHQLKJXELWDNDSORGDNRG
WUXGQLFDVDSUHWKRGQLPKDELWXDOQLPSREDþDMLPDLXWYUÿHQLPQDVOHGQRPWURPERILOLMRPLOLDQWLIRVIROLSLGQLPVLQGURPRP
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0064052
ATC
B01AD
B01AD01
streptokinaza
B01AD01
streptokinaza
NAPOMENA
B01AD02
0064130
B01AD02
NAPOMENA
B01AD11
0064060
B01AD11
B01AE
B01AE07
1069615
1069613
B01AE07
B01AE07
INN
=DãWLüHQRLPH
leka
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
Enzimi
ERþLFDVWDNOHQDSR
1500000 i.j.
Cena leka na
veliko za
pakovanje
DDD
1HPDþND
11.879,70
1,5 Mi.j.
11.879,70
-
Participacija
Cena leka na osiguranog
veliko po DDD
lica
STREPTASE
prašak za rastvor
za injekciju/infuziju
ACTILYSE
SUDãDNLUDVWYDUDþ
OLRERþLFDVD
Boehringer
za rastvor za
UDVWYDUDþHPSRPO Ingelheim Pharma
injekciju/infuziju
(50 mg/50 ml)
GmbH & Co. KG
1HPDþND
45.502,90
0,1 g
91.005,80
-
METALYSE
SUDãDNLUDVWYDUDþ OLRERþLFDVDUDVWYDUDþHP
Boehringer
za rastvor za
u špricu, 1 po 10 ml (50 Ingelheim Pharma
injekciju
mg/10 ml)
GmbH & Co. KG
1HPDþND
107.562,00
40 mg
86.049,60
-
CSL Behring GmbH
STAC
alteplaza
alteplaza
STAC
tenekteplaza
tenekteplaza
Inhibitori agregacije trombocita, direktni
dabigatraneteksilat
dabigatraneteksilat
dabigatraneteksilat
PRADAXA
PRADAXA
kapsula, tvrda
kapsula, tvrda
blister, 10 po 75 mg
Boehringer
Ingelheim Pharma
GmbH & Co. KG
1HPDþND
1.421,20
220 mg
416,89
-
blister, 10 po 110 mg
Boehringer
Ingelheim Pharma
GmbH & Co. KG
1HPDþND
1.430,60
220 mg
286,12
-
INDIKACIJE
Prevencija venske tromboembolije kod odraslih pacijenata koji se podvrgavaju elektivnom hirurškom zahvatu zamene kuka ili kolena.
NAPOMENA
STAC
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0062420
ATC
B01AX
B01AX05
B01AX05
INDIKACIJE
B01AX06
1069600
B01AX06
INN
=DãWLüHQRLPH
leka
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
2VWDODDQWLWURPERWLþNDVUHGVWYDDQWLNRDJXODQVL
Cena leka na
veliko za
pakovanje
DDD
4.739,40
2,5mg
fondaparinuks-natrijum
fondaparinuks-natrijum ARIXTRA
napunjen injekcioni špric,
10 po 0,5 ml (2,5 mg/0,5
rastvor za injekciju
ml)
Glaxo Wellcome
Production
Francuska
rivaroksaban
XARELTO
film tableta
blister, 10 po 10 mg
Bayer Healthcare
AG
1HPDþND
2.861,60
10 mg
Prevencija venske tromboembolije kod odraslih pacijenata koji se podvrgavaju elektivnom hirurškom zahvatu zamene kuka ili kolena.
NAPOMENA
B02
B02A
B02AA
B02AA02
STAC
B02AA02
INDIKACIJE
B02B
B02BA
B02BA01
0050970
B02BA01
473,94
-
1. Nestabilna angina ili infarkt miokarda bez elevacije ST segmenta (UA/NSTEMI) kod pacijenata kod kojih nije indikovano urgentno (manje 120 minuta) invazivno
OHþHQMH3&,
,QIDUNWPLRNDUGDVDHOHYFLMRP67VHJPHQWD67(0,NRGSDFLMHQDWDNRMLVHOHþHWURPEROLWLFLPDLOLNRMLXSRþHWNXQHVPHMXGDGRELMXGUXJLREOLNUHSHUIX]LYQH
terapije.
rivaroksaban
INDIKACIJE
0065040
Participacija
Cena leka na osiguranog
veliko po DDD
lica
286,16
-
195,88
-
ANTIHEMORAGICI
Antifibrinolitici
Aminokiseline
traneksaminska kiselina
traneksaminska
kiselina
TRANEXAMIC
MEDOCHEMIE
rastvor za
injekciju/infuziju
ampula, 10 po 5 ml (500
mg/5 ml)
Medochemie Ltd.
Kipar
489,70
2g
/RNDOQDILEULQROL]DNUDWNRWUDMQDSULPHQDXSURILODNVLLOHþHQMXNRGSDFLMHQDWDNRMLVXSRGYHOLNLPUL]LNRPRGNUYDUHQMDWRNRPLSRVOHRSHUDFLMHNRG
prostatektomije, konizacije cerviksa i hirurških procedura i dentalnih ekstrakcija kod bolesnika sa hemofilijom;
6LVWHPVNDILEULQROL]DKHPRUDJLMVNHNRPSOLNDFLMHSRYH]DQHVDWURPEROLWLþNRPWHUDSLMRPLNUYDUHQMHSRYH]DQRVDGLVHPLQRYDQRPLQWUDYDVNXODUQRPNRDJXODFLMRP
NRGNRMHMHSUHGRPLQDQWQDDNWLYDFLMDILEULQROLWLþNRJVLVWHPD
Vitamin K
fitomenadion (vitamin K1)
fitomenadion (vitamin
K1)
KONAKION MM
rastvor za injekciju
ampula, 5 po 10 mg/1
ml
F. Hoffmann-La
Roche Ltd.
Švajcarska
217,80
20 mg
87,12
-
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0050974
9067081
9067082
ATC
B02BA01
0066013
0066102
rastvor za injekciju
ampula, 5 po 2 mg/0,2
ml
F. Hoffmann-La
Roche Ltd.
Cena leka na
veliko za
pakovanje
DDD
Švajcarska
263,70
20 mg
527,40
-
Participacija
Cena leka na osiguranog
veliko po DDD
lica
fibrinski lepak ( fibrinogen, aprotinin, trombin, kalcijum hlorid )
B02BC30
fibrinogen, koagulacioni
faktor XIII, humani,
aprotinin, trombin,
BERIPLAST P
kalcijum hlorid
Combi-Set 1ml
ERþLFDSRPO
SUDãDNLUDVWYDUDþ mg+ 60 U + 1000 KIU +
za lepak za tkivo
500 i.j.+ 5,9 mg)/ml
CSL Behring GmbH
1HPDþND
10.539,60
-
-
-
B02BC30
fibrinogen, koagulacioni
faktor XIII, humani,
aprotinin, trombin,
BERIPLAST P
kalcijum hlorid
Combi-Set 3ml
ERþLFDSRPO
SUDãDNLUDVWYDUDþ mg+ 180 U + 3000 KIU +
za lepak za tkivo
1500 i.j.+ 17,7 mg)/3 ml CSL Behring GmbH
1HPDþND
30.916,30
-
-
-
1 po 5 ml (50 i.j./ml)
Octapharma
Pharmazeutika
Produktionsges
m.b.H
Austrija
13.863,80
500 i.j.
27.727,60
-
1 po 10 ml (100 i.j./ml)
Octapharma
Pharmazeutika
Produktionsges
m.b.H
Austrija
50.614,40
500 i.j.
25.307,20
-
Austrija
25.413,30
500 i.j.
25.413,30
-
Italija
25.413,30
500 i.j.
25.413,30
-
B02BD02
B02BD02
NAPOMENA
B02BD02
0066012
KONAKION MM
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
B02BC
B02BC30
NAPOMENA
B02BD
B02BD02
0066014
INN
fitomenadion (vitamin
K1)
=DãWLüHQRLPH
leka
Lokalni hemostatici
STAC
Faktori koagulacije krvi
koagulacioni faktor VIII (antihemofilni faktor VIII)
koagulacioni faktor VIII
(antihemofilni faktor
VIII)
OCTANATE 250
koagulacioni faktor VIII
(antihemofilni faktor
VIII)
OCTANATE 1000
SUDãDNLUDVWYDUDþ
za rastvor za
injekciju
SUDãDNLUDVWYDUDþ
za rastvor za
injekciju
STAC
koagulacioni faktor VIII (antihemofilni faktor VIII)
B02BD02
koagulacioni faktor VIII
(antihemofilni faktor
VIII)
OCTANATE 500
SUDãDNLUDVWYDUDþ
za rastvor za
injekciju
1 po (500 i.j.)/10 ml
Octapharma
Pharmazeutika
Produktionsges
m.b.H
B02BD02
koagulacioni faktor VIII
(antihemofilni faktor
VIII)
EMOCLOT
SUDãDNLUDVWYDUDþ
za rastvor za
infuziju
OLRERþLFDVD
UDVWYDUDþHPSR
i.j./ 10 ml rastv.
Kedrion S.P.A.
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0066103
0066610
0066611
0066612
0066630
0066631
0066632
0066907
ATC
INN
=DãWLüHQRLPH
leka
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
B02BD02
koagulacioni faktor VIII
(antihemofilni faktor
VIII)
EMOCLOT
SUDãDNLUDVWYDUDþ
OLRERþLFDVD
za rastvor za
UDVWYDUDþHPSR
infuziju
i.j./ 10 ml rastv.
B02BD02
koagulacioni faktor VIII
(antihemofilni faktor
VIII)
BERIATE P
SUDãDNLUDVWYDUDþ
za rastvor za
injekciju/infuziju
B02BD02
koagulacioni faktor VIII
(antihemofilni faktor
VIII)
BERIATE P
Cena leka na
veliko za
pakovanje
DDD
Participacija
Cena leka na osiguranog
veliko po DDD
lica
Kedrion S.P.A.
Italija
50.747,60
500 i.j.
25.373,80
-
1 po 2,5 ml (250 i.j./2,5
ml)
CSL Behring GmbH
1HPDþND
13.862,80
500 i.j.
27.725,60
-
SUDãDNLUDVWYDUDþ
za rastvor za
injekciju/infuziju
1 po 5 ml (500 i.j./5 ml)
CSL Behring GmbH
1HPDþND
25.413,30
500 i.j.
25.413,30
-
B02BD02
koagulacioni faktor VIII
(antihemofilni faktor
VIII)
BERIATE P
SUDãDNLUDVWYDUDþ
za rastvor za
injekciju/infuziju
1 po 10 ml (1000 i.j./10
ml)
ZLB Behring GmbH
1HPDþND
50.747,60
500 i.j.
25.373,80
-
B02BD02
koagulacioni faktor VIII,
humani
HAEMOCTIN SDH
SUDãDNLUDVWYDUDþ
za rastvor za
injekciju
OLRERþLFDSRLM
(50i.j./ml + 5ml vode za
inj.)
Biotest Pharma
GmbH
1HPDþND
13.862,80
500 i.j.
27.725,60
-
B02BD02
koagulacioni faktor VIII,
humani
HAEMOCTIN SDH
SUDãDNLUDVWYDUDþ OLRERþLFDSRLM
za rastvor za
i.j./ml + 10ml vode za
injekciju
inj.)
Biotest Pharma
GmbH
1HPDþND
25.413,30
500 i.j.
25.413,30
-
B02BD02
koagulacioni faktor VIII,
humani
HAEMOCTIN SDH
SUDãDNLUDVWYDUDþ OLRERþLFDSRLM
za rastvor za
(100 i.j./ml + 10 ml vode
injekciju
za inj.)
Biotest Pharma
GmbH
1HPDþND
50.747,60
500 i.j.
25.373,80
-
B02BD02
koagulacioni faktor VIII,
humani
KOATE-DVI
SUDãDNLUDVWYDUDþ OLRERþLFDVDUDVWYDUDþHP
za rastvor za
XERþLFLSRPO Grifols Therapeutics
injekciju/infuziju
i.j./5 ml)
INC.
SAD
13.862,80
500 i.j.
27.725,60
-
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0066908
0066906
0066905
0066903
0066901
0066909
ATC
INN
=DãWLüHQRLPH
leka
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
Cena leka na
veliko za
pakovanje
DDD
Participacija
Cena leka na osiguranog
veliko po DDD
lica
B02BD02
koagulacioni faktor VIII,
humani
KOATE-DVI
SUDãDNLUDVWYDUDþ OLRERþLFDVDUDVWYDUDþHP
za rastvor za
XERþLFLSRPO Grifols Therapeutics
injekciju/infuziju
i.j./5 ml)
INC.
SAD
25.413,30
500 i.j.
25.413,30
-
B02BD02
koagulacioni faktor VIII,
humani
KOATE-DVI
SUDãDNLUDVWYDUDþ OLRERþLFDVDUDVWYDUDþHP
za rastvor za
XERþLFLSRPO
Grifols Therapeutics
injekciju/infuziju
(1000 i.j./10 ml)
INC.
SAD
50.747,60
500 i.j.
25.373,80
-
B02BD02
oktokog alfa (humani faktor koagulacije VIII, rekombinantni)
B02BD02
oktokog alfa (humani
faktor koagulacije VIII,
rekombinantni)
B02BD02
B02BD02
B02BD02
KOGENATE BAYER
SUDãDNLUDVWYDUDþ
za rastvor za
injekciju
OLRERþLFDVDUDVWYDUDþHP
u špricu sa bio-set
priborom, 1 po 2,5 ml
(500 i.j./2,5 ml)
Bayer Healthcare
Manufacturing
S.R.L.
Italija
25.413,30
500 i.j.
25.413,30
-
KOGENATE BAYER
SUDãDNLUDVWYDUDþ
za rastvor za
injekciju
OLRERþLFDVDUDVWYDUDþHP
u špricu sa bio-set
priborom, 1 po 2,5 ml
(250 i.j/2, 5 ml)
Bayer Healthcare
Manufacturing
S.R.L.
Italija
13.862,80
500 i.j.
27.725,60
-
oktokog alfa
KOGENATE BAYER
SUDãDNLUDVWYDUDþ
za rastvor za
injekciju
OLRERþLFDVDUDVWYDUDþHP
u špricu sa bio-set
priborom, 1 po 2,5 ml
(1000 i.j/2, 5 ml)
Bayer Healthcare
Manufacturing
S.R.L.
Italija
50.747,60
500 i.j.
25.373,80
-
oktokog alfa
SUDãDNLUDVWYDUDþ OLRERþLFDVDUDVWYDUDþHP
za rastvor za
(komplet BAXJECT II), 1
RECOMBINATE 250
injekciju
po 10 ml (250 i.j./10 ml)
Baxter S.A.
Belgija
13.862,80
500 i.j.
27.725,60
-
oktokog alfa
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0066910
0066911
0066770
0066771
0066772
0066773
ATC
B02BD02
B02BD02
B02BD02
B02BD02
B02BD02
B02BD02
INN
=DãWLüHQRLPH
leka
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
Cena leka na
veliko za
pakovanje
DDD
Participacija
Cena leka na osiguranog
veliko po DDD
lica
oktokog alfa
SUDãDNLUDVWYDUDþ OLRERþLFDVDUDVWYDUDþHP
za rastvor za
(komplet BAXJECT II), 1
RECOMBINATE 500
injekciju
po 10 ml (500 i.j./10 ml)
Baxter S.A.
Belgija
25.413,30
500 i.j.
25.413,30
-
oktokog alfa
RECOMBINATE
1000
SUDãDNLUDVWYDUDþ OLRERþLFDVDUDVWYDUDþHP
za rastvor za
(komplet BAXJECT II), 1
injekciju
po 10 ml (1000 i.j./10 ml)
Baxter S.A.
Belgija
50.747,60
500 i.j.
25.373,80
-
REFACTO AF
SUDãDNLUDVWYDUDþ
ERþLFDLQDSXQMHQL
za rastvor za
injekcioni špric, 1 po 4 ml
injekciju
(250 i.j./4 ml)
Wyeth Farma S.A.
Španija
13.862,80
500 i.j.
27.725,60
REFACTO AF
SUDãDNLUDVWYDUDþ
ERþLFDLQDSXQMHQL
za rastvor za
injekcioni špric, 1 po 4 ml
injekciju
(500 i.j./4 ml)
Wyeth Farma S.A.
Španija
25.413,30
500 i.j.
25.413,30
REFACTO AF
SUDãDNLUDVWYDUDþ
ERþLFDLQDSXQMHQL
za rastvor za
injekcioni špric, 1 po 4 ml
injekciju
(1000 i.j./4 ml)
Wyeth Farma S.A.
Španija
50.747,60
500 i.j.
25.373,80
REFACTO AF
SUDãDNLUDVWYDUDþ
ERþLFDLQDSXQMHQL
za rastvor za
injekcioni špric, 1 po 4 ml
injekciju
(2000 i.j./4 ml)
Wyeth Farma S.A.
Španija
101.495,20
500 i.j.
25.373,80
moroktokog alfa
moroktokog alfa
moroktokog alfa
moroktokog alfa
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0066044
ATC
B02BD03
=DãWLüHQRLPH
INN
leka
FO
antiinhibitorski kompleks koagulacionog faktora VIII
B02BD03
antiinhibitorski
kompleks faktora VIII
INDIKACIJE
B02BD04
FEIBA NF
SUDãDNLUDVWYDUDþ
za rastvor za
infuziju
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
1 po 20 ml (500 i.j./20
ml)
Baxter AG
Austrija
Cena leka na
veliko za
pakovanje
DDD
47.306,70
10000 i.j.
Participacija
Cena leka na osiguranog
veliko po DDD
lica
946.134,00
-
Za dokazane inhibitore na koagulacioni faktor VIII i faktor IX, na osnovu mišljenja hematologa ili interniste LOLSHGLMDWUDXFHQWULPD]DOHþHQMHKHPRILOLMH
koagulacioni faktor IX
350 i.j.
16.080,54
-
Kedrion S.P.A.
Italija
22.972,20
350 i.j.
16.080,54
-
Baxter AG
Austrija
27.566,60
350 i.j.
16.080,52
-
0066010
B02BD04
koagulacioni faktor
IX,humani
AIMAFIX
0066171
B02BD04
humani faktor
koagulacije IX
IMMUNINE
SUDãDNLUDVWYDUDþ OLRERþLFDVDUDVWYDUDþHP
za rastvor za
XERþLFLSRPO
infuziju
i.j./10 ml)
SUDãDNLUDVWYDUDþ
za rastvor za
injekciju/infuziju
1 po 600 i.j./5 ml
B02BD04
koagulacioni faktor IX,
humani
BERININ P
SUDãDNLUDVWYDUDþ OLRERþLFDVDUDVWYDUDþHP
za rastvor za
XERþLFLSRPO
injekciju/infuziju
i.j./5 ml)
CSL Behring GmbH
1HPDþND
27.566,60
350 i.j.
16.080,52
-
B02BD04
koagulacioni faktor IX,
humani
HAEMONINE 250
SUDãDNLUDVWYDUDþ
ERþLFDVDSUDãNRPL
za rastvor za
ERþLFDVDUDVWYDUDþHP
injekciju
po 5 ml (50 i.j. /ml)
Biotest Pharma
GmbH
1HPDþND
11.486,10
350 i.j.
16.080,54
-
B02BD04
koagulacioni faktor IX,
humani
HAEMONINE 500
SUDãDNLUDVWYDUDþ
ERþLFDVDSUDãNRPL
za rastvor za
ERþLFDVDUDVWYDUDþHP
injekciju
po 5 ml (100 i.j./ml)
Biotest Pharma
GmbH
1HPDþND
22.972,20
350 i.j.
16.080,54
-
B02BD04
koagulacioni faktor IX,
humani
HAEMONINE 1000
SUDãDNLUDVWYDUDþ
ERþLFDVDSUDãNRPL
za rastvor za
ERþLFDVDUDVWYDUDþHP
injekciju
po 10 ml (100 i.j./ml)
Biotest Pharma
GmbH
1HPDþND
45.944,40
350 i.j.
16.080,54
-
0066502
0066501
0066500
1 po (500 i.j.)/5 ml
22.972,20
koagulacioni faktor IX
0066008
injekcija
Austrija
B02BD04
0066011
OCTANINE F
Octapharma
Pharmazeutika
Produktionsges
m.b.H
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0066200
0066201
0066202
0066700
0066701
0066153
ATC
B02BD06
Država
=DãWLüHQRLPH
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
INN
leka
FO
leka
SURL]YRÿDþDOHND
leka
faktor VIII, von Willebrand-ov faktor (vWF:Rco), (antihemofilni faktor VIII)
Cena leka na
veliko za
pakovanje
DDD
Participacija
Cena leka na osiguranog
veliko po DDD
lica
B02BD06
faktor VIII, von
Willebrand-ov faktor
(vWF:Rco),(antihemofil
ni faktor VIII)
HAEMATE P 250
SUDãDNLUDVWYDUDþ
za rastvor za
injekciju/infuziju
OLRERþLFDVD
UDVWYDUDþHPSR
i.j./ 10 ml rastv.
CSL Behring GmbH
1HPDþND
18.240,90
7200 i.j.
525.337,92
-
B02BD06
faktor VIII, von
Willebrand-ov faktor
(vWF:Rco),(antihemofil
ni faktor VIII)
HAEMATE P 500
SUDãDNLUDVWYDUDþ
za rastvor za
injekciju/infuziju
OLRERþLFDVD
UDVWYDUDþHPSR
i.j./20 ml rastv.
CSL Behring GmbH
1HPDþND
36.481,80
7200 i.j.
525.337,92
-
B02BD06
faktor VIII, von
Willebrand-ov faktor
(vWF:Rco),(antihemofil
ni faktor VIII)
HAEMATE P 1000
SUDãDNLUDVWYDUDþ
OLRERþLFDVD
za rastvor za
UDVWYDUDþHPSR
injekciju/infuziju
i.j./30 ml rastv.
CSL Behring GmbH
1HPDþND
72.963,50
7200 i.j.
525.337,20
-
B02BD06
faktor VIII, von
Willebrand-ov faktor
(vWF:RCof)
WILATE 450
SUDãDNLUDVWYDUDþ OLRERþLFDVDUDVWYDUDþHP
za rastvor za
XERþLFLSRPO
injekciju/infuziju
i.j./5 ml + 400 i.j./5 ml)
Octapharma
Pharmazeutika
Produktionsges
m.b.H
Austrija
36.481,80
7200 i.j.
525.337,92
-
B02BD06
faktor VIII, von
Willebrand-ov faktor
(vWF:RCof)
WILATE 900
SUDãDNLUDVWYDUDþ OLRERþLFDVDUDVWYDUDþHP
za rastvor za
XERþLFLSRPO
injekciju/infuziju i.j./10 ml + 800 i.j./10 ml)
Octapharma
Pharmazeutika
Produktionsges
m.b.H
Austrija
72.963,50
7200 i.j.
525.337,20
-
B02BD06
faktor VIII, von
Willebrand-ov faktor
(vWF:Rco),(antihemofil
ni faktor VIII)
IMMUNATE
SUDãDNLUDVWYDUDþ
za rastvor za
1 po (250 i.j.+ 125 i.j.) sa
injekciju
POUDVWYDUDþD
Baxter AG
Austrija
12.652,60
7200 i.j.
364.394,88
-
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0066154
ATC
B02BD06
INDIKACIJE
B02BD08
0066602
B02BD08
INDIKACIJE
B03
B03A
B03AC
B03AC02
0060250
B03AC02
NAPOMENA
B03B
B03BA
B03BA01
0051760
B03BA01
INDIKACIJE
B03BA03
0051560
B03BA03
INN
=DãWLüHQRLPH
leka
faktor VIII, von
Willebrand-ov faktor
(vWF:Rco),(antihemofil
ni faktor VIII)
IMMUNATE
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
SUDãDNLUDVWYDUDþ
za rastvor za
1 po (500 i.j.+ 250 i.j.) sa
injekciju
POUDVWYDUDþD
Baxter AG
Austrija
Cena leka na
veliko za
pakovanje
DDD
25.305,20
7200 i.j.
Participacija
Cena leka na osiguranog
veliko po DDD
lica
364.394,88
-
7HUDSLMDLSURILODNVDNUYDUHQMDNRGSDFLMHQDWDVDNRQJHQLWDOQRPKHPRILOLMD$LOLVWHþHQRPGHILFLMHQFLMRPIDNWRUD9,,,9RQ:LOOHEUDQGRYDEROHVWVDGHILFLMHQFLMRP
faktora VIII.
koagulacioni faktor VIIa, eptakog alfa ( aktivirani )
eptakog alfa (aktivirani) NOVOSEVEN
SUDãDNLUDVWYDUDþ
ERþLFDVDSUDãNRPL
za rastvor za
ERþLFDVDUDVWYDUDþHP
injekciju
po 1,1 ml (1 mg/1,1 ml)
Novo Nordisk A/S
Danska
69.526,50
2500000 i.j.
1.529,58
-
.RGSDFLMHQDWDVDXURÿHQRPKHPRILOLMRPNRMLLPDMXLQKLELWRUHQDIDNWRUH9,,,LOL,;!%8WHXURÿHQLGHILFLWIDNWRUD9,,QDRVQRYXPLãOMHQMDKHPDWRORJDLOLLQWHUQLVWHLOL
SHGLMDWUDXFHQWULPD]DOHþHQMHKHPRILOLMH
ANTIANEMICI
3UHSDUDWLJYRåÿD
7URYDOHQWQRJYRåÿHSDUHQWHUDOQLSUHSDUDWL
JYRåÿH,,,KLGURNVLGVDKDUR]DNRPSOHNV
JYRåÿH,,,KLGURNVLG
saharoza kompleks
FERROVIN
koncentrat za
rastvor za
injekciju/infuziju
ampula, 5 po 100 mg/5
ml
Rafarm S.A.
*UþND
4.937,80
0,1 g
987,56
-
STAC
Vitamin B12 i folna kiselina
Vitamin B12 (cijanokobalamin) i derivati
cijanokobalamin
cijanokobalamin
VITAMIN B12
rastvor za injekciju
50 po 500 mcg/1 ml
Alkaloid a.d.
Republika
Makedonija
907,60
20 mcg
0,73
-
rastvor za injekciju
ampula, 5 po 2500
mcg/2 ml
Galenika a.d.
Republika Srbija
361,10
20 mcg
0,58
-
Perniciozna anemija.
hidroksokobalamin
hidroksokobalamin
OHB 12
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0179350
ATC
B05
B05A
B05AA
B05AA01
B05AA01
INDIKACIJE
B05AA01
=DãWLüHQRLPH
leka
INN
FO
Država
Cena leka na
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
veliko za
leka
SURL]YRÿDþDOHND
leka
pakovanje
SREDSTVA ZA ZAMENU KRVI I PERFUZIONI RASTVORI
.UYLVOLþQLSURL]YRGL
Supstituenti krvi i proteinske frakcije plazme
DDD
Participacija
Cena leka na osiguranog
veliko po DDD
lica
albumin, humani (5%)
albumin
HUMAN ALBUMIN
OCTAPHARMA 5%
rastvor za infuziju
boca, 1 po 250 ml 5%
Octapharma
Pharmazeutika
Produktionsges
m.b.H
Austrija
4.561,50
-
-
-
STAC; Nadoknada volumena; druga linija terapije (kada je primena artificijalnih koloida kontraindikovana ili kada je postignuta maksimalna doza za koloide);
opekotine; hiperbilirubinemija kod neonatusa i terapijska zamena plazme.
albumin, humani (20%)
0179351
B05AA01
albumin
HUMAN ALBUMIN
OCTAPHARMA 20%
rastvor za infuziju
boca, 1 po 50 ml 20%
Octapharma
Pharmazeutika
Produktionsges
m.b.H
0179315
B05AA01
albumin
HUMAN ALBUMIN
rastvor za infuziju
ERþLFDSRPO
Baxter AG
Austrija
3.648,00
-
-
-
0179323
B05AA01
albumin
UMAN ALBUMIN
rastvor za infuziju
1 po 50 ml 20%
Kedrion S.P.A.
Italija
3.648,00
-
-
-
0179046
B05AA01
albumin, humani
LJUDSKI ALBUMIN
20%
rastvor za infuziju
1 po 10 ml 20%
Institut za transfuziju
krvi Srbije
Republika Srbija
729,50
-
-
-
0179048
B05AA01
albumin, humani
LJUDSKI ALBUMIN
20%
rastvor za infuziju
ERþLFDSRPO
Institut za transfuziju
krvi Srbije
Republika Srbija
3.648,00
-
-
-
rastvor za infuziju
ERþLFDSRPO CSL Behring GmbH
1HPDþND
3.648,00
-
-
-
rastvor za infuziju
VWDNOHQDERþLFDSR
ml (20%)
Biotest Pharma
GmbH
1HPDþND
3.648,00
-
-
-
ERþLFDVWDNOHQDSR
ml (20%)
Talecris
Biotherapeutics
GmbH
1HPDþND
3.517,40
-
-
-
0179190
B05AA01
albumin
HUMAN ALBUMIN
20% BEHRING
0179360
B05AA01
albumin, humani
ALBIOMIN 20%
0179186
B05AA01
albumin, humani
PLASBUMIN-20
rastvor za infuziju
Austrija
3.648,00
-
-
-
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0179185
ATC
B05AA01
NAPOMENA
B05AA07
INN
albumin, humani
=DãWLüHQRLPH
leka
PLASBUMIN-20
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
Cena leka na
veliko za
pakovanje
DDD
Participacija
Cena leka na osiguranog
veliko po DDD
lica
rastvor za infuziju
ERþLFDVWDNOHQDSR
100 ml (20%)
Talecris
Biotherapeutics
GmbH
1HPDþND
6.462,60
-
-
-
STAC
hidroksietilskrob, natrijum hlorid
0179340
B05AA07
hidroksietilskrob,
natrijum hlorid
VOLUVEN
rastvor za infuziju
1 po 500 ml ( 60 g/l + 9
g/l)
Fresenius Kabi
1HPDþND
724,10
-
-
-
0179345
B05AA07
hidroksietilskrob,
natrijum hlorid
HETASORB 6%
rastvor za infuziju
boca staklena, 1 po 500
ml (60 g/l + 9 g/l)
Hemofarm a.d.
Republika Srbija
606,10
-
-
-
0179346
B05AA07
hidroksietil skrob,
natrijum hlorid
HETASORB 10%
rastvor za infuziju
boca staklena, 1 po 500
ml (100 g/l + 9 g/l)
Hemomont d.o.o.
Republika Crna
Gora
694,50
-
-
-
B05AA07
hidroksietilskrob,
natrijum-hlorid, kalijumhlorid, kalcijum-hlorid,
magnezijum-hlorid,
natrijum-acetat,
MDEXþQDNLVHOLQD
TETRASPAN 6%
rastvor za infuziju
ERFDSODVWLþQDSR
500 ml (60 g/l + 6,252 g/l
+ 298,4 mg/l + 367,5
mg/l + 203,3 mg/l +
3,266 g/l + 671 mg/l)
B.Braun Medical SA
Švajcarska
6.516,50
-
-
-
B05AA07
hidroksietilskrob,
natrijum-hlorid, kalijumhlorid, kalcijum-hlorid,
magnezijum-hlorid,
natrijum-acetat,
MDEXþQDNLVHOLQD
TETRASPAN 6%
rastvor za infuziju
kesa, 20 po 250 ml (60
g/l + 6,252 g/l + 298,4
mg/l + 367,5 mg/l +
203,3 mg/l + 3,266 g/l +
671 mg/l)
B.Braun Medical SA
Švajcarska
8.283,30
-
-
-
0179355
0179356
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0179357
0179358
0179359
ATC
B05AA07
hidroksietilskrob,
natrijum-hlorid, kalijumhlorid, kalcijum-hlorid,
magnezijum-hlorid,
natrijum-acetat,
MDEXþQDNLVHOLQD
TETRASPAN 6%
B05AA07
hidroksietilskrob,
natrijum-hlorid, kalijumhlorid, kalcijum-hlorid,
magnezijum-hlorid,
natrijum-acetat,
MDEXþQDNLVHOLQD
TETRASPAN 10%
B05AA07
hidroksietilskrob,
natrijum-hlorid, kalijumhlorid, kalcijum-hlorid,
magnezijum-hlorid,
natrijum-acetat,
MDEXþQDNLVHOLQD
TETRASPAN 10%
NAPOMENA
B05B
B05BA
B05BA01
0174030
INN
=DãWLüHQRLPH
leka
B05BA01
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
Cena leka na
veliko za
pakovanje
DDD
Participacija
Cena leka na osiguranog
veliko po DDD
lica
rastvor za infuziju
kesa, 20 po 500 ml (60
g/l + 6,252 g/l + 298,4
mg/l + 367,5 mg/l +
203,3 mg/l + 3,266 g/l +
671 mg/l)
B.Braun Medical SA
Švajcarska
13.033,00
-
-
-
rastvor za infuziju
kesa, 20 po 250 ml (100
g/l + 6,252 g/l + 298,4
mg/l + 367,5 mg/l +
203,3 mg/l + 3,266 g/l +
671 mg/l)
B.Braun Medical SA
Švajcarska
10.829,70
-
-
-
rastvor za infuziju
kesa, 20 po 500 ml (100
g/l + 6,252 g/l + 298,4
mg/l + 367,5 mg/l +
203,3 mg/l + 3,266 g/l +
671 mg/l)
B.Braun Medical SA
Švajcarska
13.782,70
-
-
-
554,70
-
-
-
STAC
Rastvori za intravensku primenu
Rastvori za parenteralnu ishranu
aminokiseline
alanin, arginin, cistein,
fenilalanin, glicin,
histidin, izoleucin,
leucin, lizin, metionin,
prolin, serin, glacijalna
VLUüHWQDNLVHOLQD
treonin, triptofan, valin
HEPASOL 8%
boca, 1 po 500 ml (4,64
g/l + 10,72 g/l + 0,52 g/l
+ 0,88 g/l + 5,82 g/l + 2,8
g/ + 10,4 g/l + 13,09 g/l +
6,88 g/l + 1,1 g/l + 5,73
g/l + 2,24 g/l + 4,42 g/l +
4,4 g/l + 0,7 g/l + 10,08
rastvor za infuziju
g/l
Hemomont d.o.o.
Republika Crna
Gora
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
=DãWLüHQRLPH
leka
Cena leka na
veliko za
pakovanje
DDD
Participacija
Cena leka na osiguranog
veliko po DDD
lica
JKL
ATC
INN
0174041
B05BA01
aminokiseline
VAMINOLACT
rastvor za infuziju
12 po 100 ml
Fresenius Kabi
Austrija
12.968,00
-
-
-
0174037
B05BA01
alanin, prolin, glicin,
arginin, NaJOLFHULOIRVIDWMDEXþQD
kiselina
AMINOSOL 10% E
rastvor za infuziju
boca staklena, 1 po 500
ml
Hemofarm a.d.
Republika Srbija
630,00
-
-
-
0174036
B05BA01
leucin,alanin, arginin,
glicin, prolin, lizin...
AMINOSOL 15%
rastvor za infuziju
boca staklena, 1 po 500
ml
Hemofarm a.d.
Republika Srbija
954,00
-
-
-
0174035
B05BA01
aminokiseline
AMINOSOL 10%
rastvor za infuziju
boca, 1 po 500 ml
Hemofarm a.d.
Republika Srbija
630,00
-
-
-
rastvor za infuziju
boca, 10 po 500 ml (100
g/l)
Fresenius Kabi
Austria GmbH
Austrija
7.412,00
-
-
-
Fresenius Kabi
Austria GmbH
Austrija
4.770,20
-
-
-
0174021
B05BA01
aminokiseline
AMINOVEN 10%
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
0174022
B05BA01
aminokiseline
AMINOVEN 15%
rastvor za infuziju
boca, 10 po 250 ml (150
g/l)
0174023
B05BA01
aminokiseline
AMINOVEN 15%
rastvor za infuziju
boca, 10 po 500 ml (150
g/l)
Fresenius Kabi
Austria GmbH
Austrija
11.991,30
-
-
-
emulzija za infuziju
boca staklena, 10 po 500
ml
Fresenius Kabi
Austria GmbH
Austrija
18.140,00
-
-
-
NAPOMENA
B05BA02
STAC
sojino ulje, fosfolipidi, glicerol
0171110
B05BA02
sojino ulje, fosfolipidi,
glicerol
LIPOVENOES 10%
PLR
0171290
B05BA02
XOMHVRMHSUHþLãüHQR
INTRALIPID
rastvor za infuziju
10 po 100 ml (staklo)
Fresenius Kabi
Austrija
4.793,20
-
-
-
0171291
B05BA02
XOMHVRMHSUHþLãüHQR
INTRALIPID
rastvor za infuziju
10 po 100 ml (plastika)
Fresenius Kabi AB
Švedska
4.793,20
-
-
-
0171286
B05BA02
XOMHVRMHSUHþLãüHQR
INTRALIPID
rastvor za infuziju
1 po 250 ml (staklo) 20%
Fresenius Kabi AB
Švedska
968,40
-
-
-
0171287
B05BA02
XOMHVRMHSUHþLãüHQR
INTRALIPID
rastvor za infuziju
1 po 250 ml (plastika)
20%
Fresenius Kabi AB
Švedska
968,40
-
-
-
0171288
B05BA02
XOMHVRMHSUHþLãüHQR
INTRALIPID
rastvor za infuziju
1 po 500 ml (staklo) 20%
Fresenius Kabi AB
Švedska
1.281,40
-
-
-
rastvor za infuziju
1 po 500 ml (plastika)
20%
Fresenius Kabi AB
Švedska
1.281,40
-
-
-
0171289
B05BA02
XOMHVRMHSUHþLãüHQR
INTRALIPID
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0171310
0171311
0171312
ATC
0173225
emulzija za infuziju
boca, 10 po 100 ml (100 B. Braun Melsungen
g/1l + 100 g/1l)
AG
1HPDþND
4.647,70
-
-
-
B05BA02
ulje soje, rafinisano,
trigliceridi, srednje
dužine lanca
LIPOFUNDIN
MCT/LCT 20%
emulzija za infuziju
boca, 10 po 250 ml (100 B. Braun Melsungen
g/1l + 100 g/1l)
AG
1HPDþND
10.146,30
-
-
-
B05BA02
ulje soje, rafinisano,
trigliceridi, srednje
dužine lanca
LIPOFUNDIN
MCT/LCT 20%
emulzija za infuziju
boca, 10 po 500 ml (100 B. Braun Melsungen
g/1l + 100 g/1l)
AG
1HPDþND
12.701,90
-
-
-
B05BA03
B05BA03
STAC
glukoza
glukoza
GLUCOSI
INFUNDIBILE 5%
rastvor za infuziju
boca, 1 po 500 ml (5%)
Hemofarm a.d.
Republika Srbija
77,10
-
-
-
glukoza
GLUCOSI
INFUNDIBILE 10%
rastvor za infuziju
boca, 1 po 500 ml (10%)
Hemofarm a.d.
Republika Srbija
95,70
-
-
-
rastvor za infuziju
boca, 1 po 500 ml (5%)
Hemomont d.o.o.
Republika Crna
Gora
77,10
-
-
-
rastvor za infuziju
boca, 1 po 500 ml (10%)
Hemomont d.o.o.
Republika Crna
Gora
95,70
-
-
-
rastvor za infuziju
ERFDSODVWLþQDSR
ml
Zdravlje a.d.
Republika Srbija
77,10
-
-
-
rastvor za infuziju
ERFDSODVWLþQDSR
ml
Zdravlje a.d.
Republika Srbija
95,70
-
-
-
ERFDSODVWLþQDSR
100 ml (50 g/1l)
B. Braun Melsungen
AG; B. Braun
Medical SA
1HPDþND
Španija
1.393,20
-
-
-
B05BA03
glukoza
0173501
B05BA03
glukoza
GLUCOSI
INFUNDIBILE 10%
glukoza
GLUCOSI
INFUNDIBILE 5%
glukoza
GLUCOSI
INFUNDIBILE 10%
0173306
0173900
0173901
DDD
Participacija
Cena leka na osiguranog
veliko po DDD
lica
LIPOFUNDIN
MCT/LCT 20%
0173500
0173131
Cena leka na
veliko za
pakovanje
B05BA02
GLUCOSI
INFUNDIBILE 5%
0173130
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
ulje soje, rafinisano,
trigliceridi, srednje
dužine lanca
NAPOMENA
B05BA03
0173220
INN
=DãWLüHQRLPH
leka
B05BA03
B05BA03
B05BA03
B05BA03
B05BA03
glukoza
GLUCOSE 5%
rastvor za infuziju
glukoza
GLUCOSE 5%
FRESENIUS
boca staklena, 49 po 100 Fresenius Kabi Italia
rastvor za infuziju
ml (5%)
S.R.L.
Italija
3.413,30
-
-
-
glukoza
GLUCOSE 5%
FRESENIUS
boca staklena, 20 po 500 Fresenius Kabi Italia
rastvor za infuziju
ml (5%)
S.R.L.
Italija
1.542,00
-
-
-
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
ATC
B05BA10
=DãWLüHQRLPH
INN
leka
aminokiseline, vitamini, minerali
B05BA10
aminokiseline, vitamini, AMINOSTERIL Nminerali
Hepa 8%
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
Cena leka na
veliko za
pakovanje
DDD
Participacija
Cena leka na osiguranog
veliko po DDD
lica
rastvor za infuziju
boca staklena, 10 po 500
ml
Fresenius Kabi
Austria GmbH
Austrija
10.222,60
-
-
-
B05BA10
aminokiseline, vitamini,
minerali
KABIVEN
emulzija za infuziju
4 po 1026 ml (900 kcal)
Fresenius Kabi
Austrija
9.838,30
-
-
-
B05BA10
aminokiseline, vitamini,
minerali
KABIVEN
emulzija za infuziju 4 po 1540 ml (1400 kcal)
Fresenius Kabi
Austrija
10.889,50
-
-
-
B05BA10
aminokiseline, vitamini,
minerali
KABIVEN
emulzija za infuziju 3 po 2566 ml (2300 kcal)
Fresenius Kabi
Švedska
16.236,70
-
-
-
0171303
B05BA10
aminokiseline, vitamini, KABIVEN
minerali
PERIPHERAL
emulzija za infuziju 4 po 1440 ml (1000 kcal)
Fresenius Kabi
Austrija
10.789,40
-
-
-
0171305
B05BA10
aminokiseline, vitamini, KABIVEN
minerali
PERIPHERAL
emulzija za infuziju 3 po 2400 ml (1700 kcal)
Fresenius Kabi
Švedska
11.346,60
-
-
-
B05BA10
alanin,
arginin,glicin,histidin,izo
leucin, lizin, metionin,
fenilalanin, prolin, serin,
treonin, triptofan,
tirozin, valin, natrijumacetat, natrijumglicerofosfat, kalijumhlorid, magnezijumhlorid, glukoza,
kalcijum-hlorid,
maslinovo i sojino ulje, OLICLINOMEL N4mešavina
550E
kesa, 4 po 2000 ml
(11,39g/l + 6,33g/l +
5,67g/l + 2,64g/l + 3,3g/l
+ 4,02g/l + 3,19g/l +
2,2g/l + 3,08g/l + 3,74g/l
+ 2,75g/l + 2,31g/l +
0,99g/l + 0,22g/l +
3,19g/l + 2,45g/l +
5,36g/l + 2,98g/l +
1,12g/l + 200g/l + 0,74g/l
emulzija za infuziju
+ 100g/l)
Baxter S.A.
Belgija
15.081,30
-
-
-
0174040
0171300
0171301
0171306
0171121
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0171120
0171122
ATC
INN
=DãWLüHQRLPH
leka
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
Cena leka na
veliko za
pakovanje
DDD
Participacija
Cena leka na osiguranog
veliko po DDD
lica
B05BA10
alanin,
arginin,glicin,histidin,izo
leucin, lizin, metionin,
fenilalanin, prolin, serin,
treonin, triptofan,
tirozin, valin, natrijumacetat, natrijumglicerofosfat, kalijumhlorid, magnezijumhlorid, glukoza,
kalcijum-hlorid,
maslinovo i sojino ulje, OLICLINOMEL N4mešavina
550E
kesa, 6 po 1000 ml
(11,39g/l + 6,33g/l +
5,67g/l + 2,64g/l + 3,3g/l
+ 4,02g/l + 3,19g/l +
2,2g/l + 3,08g/l + 3,74g/l
+ 2,75g/l + 2,31g/l +
0,99g/l + 0,22g/l +
3,19g/l + 2,45g/l +
5,36g/l + 2,98g/l +
1,12g/l + 200g/l + 0,74g/l
emulzija za infuziju
+ 100g/l)
Baxter S.A.
Belgija
15.743,70
-
-
-
B05BA10
alanin,
arginin,glicin,histidin,izo
leucin, lizin, metionin,
fenilalanin, prolin, serin,
treonin, triptofan,
tirozin, valin, natrijumacetat, natrijumglicerofosfat, kalijumhlorid, magnezijumhlorid, glukoza,
kalcijum-hlorid,
maslinovo i sojino ulje, OLICLINOMEL N6mešavina
900E
kesa, 4 po 2000 ml
(17,6g/l + 9,78g/l +
8,76g/l + 4,08g/l + 5,1g/l
+ 6,21g/l + 4,93g/l +
3,4g/l + 4,76g/l + 5,78g/l
+ 4,25g/l + 3,57g/l +
1,53g/l + 0,34g/l +
4,93g/l + 6,12g/l +
5,36g/l + 4,47g/l +
1,12g/l + 300g/l + 0,74g/l
emulzija za infuziju
+ 200g/l)
Baxter S.A.
Belgija
17.669,10
-
-
-
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0171123
0171124
ATC
INN
=DãWLüHQRLPH
leka
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
Cena leka na
veliko za
pakovanje
DDD
Participacija
Cena leka na osiguranog
veliko po DDD
lica
B05BA10
alanin,
arginin,glicin,histidin,izo
leucin, lizin, metionin,
fenilalanin, prolin, serin,
treonin, triptofan,
tirozin, valin, natrijumacetat, natrijumglicerofosfat, kalijumhlorid, magnezijumhlorid, glukoza,
kalcijum-hlorid,
maslinovo i sojino ulje, OLICLINOMEL N7mešavina
1000E
kesa, 6 po 1000 ml
(20,7g/l + 11,5g/l +
10,3g/l + 4,8g/l + 6g/l +
7,3g/l + 5,8g/l + 4g/l +
5,6g/l + 6,8g/l + 5g/l +
4,2g/l + 1,8g/l + 0,4g/l +
5,8g/l + 6,12g/l + 5,36g/l
+ 4,47g/l + 1,12g/l +
emulzija za infuziju 400g/l + 0,74g/l + 200g/l)
Baxter S.A.
Belgija
17.770,30
-
-
-
B05BA10
alanin,
arginin,glicin,histidin,izo
leucin, lizin, metionin,
fenilalanin, prolin, serin,
treonin, triptofan,
tirozin, valin, natrijumacetat, natrijumglicerofosfat, kalijumhlorid, magnezijumhlorid, glukoza,
kalcijum-hlorid,
maslinovo i sojino ulje, OLICLINOMEL N7mešavina
1000E
kesa, 4 po 2000 ml
(20,7g/l + 11,5g/l +
10,3g/l + 4,8g/l + 6g/l +
7,3g/l + 5,8g/l + 4g/l +
5,6g/l + 6,8g/l + 5g/l +
4,2g/l + 1,8g/l + 0,4g/l +
5,8g/l + 6,12g/l + 5,36g/l
+ 4,47g/l + 1,12g/l +
emulzija za infuziju 400g/l + 0,74g/l + 200g/l)
Baxter S.A.
Belgija
16.511,50
-
-
-
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0174203
0174202
ATC
INN
=DãWLüHQRLPH
leka
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
Cena leka na
veliko za
pakovanje
DDD
Participacija
Cena leka na osiguranog
veliko po DDD
lica
B05BA10
izoleucin, leucin, lizin,
metionin, fenilalanin,
treonin, triptofan, valin,
arginin, histidin, alanin,
glicin, aspartanska kis,
glutaminska kis, prolin,
serin, tirozin, natrijumacetat, natrijumhidroksid, kalijumacetat, magnezijumAMINOPLASMAL
hlorid, dinatrijum-fosfat B.BRAUN 10% E
boca staklena, 10 po 500
ml (5g/l, 8,9g/l, 6,85g/l,
4,4g/l, 4,7g/l, 4,2g/l,
1,6g/l, 6,2g/l, 11,5g/l,
3g/l, 10,5g/l, 12g/l, 5,6g/l,
7,2g/l, 5,5g/l, 2,3g/l,
0,4g/l, 2,858g/l, 0,36g/l,
2,453g/l, 0,508g/l,
B. Braun Melsungen
rastvor za infuziju
3,581g/l
AG
1HPDþND
7.215,90
-
-
-
B05BA10
izoleucin, leucin, lizin,
metionin, fenilalanin,
treonin, triptofan, valin,
arginin, histidin, alanin,
glicin, aspartanska kis,
glutaminska kis, prolin,
serin, tirozin, natrijumacetat, natrijumhidroksid, kalijumacetat, magnezijumAMINOPLASMAL
hlorid, dinatrijum-fosfat B.BRAUN 10% E
boca staklena, 6 po 1000
ml (5g/l, 8,9g/l, 6,85g/l,
4,4g/l, 4,7g/l, 4,2g/l,
1,6g/l, 6,2g/l, 11,5g/l,
3g/l, 10,5g/l, 12g/l, 5,6g/l,
7,2g/l, 5,5g/l, 2,3g/l,
0,4g/l, 2,858g/l, 0,36g/l,
B. Braun Melsungen
2,453g/l, 0,508g/l,
rastvor za infuziju
3,581g/l
AG
1HPDþND
8.661,90
-
-
-
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0171320
0171321
ATC
INN
=DãWLüHQRLPH
leka
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
Cena leka na
veliko za
pakovanje
DDD
Participacija
Cena leka na osiguranog
veliko po DDD
lica
B05BA10
izoleucin, leucin, lizin,
metionin, fenilalanin,
treonin, triptofan, valin,
arginin, histidin, alanin,
glicin, aspartanska kis,
glutaminska kis, prolin,
serin, natrijumhidroksid, natrijumhlorid, natrijum-acetat,
kalijum-acetat,
magnezijum-acetat,
kalcijum-hlorid,
glukoza, natrijumdihidrogenfosfat, cinkacetat, trigliceridi,
srednje dužine lanca,
NUTRIFLEX LIPID
ulje soje
PERI
kesa, 5 po 1250 ml
(1,872 g/l + 2,504 g/l +
2,272 g/l + 1,568 g/l +
2,808 g /l + 1,456 g/l +
0,456 g/l + 2,08 g/l +
2,16 g/l + 1,352 g/l +
3,88 g/l + 1,32 g/l + 1,2
g/l + 2,8 g/l + 2,72 g/l +
2,4 g/l + 0,64 g/l + 0,865
g/l + 0,435 g/l + 2,354 g/l
+ 0,515 g/l + 0,353 g/l +
70,4 g/l + 0,936 g/l +
B.Braun Melsungen
emulzija za infuziju 5,28 g/l + 20 g/l + 20 g/l
AG
1HPDþND
13.973,50
-
-
-
B05BA10
izoleucin, leucin, lizin,
metionin, fenilalanin,
treonin, triptofan, valin,
arginin, histidin, alanin,
glicin, aspartanska kis,
glutaminska kis, prolin,
serin, natrijumhidroksid, natrijumhlorid, natrijum-acetat,
kalijum-acetat,
magnezijum-acetat,
kalcijum-hlorid,
glukoza, natrijumdihidrogenfosfat, cinkacetat, trigliceridi,
srednje dužine lanca,
NUTRIFLEX LIPID
ulje soje
PERI
kesa, 5 po 1875 ml
(1,872 g/l + 2,504 g/l +
2,272 g/l + 1,568 g/l +
2,808 g /l + 1,456 g/l +
0,456 g/l + 2,08 g/l +
2,16 g/l + 1,352 g/l +
3,88 g/l + 1,32 g/l + 1,2
g/l + 2,8 g/l + 2,72 g/l +
2,4 g/l + 0,64 g/l + 0,865
g/l + 0,435 g/l + 2,354 g/l
+ 0,515 g/l + 0,353 g/l +
70,4 g/l + 0,936 g/l +
B.Braun Melsungen
emulzija za infuziju 5,28 g/l + 20 g/l + 20 g/l
AG
1HPDþND
16.768,10
-
-
-
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0171322
0171323
ATC
INN
=DãWLüHQRLPH
leka
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
Cena leka na
veliko za
pakovanje
DDD
Participacija
Cena leka na osiguranog
veliko po DDD
lica
B05BA10
izoleucin, leucin, lizin,
metionin, fenilalanin,
treonin, triptofan, valin,
arginin, histidin, alanin,
glicin, aspartanska kis,
glutaminska kis, prolin,
serin, natrijumhidroksid, natrijumhlorid, natrijum-acetat,
kalijum-acetat,
magnezijum-acetat,
kalcijum-hlorid,
glukoza, natrijumdihidrogenfosfat, cinkacetat, trigliceridi,
srednje dužine lanca,
NUTRIFLEX LIPID
ulje soje
PERI
kesa, 5 po 2500 ml
(1,872 g/l + 2,504 g/l +
2,272 g/l + 1,568 g/l +
2,808 g /l + 1,456 g/l +
0,456 g/l + 2,08 g/l +
2,16 g/l + 1,352 g/l +
3,88 g/l + 1,32 g/l + 1,2
g/l + 2,8 g/l + 2,72 g/l +
2,4 g/l + 0,64 g/l + 0,865
g/l + 0,435 g/l + 2,354 g/l
+ 0,515 g/l + 0,353 g/l +
70,4 g/l + 0,936 g/l +
B.Braun Melsungen
emulzija za infuziju 5,28 g/l + 20 g/l + 20 g/l
AG
1HPDþND
21.239,70
-
-
-
B05BA10
izoleucin, leucin, lizin,
metionin, fenilalanin,
treonin, triptofan, valin,
arginin, histidin, alanin,
glicin, aspartanska kis,
glutaminska kis, prolin,
serin, natrijumhidroksid, natrijumhlorid, natrijum-acetat,
kalijum-acetat,
magnezijum-acetat,
kalcijum-hlorid,
glukoza, natrijumdihidrogenfosfat, cinkacetat, trigliceridi,
srednje dužine lanca,
NUTRIFLEX LIPID
ulje soje
PLUS
kesa, 5 po 1250 ml
(2,256 g/l + 3,008 g/l +
2,728 g/l + 1,88 g/l +
3,368 g/l + 1,744 g/l +
0,544 g/l + 2,496 g/l +
2,592 g/l + 1,624 g/l +
4,656 g/l + 1,584 g/l +
1,44 g/l + 3,368 g/l +
3,264 g/l + 2,88 g/l +
0,781 g/l + 0,402 g/l +
0,222 g/l + 2,747 g/l +
0,686 g/l + 0,47 g/l + 132
g/l + 1,872 g/l + 5,264 g/l B.Braun Melsungen
emulzija za infuziju
+ 20 g/l + 20 g/l)
AG
1HPDþND
16.835,20
-
-
-
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0171324
0171325
ATC
B05BA10
B05BA10
INN
izoleucin, leucin, lizin,
metionin, fenilalanin,
treonin, triptofan, valin,
arginin, histidin, alanin,
glicin, aspartanska kis,
glutaminska kis, prolin,
serin, natrijumhidroksid, natrijumhlorid, natrijum-acetat,
kalijum-acetat,
magnezijum-acetat,
kalcijum-hlorid,
glukoza, natrijumdihidrogenfosfat, cinkacetat, trigliceridi,
srednje dužine lanca,
ulje soje
izoleucin, leucin, lizin,
metionin, fenilalanin,
treonin, triptofan, valin,
arginin, histidin, alanin,
glicin, aspartanska kis,
glutaminska kis, prolin,
serin, natrijumhidroksid, natrijumhlorid, natrijum-acetat,
kalijum-acetat,
magnezijum-acetat,
kalcijum-hlorid,
glukoza, natrijumdihidrogenfosfat, cinkacetat, trigliceridi,
srednje dužine lanca,
ulje soje
=DãWLüHQRLPH
leka
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
Cena leka na
veliko za
pakovanje
DDD
Participacija
Cena leka na osiguranog
veliko po DDD
lica
NUTRIFLEX LIPID
PLUS
kesa, 5 po 1875 ml
(2,256 g/l + 3,008 g/l +
2,728 g/l + 1,88 g/l +
3,368 g/l + 1,744 g/l +
0,544 g/l + 2,496 g/l +
2,592 g/l + 1,624 g/l +
4,656 g/l + 1,584 g/l +
1,44 g/l + 3,368 g/l +
3,264 g/l + 2,88 g/l +
0,781 g/l + 0,402 g/l +
0,222 g/l + 2,747 g/l +
0,686 g/l + 0,47 g/l + 132
g/l + 1,872 g/l + 5,264 g/l B.Braun Melsungen
emulzija za infuziju
+ 20 g/l + 20 g/l)
AG
1HPDþND
20.121,80
-
-
-
NUTRIFLEX LIPID
PLUS
kesa, 5 po 2500 ml
(2,256 g/l + 3,008 g/l +
2,728 g/l + 1,88 g/l +
3,368 g/l + 1,744 g/l +
0,544 g/l + 2,496 g/l +
2,592 g/l + 1,624 g/l +
4,656 g/l + 1,584 g/l +
1,44 g/l + 3,368 g/l +
3,264 g/l + 2,88 g/l +
0,781 g/l + 0,402 g/l +
0,222 g/l + 2,747 g/l +
0,686 g/l + 0,47 g/l + 132
g/l + 1,872 g/l + 5,264 g/l B.Braun Melsungen
emulzija za infuziju
+ 20 g/l + 20 g/l)
AG
1HPDþND
26.829,00
-
-
-
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0171326
0171327
ATC
INN
=DãWLüHQRLPH
leka
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
Cena leka na
veliko za
pakovanje
DDD
Participacija
Cena leka na osiguranog
veliko po DDD
lica
B05BA10
izoleucin, leucin, lizin,
metionin, fenilalanin,
treonin, triptofan, valin,
arginin, histidin, alanin,
glicin, aspartanska kis,
glutaminska kis, prolin,
serin, natrijumhidroksid, natrijumhlorid, natrijum-acetat,
kalijum-acetat,
magnezijum-acetat,
kalcijum-hlorid,
glukoza, natrijumdihidrogenfosfat, cinkacetat, trigliceridi,
srednje dužine lanca,
NUTRIFLEX LIPID
ulje soje
SPECIAL
kesa, 5 po 1250 ml
(3,284 g/l + 4,384 g/l +
3,98 g/l + 2,736 g/l +
4,916 g/l + 2,54 g/l + 0,8
g/l + 3,604 g/l + 3,78 g/l
+ 2,368 g/l + 6,792 g/l +
2,312 g/l + 2,1 g/l +
4,908 g/l + 4,76 g/l + 4,2
g/l + 1,171 g/l + 0,378 g/l
+ 0,25 g/l + 3,689 g/l +
0,91 g/l + 0,623 g/l +
158,4 g/l + 2,496 g/l +
7,024 g/l + 20 g/l + 20 B.Braun Melsungen
emulzija za infuziju
g/l)
AG
1HPDþND
20.540,90
-
-
-
B05BA10
izoleucin, leucin, lizin,
metionin, fenilalanin,
treonin, triptofan, valin,
arginin, histidin, alanin,
glicin, aspartanska kis,
glutaminska kis, prolin,
serin, natrijumhidroksid, natrijumhlorid, natrijum-acetat,
kalijum-acetat,
magnezijum-acetat,
kalcijum-hlorid,
glukoza, natrijumdihidrogenfosfat, cinkacetat, trigliceridi,
srednje dužine lanca,
NUTRIFLEX LIPID
ulje soje
SPECIAL
kesa, 5 po 1875 ml
(3,284 g/l + 4,384 g/l +
3,98 g/l + 2,736 g/l +
4,916 g/l + 2,54 g/l + 0,8
g/l + 3,604 g/l + 3,78 g/l
+ 2,368 g/l + 6,792 g/l +
2,312 g/l + 2,1 g/l +
4,908 g/l + 4,76 g/l + 4,2
g/l + 1,171 g/l + 0,378 g/l
+ 0,25 g/l + 3,689 g/l +
0,91 g/l + 0,623 g/l +
158,4 g/l + 2,496 g/l +
7,024 g/l + 20 g/l + 20 B.Braun Melsungen
emulzija za infuziju
g/l)
AG
1HPDþND
21.484,20
-
-
-
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0171328
ATC
B05BA10
NAPOMENA
B05BB
B05BB01
INN
=DãWLüHQRLPH
leka
izoleucin, leucin, lizin,
metionin, fenilalanin,
treonin, triptofan, valin,
arginin, histidin, alanin,
glicin, aspartanska kis,
glutaminska kis, prolin,
serin, natrijumhidroksid, natrijumhlorid, natrijum-acetat,
kalijum-acetat,
magnezijum-acetat,
kalcijum-hlorid,
glukoza, natrijumdihidrogenfosfat, cinkacetat, trigliceridi,
srednje dužine lanca,
NUTRIFLEX LIPID
ulje soje
SPECIAL
DDD
1HPDþND
29.064,80
-
-
-
Participacija
Cena leka na osiguranog
veliko po DDD
lica
Rastvori za elektrolitni disbalans
natrijum hlorid, kalijum hlorid, kalcijum hlorid
NATRII CHLORIDI
INFUNDIBILE
COMP. (Ringerov
rastv)
0175260
B05BB01
0175400
B05BB01
natrijum hlorid, kalijum
hlorid, kalcijum hlorid
RINGEROV
RASTVOR
natrijum hlorid, kalijum
hlorid, kalcijum hlorid
NATRII CHLORIDI
INFUNDIBILE
COMP. (Ringerov
rastv)
B05BB01
kesa, 5 po 2500 ml
(3,284 g/l + 4,384 g/l +
3,98 g/l + 2,736 g/l +
4,916 g/l + 2,54 g/l + 0,8
g/l + 3,604 g/l + 3,78 g/l
+ 2,368 g/l + 6,792 g/l +
2,312 g/l + 2,1 g/l +
4,908 g/l + 4,76 g/l + 4,2
g/l + 1,171 g/l + 0,378 g/l
+ 0,25 g/l + 3,689 g/l +
0,91 g/l + 0,623 g/l +
158,4 g/l + 2,496 g/l +
7,024 g/l + 20 g/l + 20 B.Braun Melsungen
emulzija za infuziju
g/l)
AG
Cena leka na
veliko za
pakovanje
STAC
natrijum hlorid, kalijum
hlorid, kalcijum hlorid
0175515
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
rastvor za infuziju
boca plasticna, 1 po 500
ml (8,6 g/l+0,3 g/l+ 0,33
g/l)
Hemofarm a.d.
Republika Srbija
90,70
-
-
-
rastvor za infuziju
boca, 1 po 500 ml (8,6
g/l+0,3 g/l+ 0,33 g/l)
Zdravlje a.d.
Republika Srbija
90,70
-
-
-
rastvor za infuziju
boca plasticna, 1 po 500
ml (8,6 g/l+0,3 g/l+ 0,33
g/l)
Hemomont d.o.o.
Republika Crna
Gora
90,70
-
-
-
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0175410
0175185
0400156
0400150
ATC
B05BB01
Država
=DãWLüHQRLPH
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
INN
leka
FO
leka
SURL]YRÿDþDOHND
leka
natrijum hlorid, kalijum hlorid, kalcijum hlorid, natrijum laktat
B05BB01
natrijum hlorid, kalijum
hlorid, kalcijum hlorid,
natrijum laktat
B05BB01
natrijum-hlorid, kalijumhlorid, kalcijum-hlorid, HARTMANOV
natrijum-laktat
RASTVOR
B05BC
B05BC01
manitol
B05BC01
manitol
B05BC01
HARTMANOV
RASTVOR
rastvor za infuziju
Zdravlje a.d.
Republika Srbija
99,40
-
-
-
rastvor za infuziju
boca, 1 po 500 ml (6,02
g/l + 0,373 g/l + 0,294 g/l
+ 3,25 g/l)
Hemofarm a.d.
Republika Srbija
99,40
-
-
-
Rastvori za osmotsku diurezu
manitol
MANITOL 20%
MANITOL 10%
rastvor za infuziju
boca staklena, 1 po 250
ml 20%
Hemofarm a.d.
Republika Srbija
151,10
-
-
-
rastvor za infuziju
boca staklena, 1 po 500
ml 10%
Hemofarm a.d.
Republika Srbija
163,20
-
-
-
Hemomont d.o.o.
Republika Crna
Gora
151,10
-
-
-
Hemomont d.o.o.
Republika Crna
Gora
163,20
-
-
-
Republika Srbija
1.315,70
-
-
-
0400430
B05BC01
manitol
MANITOL
rastvor za infuziju
0400431
B05BC01
manitol
MANITOL
rastvor za infuziju
boca staklena, 1 po 500
ml 10%
B05C
B05CX
B05CX10
manitol, sorbitol
B05CX10
manitol, sorbitol
Rastvori za ispiranje
Ostali rastvori za ispiranje
ISPIROL
B05D
9175730
9175731
DDD
Participacija
Cena leka na osiguranog
veliko po DDD
lica
boca, 1 po 500 ml (6,02
g/l + 0,373 g/l + 0,294 g/l
+ 3,25 g/l)
boca staklena, 1 po 250
ml 20%
9175213
Cena leka na
veliko za
pakovanje
rastvor za ispiranje
bešike
kesa, 5 l (5,4 g/l + 27 g/l)
Hemofarm a.d.
Rastvori za peritonealnu dijalizu
B05D...
glukoza, natrijumhlorid, natrijum-laktat,
kalcijum-hlorid,
magnezijum-hlorid
B05D...
glukoza, natrijumhlorid, natrijum-laktat,
kalcijum-hlorid,
magnezijum-hlorid
DIANEAL PD4
SODVWLþQDNHVDSR
ml (13,6 g/l+5,38
rastvor za
g/l+4,48 g/l+0,184
Baxter Healthcare
peritonealnu dijalizu
g/l+0,051 g/l)
S.A.
Irska
798,30
-
-
-
DIANEAL PD4
SODVWLþQDNHVDSR
ml (13,6 g/l+5,38
rastvor za
g/l+4,48 g/l+0,184
Baxter Healthcare
peritonealnu dijalizu
g/l+0,051 g/l)
S.A.
Irska
919,00
-
-
-
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
9175732
9175733
9175734
9175735
9175736
9175737
9175738
ATC
INN
B05D...
glukoza, natrijumhlorid, natrijum-laktat,
kalcijum-hlorid,
magnezijum-hlorid
B05D...
glukoza, natrijumhlorid, natrijum-laktat,
kalcijum-hlorid,
magnezijum-hlorid
B05D...
glukoza, natrijumhlorid, natrijum-laktat,
kalcijum-hlorid,
magnezijum-hlorid
B05D...
glukoza, natrijumhlorid, natrijum-laktat,
kalcijum-hlorid,
magnezijum-hlorid
B05D...
glukoza, natrijumhlorid, natrijum-laktat,
kalcijum-hlorid,
magnezijum-hlorid
B05D...
glukoza, natrijumhlorid, natrijum-laktat,
kalcijum-hlorid,
magnezijum-hlorid
B05D...
glukoza, natrijumhlorid, natrijum-laktat,
kalcijum-hlorid,
magnezijum-hlorid
=DãWLüHQRLPH
leka
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
Cena leka na
veliko za
pakovanje
DDD
Participacija
Cena leka na osiguranog
veliko po DDD
lica
DIANEAL PD4
SODVWLþQDNHVDSR
ml (13,6 g/l+5,38
rastvor za
g/l+4,48 g/l+0,184
Baxter Healthcare
peritonealnu dijalizu
g/l+0,051 g/l)
S.A.
Irska
1.273,70
-
-
-
DIANEAL PD4
SODVWLþQDNHVDSR
ml (22,7 g/l+5,38
rastvor za
g/l+4,48 g/l+0,184
Baxter Healthcare
peritonealnu dijalizu
g/l+0,051 g/l)
S.A.
Irska
798,30
-
-
-
DIANEAL PD4
SODVWLþQDNHVDSR
ml (22,7 g/l+5,38
rastvor za
g/l+4,48 g/l+0,184
Baxter Healthcare
peritonealnu dijalizu
g/l+0,051 g/l)
S.A.
Irska
919,00
-
-
-
DIANEAL PD4
SODVWLþQDNHVDSR
ml
rastvor za
(22.7g/l+5.38g/l+4.48g/l+ Baxter Healthcare
peritonealnu dijalizu
0.184g/l+0.051g/l)
S.A.
Irska
1.273,70
-
-
-
DIANEAL PD4
SODVWLþQDNHVDSR
ml
rastvor za
(38.6g/l+5.38g/l+4.48g/l+ Baxter Healthcare
peritonealnu dijalizu
0.184g/l+0.051g/l)
S.A.
Irska
798,30
-
-
-
DIANEAL PD4
SODVWLþQDNHVDSR
ml
rastvor za
(38.6g/l+5.38g/l+4.48g/l+ Baxter Healthcare
peritonealnu dijalizu
0.184g/l+0.051g/l)
S.A.
Irska
919,00
-
-
-
DIANEAL PD4
SODVWLþQDNHVDSR
ml
rastvor za
(38.6g/l+5.38g/l+4.48g/l+ Baxter Healthcare
S.A.
peritonealnu dijalizu
0.184g/l+0.051g/l)
Irska
1.273,70
-
-
-
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
9175739
9175741
9175716
9175717
9175718
9175743
ATC
INN
=DãWLüHQRLPH
leka
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
Cena leka na
veliko za
pakovanje
DDD
Participacija
Cena leka na osiguranog
veliko po DDD
lica
B05D...
tirozin, triptofan,
fenilalanin, treonin,
serin, prolin, glicin,
alanin, valin, metionin,
izoleucin, leucin, lizin,
histidin, arginin,
kalcijum-hlorid,
magnezijum-hlorid,
natrijum-laktat, natrijumhlorid
NUTRINEAL PD4
SODVWLþQDNHVDSR
ml
(0.3g/l+0.27g/l+0.57g/l+0
.646g/l+0.51g/l+0.595g/l
+0.51g/l+0.951g/l+1.393
g/l+0.85g/l+0.85g/l+1.02
g/l+0.955g/l+0.714g/l+1.
rastvor za
071g/l+0.184g/l+0.0508g Baxter Healthcare
peritonealnu dijalizu
/l+4.48g/l+5.38g/l
S.A.
Irska
1.538,90
-
-
-
B05D...
ikodekstrin, natrijumhlorid, natrijum(S)laktat, kalcijum-hlorid,
magnezijum-hlorid
SODVWLþQDNHVDSR
ml
rastvor za
(75g/l+5.4g/l+4.5g/l+0.25 Baxter Healthcare
peritonealnu dijalizu
7g/l+0.051g/l)
S.A.
Irska
2.241,30
-
-
-
B05DB..
kesa, 4 po 2000 ml
natrijum-hlorid, natrijumlaktat, kalcijum-hlorid, BALANCE 1.5%
(5.64g/l + 3.925g/l +
magnezijum-hlorid,
glukoze,1.25 mmol/l
rastvor za
0.1838g/l + 0.1017g/l +
glukoza
kalcijuma
peritonealnu dijalizu
15g/l)
Fresenius Medical
Care Deutschland
GmbH
1HPDþND
2.517,10
-
-
-
B05DB..
kesa, 4 po 2000 ml
natrijum-hlorid, natrijumlaktat, kalcijum-hlorid, BALANCE 2.3%
(5.64g/l + 3.925g/l +
magnezijum-hlorid,
glukoze,1.25 mmol/l
rastvor za
0.1838g/l + 0.1017g/l +
glukoza
kalcijuma
peritonealnu dijalizu
22.73g/l)
Fresenius Medical
Care Deutschland
GmbH
1HPDþND
2.517,10
-
-
-
B05DB..
kesa, 4 po 2000 ml
natrijum-hlorid, natrijumlaktat, kalcijum-hlorid, BALANCE 4.25%
(5.64g/l + 3.925g/l +
magnezijum-hlorid,
glukoze,1.25 mmol/l
rastvor za
0.1838g/l + 0.1017g/l +
glukoza
kalcijuma
peritonealnu dijalizu
42,5 g/l)
Fresenius Medical
Care Deutschland
GmbH
1HPDþND
2.517,10
-
-
-
B05DB..
natrijum-hlorid, natrijumlaktat, kalcijum-hlorid, BALANCE 1.5%
kesa, 4 po 2000 ml (5.64
magnezijum-hlorid,
glukoze,1.75 mmol/l
rastvor za
g/l + 3.925 g/l + 0.2573
glukoza
kalcijuma
peritonealnu dijalizu g/l + 0.1017 g/l + 15 g/l)
Fresenius Medical
Care Deutschland
GmbH
1HPDþND
2.517,10
-
-
-
EXTRANEAL
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
9175744
9175745
9175720
9175722
9175724
9175753
9175755
ATC
INN
=DãWLüHQRLPH
leka
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
Cena leka na
veliko za
pakovanje
DDD
Participacija
Cena leka na osiguranog
veliko po DDD
lica
B05DB..
natrijum-hlorid, natrijumkesa, 4 po 2000 ml
laktat, kalcijum-hlorid, BALANCE 2.3%
(5.64g/l + 3.925g/l +
magnezijum-hlorid,
glukoze,1.75 mmol/l
rastvor za
0.2573g/l + 0.1017g/l +
glukoza
kalcijuma
peritonealnu dijalizu
22.73g/l)
Fresenius Medical
Care Deutschland
GmbH
1HPDþND
2.517,10
-
-
-
B05DB..
kesa, 4 po 2000 ml
natrijum-hlorid, natrijumlaktat, kalcijum-hlorid, BALANCE 4.25%
(5.64g/l + 3.925g/l +
magnezijum-hlorid,
glukoze,1.75 mmol/l
rastvor za
0.2573g/l + 0.1017g/l +
glukoza
kalcijuma
peritonealnu dijalizu
42.5g/l)
Fresenius Medical
Care Deutschland
GmbH
1HPDþND
2.517,10
-
-
-
B05DB..
natrijum-hlorid, natrijumlaktat, kalcijum-hlorid,
magnezijum-hlorid,
glukoza
CAPD 17 Stay safe
kesa, 4 po 2000 ml
(5.786g/l + 7.847g/l +
rastvor za
0.1838g/l + 0.1017g/l +
peritonealnu dijalizu
15g/l)
Fresenius Medical
Care Deutschland
GmbH
1HPDþND
2.269,40
-
-
-
B05D..
natrijum-hlorid, natrijumlaktat, kalcijum-hlorid,
magnezijum-hlorid,
glukoza
CAPD 18 Stay safe
kesa, 4 po 2000 ml
(5.786g/l + 7.847g/l +
rastvor za
0.1838g/l + 0.1017g/l +
peritonealnu dijalizu
42.5g/l)
Fresenius Medical
Care Deutschland
GmbH
1HPDþND
2.269,40
-
-
-
B05D..
natrijum-hlorid, natrijumlaktat, kalcijum-hlorid,
magnezijum-hlorid,
glukoza
CAPD 19 Stay safe
kesa, 4 po 2000 ml
(5.786g/l + 7.847g/l +
rastvor za
0.1838g/l + 0.1017g/l +
peritonealnu dijalizu
22.73g/l)
Fresenius Medical
Care Deutschland
GmbH
1HPDþND
2.269,40
-
-
-
B05DB..
natrijum-hlorid, natrijumlaktat, kalcijum-hlorid,
magnezijum-hlorid,
glukoza
CAPD 2 Stay safe
kesa, 4 po 2000 ml
(5.786g/l + 7.847g/l +
rastvor za
0.2573g/l + 0.1017g/l +
peritonealnu dijalizu
15g/l)
Fresenius Medical
Care Deutschland
GmbH
1HPDþND
2.440,30
-
-
-
B05DB..
natrijum-hlorid, natrijumlaktat, kalcijum-hlorid,
magnezijum-hlorid,
glukoza
CAPD 3 Stay safe
kesa, 4 po 2000 ml
(5.786g/l + 7.847g/l +
rastvor za
0.2573g/l + 0.1017g/l +
peritonealnu dijalizu
42,5g/l)
Fresenius Medical
Care Deutschland
GmbH
1HPDþND
2.440,30
-
-
-
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
9175757
9175754
9175756
9175758
9175721
9175723
9175725
ATC
INN
=DãWLüHQRLPH
leka
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
Cena leka na
veliko za
pakovanje
DDD
Participacija
Cena leka na osiguranog
veliko po DDD
lica
B05DB..
natrijum-hlorid, natrijumlaktat, kalcijum-hlorid,
magnezijum-hlorid,
glukoza
CAPD 4 Stay safe
kesa, 4 po 2000 ml
(5.786g/l + 7.847g/l +
rastvor za
0.2573g/l + 0.1017g/l +
peritonealnu dijalizu
22.73g/l)
Fresenius Medical
Care Deutschland
GmbH
1HPDþND
2.440,30
-
-
-
B05DB..
natrijum-hlorid, natrijumlaktat, kalcijum-hlorid,
magnezijum-hlorid,
glukoza
CAPD 2 Stay safe
kesa, 4 po 2500 ml
(5.786g/l + 7.847g/l +
rastvor za
0.2573g/l + 0.1017g/l +
peritonealnu dijalizu
15g/l)
Fresenius Medical
Care Deutschland
GmbH
1HPDþND
3.089,20
-
-
-
B05DB..
natrijum-hlorid, natrijumlaktat, kalcijum-hlorid,
magnezijum-hlorid,
glukoza
CAPD 3 Stay safe
kesa, 4 po 2500 ml
(5.786g/l + 7.847g/l +
rastvor za
0.2573g/l + 0.1017g/l +
peritonealnu dijalizu
42,5g/l)
Fresenius Medical
Care Deutschland
GmbH
1HPDþND
3.089,20
-
-
-
B05DB..
natrijum-hlorid, natrijumlaktat, kalcijum-hlorid,
magnezijum-hlorid,
glukoza
CAPD 4 Stay safe
kesa, 4 po 2500 ml
(5.786g/l + 7.847g/l +
rastvor za
0.2573g/l + 0.1017g/l +
peritonealnu dijalizu
22.73g/l)
Fresenius Medical
Care Deutschland
GmbH
1HPDþND
3.089,20
-
-
-
B05DB..
natrijum-hlorid, natrijumlaktat, kalcijum-hlorid,
magnezijum-hlorid,
glukoza
CAPD 17 Stay safe
kesa, 4 po 2500 ml
(5.786g/l + 7.847g/l +
rastvor za
0.1838g/l + 0.1017g/l +
peritonealnu dijalizu
15g/l)
Fresenius Medical
Care Deutschland
GmbH
1HPDþND
2.836,70
-
-
-
B05D..
natrijum-hlorid, natrijumlaktat, kalcijum-hlorid,
magnezijum-hlorid,
glukoza
CAPD 18 Stay safe
kesa, 4 po 2500 ml
(5.786g/l + 7.847g/l +
rastvor za
0.1838g/l + 0.1017g/l +
peritonealnu dijalizu
42.5g/l)
Fresenius Medical
Care Deutschland
GmbH
1HPDþND
2.836,70
-
-
-
B05D..
natrijum-hlorid, natrijumlaktat, kalcijum-hlorid,
magnezijum-hlorid,
glukoza
CAPD 19 Stay safe
kesa, 4 po 2500 ml
(5.786 g/l + 7.847g/l +
rastvor za
0.1838g/l + 0.1017g/l +
peritonealnu dijalizu
22.73g/l)
Fresenius Medical
Care Deutschland
GmbH
1HPDþND
2.836,70
-
-
-
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
9175117
9175119
9175118
9175726
9175727
9175728
9175729
ATC
INN
=DãWLüHQRLPH
leka
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
Cena leka na
veliko za
pakovanje
DDD
Participacija
Cena leka na osiguranog
veliko po DDD
lica
B05DB..
natrijum-hlorid, natrijumlaktat, kalcijum-hlorid,
magnezijum-hlorid,
glukoza
CAPD 2 Sleep safe
kesa, 2 po 5000 ml
(5.786 g/l + 7.847 g/l +
rastvor za
0.2573g/l + 0.1017g11 +
peritonealnu dijalizu
15 g/l)
Fresenius Medical
Care Deutschland
GmbH
1HPDþND
2.615,10
-
-
-
B05DB..
natrijum-hlorid, natrijumlaktat, kalcijum-hlorid,
magnezijum-hlorid,
glukoza
CAPD 3 Sleep safe
kesa, 2 po 5000 ml
(5.786 g/l + 7.847 g/l +
rastvor za
0.2573g/l + 0.1017g/l +
peritonealnu dijalizu
42.5 g/ll)
Fresenius Medical
Care Deutschland
GmbH
1HPDþND
2.615,10
-
-
-
B05DB..
natrijum-hlorid, natrijumlaktat, kalcijum-hlorid,
magnezijum-hlorid,
glukoza
CAPD 4 Sleep safe
kesa, 2 po 5000 ml
(5.786 g/l+ 7.847 g/l +
rastvor za
0.2573g/l + 0.1017g/l +
peritonealnu dijalizu
22.73 g/l
Fresenius Medical
Care Deutschland
GmbH
1HPDþND
2.615,10
-
-
-
B05D...
glukoza, natrijumhlorid, natrijum-laktat,
kalcijum-hlorid,
magnezijum-hlorid
GAMBROSOL trio
10
SODVWLþQDNHVDSR
2000 ml (500g/l + 5.38g/l
rastvor za
+ 4.72g/l + 0.271g/l +
peritonealnu dijalizu
0.054g/l)
Dialifluids S.R.L.
Italija
779,20
-
-
-
B05D...
glukoza, natrijumhlorid, natrijum-laktat,
kalcijum-hlorid,
magnezijum-hlorid
GAMBROSOL trio
10
SODVWLþQDNHVDSR
5000 ml (500g/l + 5.38g/l
rastvor za
+ 4.72g/l + 0.271g/l +
peritonealnu dijalizu
0.054g/l)
Dialifluids S.R.L.
Italija
1.050,80
-
-
-
B05D...
glukoza, natrijumhlorid, natrijum-laktat,
kalcijum-hlorid,
magnezijum-hlorid
GAMBROSOL trio
40
SODVWLþQDNHVDSR
2000 ml (500g/l + 5.38g/l
rastvor za
+ 4.72g/l + 0.209g/l +
peritonealnu dijalizu
0.054g/l)
Dialifluids S.R.L.
Italija
779,20
-
-
-
B05D...
glukoza, natrijumhlorid, natrijum-laktat,
kalcijum-hlorid,
magnezijum-hlorid
GAMBROSOL trio
40
SODVWLþQDNHVDSR
5000 ml (500g/l + 5.38g/l
rastvor za
+ 4.72g/l + 0.209g/l +
peritonealnu dijalizu
0.054g/l)
Dialifluids S.R.L.
Italija
1.050,80
-
-
-
/LVWD%*UXSD%/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0175150
0133110
0175510
0175180
0175240
0175516
0175312
0175582
0175581
0174050
ATC
B05X
B05XA
B05XA01
kalijum hlorid
B05XA01
kalijum hlorid
B05XA02
natrijum hidrogenkarbonat
B05XA02
natrijum
hidrogenkarbonat
B05XA03
natrijum hlorid
B05XA03
B05XA03
B05XA03
B05XA03
B05XA03
B05XA03
B05XA03
Fresenius Kabi
Norge
Norveška
972,70
-
-
-
NATRIUMBICARBO
NAT FRESENIUS
8,4%
rastvor za infuziju
ERþLFDSRPO
Fresenius Kabi
Austria GmbH
Austrija
2.488,40
-
-
-
natrijum hlorid
NATRII CHLORIDI
INFUNDIBILE
rastvor za infuziju
boca staklena, 1 po 500
ml 9g/l
Hemomont d.o.o.
Republika Crna
Gora
82,60
-
-
-
natrijum hlorid
NATRII CHLORIDI
INFUNDIBILE
rastvor za infuziju
ERFDSODVWLþQDSR
ml 9g/l
Zdravlje a.d.
Republika Srbija
82,60
-
-
-
natrijum hlorid
NATRII CHLORIDI
INFUNDIBILE
rastvor za infuziju
ERFDSODVWLþQDSR
ml 0,9%
Hemofarm a.d.
Republika Srbija
82,60
-
-
-
natrijum hlorid
NATRII CHLORIDI
INFUNDIBILE
rastvor za infuziju
boca staklena , 1 po 250
ml (9g/l)
Republika Crna
Gora
67,50
-
-
-
natrijum hlorid
SODIUM CHLORIDE
0.9%
rastvor za infuziju
1HPDþND
Rumunija;
Španija
1.336,40
-
-
-
natrijum hlorid
boca staklena, 49 po 100 Fresenius Kabi Italia
SODIUM CHLORIDE rastvor za infuziju
ml (9g/l)
S.R.L.
Italija
3.274,30
-
-
-
natrijum hlorid
boca staklena, 1 po 500 Fresenius Kabi Italia
ml (9g/l)
S.R.L.
Italija
82,60
-
-
-
Austrija
34.281,00
-
-
-
Švedska
3.320,20
-
-
-
B05XB02
alanil glutamin
B05XC..
NAPOMENA
DDD
Participacija
Cena leka na osiguranog
veliko po DDD
lica
20 po 20 ml (1 mmol/ml)
alanil glutamin
KALIUM CHLORID
FRESENIUS
Država
Cena leka na
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
veliko za
FO
leka
SURL]YRÿDþDOHND
leka
pakovanje
Rastvori za intravensku primenu, kao dopunska terapijska sredstva
Rastvori elektrolita
koncentrat za
rastvor za infuziju
B05XB
B05XB02
NAPOMENA
B05XC
B05XC..
0052720
INN
=DãWLüHQRLPH
leka
SODIUM CHLORIDE rastvor za infuziju
ERFDSODVWLþQDSR
100 ml (9g/l)
Hemomont d.o.o.
AG; B. Braun
Pharmaceuticals
S.A.; B. Braun
Medical SA
Aminokiseline
DIPEPTIVEN
koncentrat za
rastvor za infuziju
boca, 10 po 100 ml (20
g/100 ml)
Fresenius Kabi
Austria GMBH
STAC
Vitamini
askorbinska kiselina, nikotinamid
askorbinska kiselina,
nikotinamid
STAC
SOLUVIT N
prašak za rastvor
za infuziju
ERþLFDVWDNOHQDSR
10 ml
Fresenius Kabi AB
/LVWD%*UXSD&/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0100250
ATC
INN
C
C01
C01A
C01AA
C01AA05 digoksin
C01AA05
digoksin
Cena leka
Država
na veliko
=DãWLüHQRLPH
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
za
leka
FO
leka
SURL]YRÿDþDOHND
leka
pakovanje
DDD
KARDIOVASKULARNI SISTEM (LEKOVI KOJI DELUJU NA KARDIOVASKULARNI SISTEM)
TERAPIJA BOLESTI SRCA
6UþDQLJOLNR]LGL
Glikozidi digitalisa
DILACOR
rastvor za
injekciju/infuziju
Republika Srbija
164,20
0,25 mg
27,37
-
koncentrat za rastvor ampula, 5 po 3 ml (150 Ebewe Pharma Ges.
za infuziju
mg/3ml)
M.B.H NFG. KG
Austrija
346,20
0,2 g
92,32
-
ampula, 6 po 3 ml (150
mg/3 ml)
Francuska
415,40
0,2 g
92,31
-
C01B
C01BD
C01BD01 amjodaron
C01BD01
amjodaron
SEDACORON
0101355
C01BD01
amjodaron
CORDARONE
rastvor za injekciju
dopamin
Sanofi Winthrop
Industrie
6WLPXODQVLVUþDQRJUDGDLVNOMXþXMXüLVUþDQHJOLNR]LGH
$GUHQHUJLþNDLGRSDPLQHUJLþNDVUHGVWYD
C01C
C01CA
C01CA04 dopamin
C01CA04
Zdravlje a.d.
Antiaritmici, grupa I i III
Antiaritmici, grupa III
0101441
0105146
ampula, 6 po 2 ml
(0,25 mg/2ml)
Cena leka Participacija
na veliko osiguranog
po DDD
lica
DOPAMIN
ADMEDA 50
Haupt Pharma
Wulfing GmbH,
koncentrat za rastvor ampula, 5 po 5 ml (50 1HPDþND]D$GPHGD
za infuziju
mg/5 ml)
Arzneimittel GmbH
1HPDþND
490,90
0,5 g
981,80
-
1HPDþND
481,00
0,5 g
962,00
-
Republika Srbija
2.165,60
0,5 g
21.656,00
-
C01CA07 dobutamin
0105401
C01CA07
dobutamin
DOBUTAMIN
ADMEDA 250
koncentrat za rastvor
za infuziju
ampula, 1 po 50 ml
(250 mg/50 ml)
Haupt Pharma
Wulfing GmbH,
1HPDþND]D$GPHGD
Arzneimittel GmbH
injekcija
50 po 1 mg/1 ml
Jugoremedija a.d.
C01CA24 adrenalin (epinefrin)
0105031
C01CA24
epinefrin
(adrenalin)
ADRENALIN HCL
1:1000
/LVWD%*UXSD&/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
=DãWLüHQRLPH
leka
ATC
INN
C01D
C01DA
C01DA02 gliceriltrinitrat (nitroglicerin)
FO
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
Vazodilatatori u terapiji bolesti srca
Organski nitrati
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
0102182
C01DA02
gliceriltrinitrat
(nitroglicerin)
NIRMIN
rastvor za injekciju
ampula, 50 po 1,6 ml
(1 mg/1,6 ml)
Hemofarm a.d.
Republika Srbija
887,00
-
-
-
0102180
C01DA02
gliceriltrinitrat
(nitroglicerin)
NIRMIN
koncentrat za rastvor
za infuziju
ampula, 50 po 1,6 ml
(5 mg/1,6 ml)
Hemofarm a.d.
Republika Srbija
2.147,50
-
-
-
C02
C02C
C02CA
C02CA06 urapidil
ANTIHIPERTENZIVI
Antiadrenergici sa perifernim delovanjem
$QWDJRQLVWLDOIDDGUHQHUJLþNLKUHFHSWRUD
0103290
C02CA06
urapidil
EBRANTIL 25
injekcija
5 po 25 mg/5 ml
Nycomed GmbH
1HPDþND
1.660,30
50 mg
664,12
-
0103291
C02CA06
urapidil
EBRANTIL 50
injekcija
5 po 50 mg/10 ml
Nycomed GmbH
1HPDþND
1.660,30
50 mg
332,06
-
NAPOMENA
STAC
C03
C03C
C03CA
C03CA01 furosemid
0400411
C03CA01
furosemid
DIURETICI
Snažni diuretici (Henleove petlje)
Sulfonamidski diuretici, monokomponentni
FUROSEMIDE
,9$1ý,û
rastvor za injekciju
ampula, 10 po 2 ml (10
mg/ml)
Sopharma PLC
Bugarska
345,60
40 mg
69,12
-
rastvor za
injekciju/infuziju
ampula, 10 po 2 ml
(0,5 mg/2 ml)
Hemofarm a.d.
Republika Srbija
105,00
1 mg
21,00
-
255,10
0,15 g
1.530,60
-
C03CA02 bumetanid
0400040
C03CA02
bumetanid
YURINEX
%/2.$725,%(7$$'5(1(5*,ý.,+5(&(3725$
%HWDDGUHQHUJLþNLEORNDWRUL
%HWDDGUHQHUJLþNLEORNDWRULVHOHNWLYQL
C07
C07A
C07AB
C07AB02 metoprolol
0107497
C07AB02
metoprolol
PRESOLOL
rastvor za injekciju
ampula, 5 po 5 ml (5
mg/5 ml)
Hemofarm a.d.
Republika Srbija
/LVWD%*UXSD&/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0402102
ATC
INN
C08
C08C
C08CA
C08CA06 nimodipin
C08CA06
nimodipin
=DãWLüHQRLPH
leka
NIMOTOP S
FO
rastvor za infuziju
Država
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
leka
SURL]YRÿDþDOHND
leka
BLOKATORI KALCIJUMSKIH KANALA
Selektivni blokatori kalcijumskih kanala
Derivati dihidropiridina
ERþLFDSRPO
mg
Bayer Schering
Pharma AG
1HPDþND
Cena leka
na veliko
za
pakovanje
DDD
1.298,50
50 mg
129,85
-
0,24 g
2.158,56
-
30 mg
47,11
-
Cena leka Participacija
na veliko osiguranog
po DDD
lica
67$&6DPR]DOHþHQMHEROHVQLNDVDVXEDUDKQRLGDOQLPNUYDUHQMHP
NAPOMENA
C08D
Selektivni blokatori kalcijumskih kanala sa direktnim delovanjem na srce
C08DA
Derivati fenilalkilamina
C08DA01 verapamil
0402721
C08DA01
verapamil
VERAPAMIL
ALKALOID
C09
C09A
C09AA
C09AA15 zofenopril
1103462
C09AA15
INDIKACIJE
zofenopril
rastvor za
injekciju/infuziju
ampula, 10 po 2 ml (5
mg/2 ml)
Alkaloid a.d.
Makedonija
449,70
LEKOVI KOJI DELUJU NA RENIN-ANGIOTENZIN SISTEM
,QKLELWRULDQJLRWHQ]LQNRQYHUWXMXüHJHQ]LPD$&(PRQRNRPSRQHQWQL
Inhibitori ACE, monokomponentni
ZOFECARD
film tableta
blister, 28 po 7,5 mg
y
GmbH; A. Menarini
Manufacturing
Logistics and
Services S.R.L.
1HPDþND,WDOLMD
329,80
Hipertenzija:
Zofenopril je indikovan u terapiji blage do umerene esencijalne hipertenzije.
Akutni infarkt miokarda:
=RIHQRSULOMHLQGLNRYDQXWHUDSLMLNRMDMH]DSRþHODXSUYLKVDWDNRGSDFLMHQDWDVDDNXWQLPLQIDUNWRPPLRNDUGDVDLOLEH]]QDNRYDLVLPSWRPDVUþDQH
LQVXILFLMHQFLMHNRMLVXKHPRGLQDPVNLVWDELOQLLQHSULPDMXWURPEROLWLþNXWHUDSLMX
/LVWD%*UXSD'/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYWYHQLPXVWDQRYDPD
JKL
ATC
INN
D
D08
D08A
D08AG
D08AG02 povidon jod
=DãWLüHQRLPH
leka
Cena leka
Država
na veliko
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
za
FO
leka
SURL]YRÿDþDOHND
leka
pakovanje
/(.29,=$/(ý(1-(%2/(67,.2ä(,327.2ä12*7.,9$'(50$7,&,
ANTISEPTICI I DEZINFICIJENSI
Antiseptici i dezinficijensi
Proizvodi sa jodom
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
4156151
D08AG02
povidon jod
POVIDON JOD
pena za kožu
NRQWHMQHUSODVWLþQL
po 500 ml (7,5%)
Hemofarm a.d.
Republika Srbija
407,40
-
-
-
4156150
D08AG02
povidon jod
POVIDON JOD
rastvor za kožu
NRQWHMQHUSODVWLþQL
po 500 ml (10%)
Hemofarm a.d.
Republika Srbija
407,40
-
-
-
4156152
D08AG02
povidon jod
POVIDON JOD
pena za kožu
NRQWHMQHUSODVWLþQL
po 5000ml (7,5%)
Hemofarm a.d.
Republika Srbija
4.074,00
-
-
-
ERþLFDSRPO
(10 %)
Alkaloid a.d. u
saradnji sa
Mundipharma AG,
Švajcarska
Republika
Makedonija
814,80
-
-
-
4156163
D08AG02
povidon
BETADINE
rastvor za kožu
/LVWD%*UXSD*/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0141132
0141135
ATC
INN
G
G02
G02A
G02AB
G02AB01 metilergometrin
G02AB01
G02AB01
Cena leka
Država
na veliko
Cena leka
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
za
na veliko
=DãWLüHQRLPHOHND
FO
leka
SURL]YRÿDþDOHND
leka
pakovanje
DDD
po DDD
*(1,7285,1$51,6,67(0,32/1,+25021,/(.29,=$/(ý(1-(*(1,7285,1$512*6,67(0$,32/1,+25021,
OSTALI GINEKOLOŠKI LEKOVI
Preparati za kontrakciju uterusa
Ergot alkaloidi
Participacija
osiguranog
lica
metilergometrin
METHYLERGOMETRI
N
injekcija
50 po 0,1 mg/1 ml
Hemofarm a.d.
Republika Srbija
563,10
0,2 mg
22,52
-
metilergometrin
METHYLERGOMETRI
N
injekcija
50 po 0,2 mg/1 ml
Hemofarm a.d.
Republika Srbija
1.134,50
0,2 mg
22,69
-
Prostaglandini
G02AD
G02AD02 dinoproston (PGE2)
4143125
G02AD02
dinoproston (PGE2)
PREPIDIL GEL
endocervikalni gel
napunjeni injekcioni
špric, 1 po 3 g
(0,5 mg/3g)
6143120
G02AD02
dinoproston (PGE2)
PROSTIN E2
vaginalna tableta
4 po 3 mg
Sanico N.V.
Belgija
4.537,10
0,5 mg
189,05
-
rastvor za injekciju
1 po 0,25 mg/ml
Pfizer Manufacturing
Belgium NV
Belgija
1.084,90
2,5 mg
10.849,00
-
634,60
-
-
-
718,10
18 mg
10,34
-
Pfizer Manufacturing
Belgium NV
Belgija
1.875,60
0,5 mg
312,60
-
STAC
NAPOMENA
G02AD04 karboprost (PGM15)
0143043
G02AD04
karboprost (PGM15) PROSTIN 15M
STAC
NAPOMENA
G02C
G02CA
G02CA03 fenoterol
0142102
G02CA03
fenoterol
Ostali ginekološki preparati
6LPSDWLNRPHWLFLNRGSUHYUHPHQRJSRURÿDMDWRNROLWLFL
PARTUSISTEN
koncentrat za rastvor
za infuziju
G03BA03
testosteron enantat
TESTOSTERON
DEPO
Boehringer Ingelheim
Espana S.A.
Španija
POLNI HORMONI I MODULATORI GENITALNOG SISTEMA
Androgeni
Derivati 3-androst-4ona
G03
G03B
G03BA
G03BA03 testosteron enantat
0048619
ampula, 5 po 10 ml
(0.5 mg/10 ml)
injekcija
5 po 250 mg/ml
Galenika a.d.
Republika Srbija
/LVWD%*UXSD*/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0048468
ATC
INN
=DãWLüHQRLPHOHND
G03D
G03DA
G03DA03 hidroksiprogesteron
G03DA03
hidroksiprogesteron
PROGESTERON
DEPO
FO
3DNRYDQMHLMDþLQD
Naziv
leka
SURL]YRÿDþDOHND
Gestageni
Derivati pregnena
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
rastvor za injekciju
5 po 250 mg/ml
Galenika a.d.
Republika Srbija
557,70
10 mg
4,46
-
vaginalni gel
aplikator, 1 po 15 (90
mg/1,125 g)
Fleet Laboratories
Ltd.
Velika Britanija
3.623,30
90 mg
241,55
-
G03DA04 progesteron
4137040
G03DA04
progesteron
CRINONE
=DOHþHQMHQHSORGQRVWLQDVWDOHXVOHGQHDGHNYDWQHOXWHDOQHID]H1
INDIKACIJE
2. U toku invitro oplodnje (N97).
G03G
Gonadotropini i drugi stimulatori ovulacije
G03GA
Gonadotropini
G03GA01 horiogonadotropin
0044143
G03GA01
horiogonadotropin
PREGNYL
injekcija
3 po 1500 i.j. sa rastv.
N.V. Organon
Holandija
406,00
250 i.j.
22,56
-
0044142
G03GA01
horiogonadotropin
PREGNYL
injekcija
3 po 5000 i.j. sa rastv.
N.V. Organon
Holandija
1.030,80
250 i.j.
17,18
-
N.V. Organon
Holandija
343,60
250 i.j.
17,18
-
Ferring GmbH
1HPDþND
18.161,40
30 i.j.
726,46
-
IBSA Institut
Biochemique S.A.
Švajcarska
1.821,50
30 i.j.
728,60
-
0044144
G03GA01
NAPOMENA
G03GA02
0044086
0044400
G03GA02
G03GA02
INDIKACIJE
NAPOMENA
horiogonadotropin
PREGNYL
lioampula sa
SUDãDNLUDVWYDUDþ]D UDVWYDUDþHPSRPO
rastvor za injekciju
(5000 i.j./1ml)
Po preporuci endokrinologa i ginekologa, kao dijagnostik i terapeutik.
menotrofin ( humani menopauzalni gonadotropin )
menotrofin
menotrofin
ERþLFDSRLMVD
10 amp. po 1ml
UDVWYDUDþD
MENOPUR
SUDãDNLUDVWYDUDþ]D
rastvor za injekciju
MERIONAL
OLRERþLFDVD
UDVWYDUDþHPXDPSXOL
SUDãDNLUDVWYDUDþ]D
1 po 1ml (75 i.j.
rastvor za injekciju
FSH/75 i.j. LH)
6HNXQGDUQLKLSRJRQDGRWURSL]DPKLSRWDODPXVQRLLOLSLWXLWDUQRRãWHüHQMH
Lek se uvodi u terapiju na osnovu mišljenja endokrinologa zdravstvene ustanove koja obavlja zdravstvenu delatnost na tercijarnom nivou.
/LVWD%*UXSD*/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0044412
ATC
INN
G03GA04 urofolitropin
G03GA04
INDIKACIJE
NAPOMENA
G03GA05
urofolitropin
=DãWLüHQRLPHOHND
FOSTIMON
FO
3DNRYDQMHLMDþLQD
Naziv
leka
SURL]YRÿDþDOHND
OLRERþLFDVD
SUDãDNLUDVWYDUDþ]D UDVWYDUDþHPXDPSXOL
rastvor za injekciju
1 po 1 ml (75 i.j./ml)
IBSA Institut
Biochemique S.A.
Cena leka
na veliko
za
pakovanje
Švajcarska
1.161,20
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
75 i.j.
1.161,20
-
6HNXQGDUQLKLSRJRQDGRWURSL]DPKLSRWDODPXVQRLLOLSLWXLWDUQRRãWHüHQMH
Lek se uvodi u terapiju na osnovu mišljenja endokrinologa zdravstvene ustanove koja obavlja zdravstvenu delatnost na tercijarnom nivou.
folitropin alfa
0044250
G03GA05
folitropin alfa
GONAL-F
0044251
G03GA05
folitropin alfa
GONAL-F 300
OLRERþLFDVD
SUDãDNLUDVWYDUDþ]D UDVWYDUDþHPXãSULFX
rastvor za injekciju
1 po 75 i.j./ml
Merck Serono S.P.A.
Italija
2.652,20
75 i.j.
2.652,20
-
rastvor za injekciju
pen sa uloškom, 1 po
0,5 ml (300 i.j./0,5 ml) Merck Serono S.P.A.
Italija
10.883,90
75 i.j.
2.720,98
-
Italija
16.228,70
75 i.j.
2.704,78
-
Italija
32.425,50
75 i.j.
2.702,13
-
0044252
G03GA05
folitropin alfa
GONAL-F 450
rastvor za injekciju
pen sa uloškom, 1 po
0,75 ml (450 i.j./0,75
ml)
Merck Serono S.P.A.
0044253
G03GA05
folitropin alfa
GONAL-F 900
rastvor za injekciju
pen sa uloškom, 1 po
1,5 ml (900 i.j./1,5 ml) Merck Serono S.P.A.
INDIKACIJE
Država
proizvodnje
leka
6HNXQGDUQLKLSRJRQDGRWURSL]DPKLSRWDODPXVQRLLOLSLWXLWDUQRRãWHüHQMH
,QIHUWLOLWHWXåHQDXGUXåHQVDKURQLþQRPDQRYXODFLMRPXVLQGURPXSROLFLVWLþQLKRYDULMXPDNRGåHQDNRMHVXUH]LVWHQWQHQDSUHWKRGQXSULPHQXPHWIRUPLQDL
klomifen citrata.
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja endokrinologa ili ginekologa zdravstvene ustanove koja obavlja zdravstvenu delatnost na tercijarnom nivou.
G03GA06 folitropin beta
0044226
G03GA06
folitropin beta
PUREGON
injekcija
1 po 0,5 ml (50 i.j./0,5
ml)
N.V. Organon
Holandija
1.797,80
75 i.j.
2.696,70
-
0044227
G03GA06
folitropin beta
PUREGON
injekcija
1 po 0,5 ml (100 i.j./0,5
ml)
N.V. Organon
Holandija
3.406,90
75 i.j.
2.555,18
-
INDIKACIJE
NAPOMENA
6HNXQGDUQLKLSRJRQDGRWURSL]DPKLSRWDODPXVQRLLOLSLWXLWDUQRRãWHüHQMH
,QIHUWLOLWHWXåHQDXGUXåHQVDKURQLþQRPDQRYXODFLMRPXVLQGURPXSROLFLVWLþQLKRYDULMXPDNRGåHQDNRMHVXUH]LVWHQWQHQDSUHWKRGQXSULPHQXPHWIRUPLQDL
klomifen citrata.
Lek se uvodi u terapiju na osnovu mišljenja endokrinologa ili ginekologa zdravstvene ustanove koja obavlja zdravstvenu delatnost na tercijarnom nivou.
/LVWD%*UXSD+/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0140150
0140115
0140116
ATC
INN
H
H01
H01B
H01BB
H01BB02 oksitocin
H01BB02
H01BB02
H01BB02
oksitocin
oksitocin
oksitocin
Cena leka
Država
na veliko
=DãWLüHQRLPH
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
za
leka
FO
leka
SURL]YRÿDþDOHND
leka
pakovanje
DDD
+250216.,35(3$5$7,=$6,67(06.835,0(18,6./-8ý8-8û,32/1(+25021(,,168/,1(
HORMONI HIPOFIZE I HIPOTALAMUSA I ANALOZI
Hormoni zadnjeg režnja hipofize
Oksitocin i analozi
OXYTOCIN
SYNTHETIC
Gedeon Richter
0DÿDUVND
3.483,30
15 i.j.
52,25
-
SYNTOCINON
rastvor za
injekciju/koncentrat
za rastvor za infuziju ampula, 100 po 5 i.j./ml
Novartis Pharma
Stein AG
Švajcarska
2.424,10
15 i.j.
72,72
-
SYNTOCINON
rastvor za
injekciju/koncentrat
za rastvor za infuziju
Novartis Pharma
Stein AG
Švajcarska
3.483,30
15 i.j.
52,25
-
Švajcarska
3.736,60
0,7 mg
5.231,24
-
injekcija
NAPOMENA
STAC
H01C
H01CB
H01CB02 oktreotid
0049190
H01CB02
oktreotid
Cena leka Participacija
na veliko osiguranog
po DDD
lica
100 po 10 i.j./ml
ampula, 100 po 10
i.j./ml
Hormoni hipotalamusa
Antagonisti hormona rasta
SANDOSTATIN
rastvor za
injekciju/infuziju
ampula, 5 po 1 ml (0,1
mg/ml)
Novartis Pharma
Stein AG
*DVWURHQWHURSDQNUHDVQLQHXURHQGRNULQLWXPRULNDRQDVWDYDNEROQLþNRJOHþHQMD&&''''
2. Akromegalija (D35.2; E22.0);
7HUDSLMDDNXWQRJYDULFHDOQRJNUYDUHQMDL]YDULNVDMHGQMDNDLåHOXFDXEROQLþNLPXVORYPD,
7HUDSLMDSDQNUHDVQHILVWXOHQDNRQRSHUDFLMHQDSDQNUHDVXNRMDQHUHDJXMHQDHQGRVNRSVNXKHPRVWD]XXEROQLþNLPXVORYLPD...
K86.9).
INDIKACIJE
H01CB02 oktreotid
0049195
H01CB02
oktreotid
SANDOSTATIN
LAR
ERþLFDLUDVWYDUDþX
SUDãDNLUDVWYDUDþ]D
napunjenom
suspenziju za
injekcionom špricu, 1
injekciju
po 10 mg/2,5 ml
Novartis Pharma
Stein AG
Švajcarska
52.509,20
0,7 mg
3.675,64
-
/LVWD%*UXSD+/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0049196
0049197
ATC
H01CB02
H01CB02
INN
oktreotid
oktreotid
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD
Naziv
leka
SURL]YRÿDþDOHND
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
SANDOSTATIN
LAR
ERþLFDLUDVWYDUDþX
SUDãDNLUDVWYDUDþ]D
napunjenom
suspenziju za
injekcionom špricu, 1
injekciju
po 20 mg/2,5 ml
Novartis Pharma
Stein AG
Švajcarska
90.510,90
0,7 mg
3.167,88
-
SANDOSTATIN
LAR
ERþLFDLUDVWYDUDþX
SUDãDNLUDVWYDUDþ]D
napunjenom
suspenziju za
injekcionom špricu, 1
injekciju
po 30 mg/2,5 ml
Novartis Pharma
Stein AG
Švajcarska
117.610,50
0,7 mg
2.744,25
-
*DVWURHQWHURSDQNUHDVQLQHXURHQGRNULQLWXPRULNDRQDVWDYDNEROQLþNRJOHþHQMD&&''''
INDIKACIJE
2. Akromegalija (D35.2; E22.0).
H01CB03 lanreotid
0049231
0049232
0049233
H01CB03
H01CB03
H01CB03
lanreotid
SOMATULINE
AUTOGEL
lanreotid
SOMATULINE
AUTOGEL
lanreotid
SOMATULINE
AUTOGEL
injekcija, špric
1 po 60 mg
Ipsen Pharma
Biotech
Francuska
74.102,90
3 mg
3.705,15
-
rastvor za injekciju
napunjen injekcioni
špric,1 po 90 mg
Ipsen Pharma
Biotech
Francuska
79.980,50
3 mg
2.666,02
-
rastvor za injekciju
napunjen injekcioni
špric,1 po 120 mg
Ipsen Pharma
Biotech
Francuska
109.398,50
3 mg
2.734,96
-
INDIKACIJE
1HXURHQGRNULQLWXPRULNDRQDVWDYDNEROQLþNRJOHþHQMD&&&&'''''''((((44
H02
KORTIKOSTEROIDI ZA SISTEMSKU PRIMENU
H02A
Kortikosteroidi za sistemsku primenu, monokomponentni
H02AB
Glukokortikoidi
H02AB01 betametazondinatrijum fosfat, betametazon dipropionat
0047286
H02AB01
betametazon
DIPROPHOS
injekcija
5 po (2 mg + 5 mg)/ml
Schering Plough
Belgija
1.433,90
1,5 mg
61,45
-
rastvor za injekciju
ampula, 25 po 4 mg/ml
Galenika a.d.
Republika Srbija
688,50
1,5 mg
10,33
-
H02AB02 deksametazon
0047140
H02AB02
deksametazon
DEXASON
/LVWD%*UXSD+/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0047219
0047220
0047216
0047218
ATC
INN
H02AB04 metilprednizolon
H02AB04
H02AB04
H02AB04
H02AB04
metilprednizolon
metilprednizolon
metilprednizolon
metilprednizolon
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD
Naziv
leka
SURL]YRÿDþDOHND
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
LEMOD SOLU
OLRERþLFDVD
SUDãDNLUDVWYDUDþ]D UDVWYDUDþHPXDPSXOL
rastvor za
1 po 2 ml (125 mg/2
injekciju/infuziju
ml)
Hemofarm a.d.
Republika Srbija
190,80
20 mg
30,53
-
LEMOD SOLU
OLRERþLFDVD
SUDãDNLUDVWYDUDþ]D UDVWYDUDþHPXDPSXOL
rastvor za
1 po 7,8 ml (500
injekciju/infuziju
mg/7,8 ml)
Hemofarm a.d.
Republika Srbija
629,60
20 mg
25,18
-
LEMOD SOLU
SUDãDNLUDVWYDUDþ]D
OLRERþLFDVD
rastvor za
UDVWYDUDþHPXDPSXOL
injekciju/infuziju
15 po 1 ml (20 mg/ml)
Hemofarm a.d.
Republika Srbija
765,40
20 mg
51,03
-
LEMOD SOLU
SUDãDNLUDVWYDUDþ]D
OLRERþLFDVD
rastvor za
UDVWYDUDþHPXDPSXOL
injekciju/infuziju
15 po 1 ml (40 mg/ml)
Hemofarm a.d.
Republika Srbija
1.426,30
20 mg
47,54
-
suspenzija za
injekciju
ERþLFDSRPO
mg/1 ml)
Hemofarm a.d.
Republika Srbija
1.109,00
20 mg
55,45
-
0047212
H02AB04
metilprednizolon
LEMOD DEPO
0047173
H02AB04
metilprednizolon
NIRYPAN
SOLUBILE
injekcija
15 po 20 mg sa rastv.
Jugoremedija a.d.
Republika Srbija
765,40
20 mg
51,03
-
metilprednizolon
NIRYPAN
SOLUBILE
injekcija
15 po 40 mg sa rastv.
Jugoremedija a.d.
Republika Srbija
1.426,30
20 mg
47,54
-
HIDROKORTIZON
liofilizat za rastvor za
injekciju sa
OLRERþLFDVD
UDVWYDUDþHP]D
UDVWYDUDþHPXDPSXOL
parenteralnu
1 po 2 ml (100 mg/2
upotrebu
ml)
Hemofarm a.d.
Republika Srbija
125,30
30 mg
37,59
-
HIDROKORTIZON
liofilizat za rastvor za
injekciju sa
OLRERþLFDVD
UDVWYDUDþHP]D
UDVWYDUDþHPXDPSXOL
parenteralnu
1 po 4 ml (500 mg/4
upotrebu
ml)
Hemofarm a.d.
Republika Srbija
327,10
30 mg
19,63
-
0047174
H02AB04
H02AB09 hidrokortizon (kortizol)
0047120
0047121
H02AB09
H02AB09
hidrokortizon
hidrokortizon
/LVWD%*UXSD+/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0047122
ATC
H02AB09
INN
hidrokortizon
=DãWLüHQRLPH
leka
HIDROKORTIZON
FO
liofilizat za rastvor za
injekciju sa
UDVWYDUDþHP]D
parenteralnu
GYRGHOQDERþLFDSR
upotrebu
2 ml (100 mg/2 ml)
parikalcitol
1050012
H05BX02
parikalcitol
ZEMPLAR
kapsula, meka
blister, 28 po 1 mcg
1050010
H05BX02
parikalcitol
ZEMPLAR
kapsula, meka
0050140
H05BX02
parikalcitol
ZEMPLAR
rastvor za injekciju
blister, 28 po 2 mcg
ampula 5 po 1 ml (5
mcg/ ml)
NAPOMENA
Cena leka
na veliko
za
pakovanje
DDD
Republika Srbija
109,90
30 mg
32,97
-
Velika Britanija
9.687,20
2 mcg
691,94
-
Velika Britanija
19.323,30
2 mcg
690,12
-
Italija
10.550,90
2 mcg
844,07
-
3DNRYDQMHLMDþLQD
Naziv
leka
SURL]YRÿDþDOHND
H05
H05B
H05BX
H05BX02
INDIKACIJE
Država
proizvodnje
leka
Hemofarm a.d.
Cena leka Participacija
na veliko osiguranog
po DDD
lica
Homeostaza kalcijuma
Antiparatiroidni hormoni
Drugi antiparatiroidni hormoni
Aesica
Queenborough Ltd.
Aesica
Queenborough Ltd.
Abbott S.R.L.
6HNXQGDUQLKLSHUSDUDWLUHRLGL]DPNRGEROHVQLNDNRMLVXQDKURQLþQRPSURJUDPXGLMDOL]HKHPRGLMDOL]DLSHULWRQHDOQDGLMDOL]DLWREROHVQLFLNRMLQLVX
RGJRYRULOLQDSUHWKRGQXVWDQGDUGQXWHUDSLMXNDOFLWULROYH]DþLIRVIDWDKLSRNDOFHPLMVNLGLMDOL]QLUDVWYRULGLMHWDVLURPDãQDIRVIRURPVDXPHUHQLP
hiperparatireoidizmom koji imaju trajno povišen IPTH>500-800 pg/ml.
.RQWUDLQGLNDFLMHNRQFHQWUDFLMD&DYHüDRGPPROOLOLSURL]YRG&D[3!PPROO
Lek se uvodi u terapiju u dijaliznim centrima.
/LVWD%*UXSD-/HNRYLNRMLSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0029781
ATC
J
J01
J01A
J01AA
J01AA12
tigeciklin
J01AA12
tigeciklin
NAPOMENA
J01C
J01CA
J01CA01
=DãWLüHQRLPH
leka
INN
TYGACIL
FO
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
ANTIINFEKTIVNI LEKOVI ZA SISTEMSKU PRIMENU
ANTIBAKTERIJSKI LEKOVI ZA SISTEMSKU PRIMENU
Tetraciklini
Tetraciklini
prašak za rastvor za
infuziju
ERþLFDSRPJ
PENTREXYL
prašak za rastvor za
injekciju
0021108
J01CA01
ampicilin
PAMECIL
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
1g
0021109
J01CA01
ampicilin
PAMECIL
prašak za rastvor za
injekciju/infuziju
J01CE
J01CE30
benzilpenicilin, prokain benzilpenicilin
J01CE30
benzilpenicilin,
prokainbenzilpenicilin
J01CR
J01CR01
ampicilin, sulbaktam
NAPOMENA
0,1 g
10.313,84
-
ampicilin
ampicilin
J01CR01
51.569,20
Beta-laktam antibakterijski lekovi, penicilini
Penicilini širokog spektra
J01CA01
0021357
Velika Britanija
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
**
0021105
0020056
Wyeth Pharmaceuticals
Cena leka
na veliko
za
pakovanje
ERþLFDSRJ
ERþLFDVWDNOHQD
po 1 g
Corden Pharma Latina
S.P.A.
Italija
3.606,60
2g
144,26
-
Medochemie Ltd.
Kipar
721,30
2g
144,26
-
Medochemie Ltd.
Kipar
7.213,20
2g
144,26
-
Republika Srbija
2.386,70
6000000 i.j.
477,34
-
2g
315,92
-
Penicilini osetljivi na beta-laktamazu
PANCILLIN
prašak za suspenziju
za injekciju
ERþLFDSR
i.j. (600000i.j.+
200000i.j.)
Hemofarm a.d.
.RPELQDFLMHSHQLFLOLQDXNOMXþXMXüLLNRPELQDFLMHVDLQKLELWRULPDEHWDODNWDPD]H
ampicilin, sulbaktam
STAC
AMPISULCILLIN
prašak za rastvor za
injekciju
ERþLFDVWDNOHQDSR
1,5 g (1000mg +
500mg)
Zdravlje a.d.
Republika Srbija
1.579,60
/LVWD%*UXSD-/HNRYLNRMLSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
ATC
J01CR02
=DãWLüHQRLPH
INN
leka
amoksicilin, klavulanska kiselina
0021565
J01CR02
amoksicilin,
klavulanska kiselina
AMOKSIKLAV
prašak za rastvor za
injekciju/infuziju
5 po (1000 mg+ 200
mg)
Lek farmacevtska
družba d.d.
Slovenija
975,10
3g
585,06
-
0021650
J01CR02
amoksicilin,
klavulanska kiselina
MEDOCLAV
prašak za rastvor za
injekciju/infuziju
5 po (1000 mg+ 200
mg)
Medochemie Ltd.
Kipar
975,10
3g
585,06
-
JKL
NAPOMENA
J01CR05
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
STAC
piperacilin, tazobaktam
0021998
J01CR05
piperacilin, tazobaktam TAZOCIN
prašak za rastvor za
injekciju/infuziju
ERþLFDSRJ
0,5 mg)
Wyeth Lederle S.P.A.
Italija
9.204,00
14 g
2.684,50
-
0021995
J01CR05
piperacilin, tazobaktam PIPTAZ
prašak za rastvor za
injekciju/infuziju
ERþLFDSRJ
0.5g)
PharmaSwiss d.o.o.
Republika Srbija
9.204,00
14 g
2.684,50
-
0021959
J01CR05
piperacilin, tazobaktam ACIPIRIN
prašak za rastvor za
injekciju/infuziju
ERþLFDVWDNOHQDSR
(4 g + 0,5 g)
Laboratorio Reig Jofre
S.A.
Španija
767,00
14 g
2.684,50
-
J01CR05
PIPERACILLIN/TAZO
BACTAM
piperacilin, tazobaktam AUROBINDO
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
4,5 g
Aurobindo Pharma Ltd.
Indija
9.204,00
14 g
2.684,50
-
0021971
NAPOMENA
J01D
**
Ostali beta-laktam antibakterijski lekovi
Cefalosporini I generacije
J01DB
J01DB04
cefazolin
0321961
J01DB04
cefazolin
GALECEF
prašak za rastvor za
injekciju/infuziju
ERþLFDSRJ
Galenika a.d.
Republika Srbija
5.975,90
3g
358,55
-
0321030
J01DB04
cefazolin
PRIMACEPH
prašak za rastvor za
injekciju/infuziju
50 po 1 g
PharmaSwiss d.o.o.
Republika Srbija
5.975,90
3g
358,55
-
/LVWD%*UXSD-/HNRYLNRMLSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
ATC
INN
=DãWLüHQRLPH
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Chephasaar Chem.
Pharm.
1HPDþND
1.838,90
3g
275,84
-
Pharmanova d.o.o.
Republika Srbija
597,60
3g
358,56
-
prašak za rastvor za
injekciju
Hemofarm a.d. u
saradnji sa
ERþLFDVWDNOHQDSR GlaxoSmithKline Export
750 mg
Limited, Velika Britanija
Republika Srbija
112,80
3g
451,20
-
Hemofarm a.d. u
saradnji sa
ERþLFDVWDNOHQDSR GlaxoSmithKline Export
1500 mg
Limited, Velika Britanija
Republika Srbija
195,50
3g
391,00
-
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
0321829
J01DB04
cefazolin
CEFAZOLIN-MIP
prašak za rastvor za
injekciju/infuziju
0321854
J01DB04
cefazolin
CEFAZOLIN
PHARMANOVA
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju
g
J01DC
J01DC02
0321971
J01DC02
ERþLFDSRJ
Cena leka Participacija
na veliko osiguranog
po DDD
lica
Cefalosporini II generacije
cefuroksim
cefuroksim
NILACEF
0321972
J01DC02
cefuroksim
NILACEF
prašak za rastvor za
injekciju
0321025
J01DC02
cefuroksim
CEFUROKSIM
prašak za rastvor za
injekciju
1 po 1500 mg
Galenika a.d.
Republika Srbija
195,50
3g
391,00
-
0321024
J01DC02
cefuroksim
CEFUROKSIM
prašak za rastvor za
injekciju
1 po 750 mg
Galenika a.d.
Republika Srbija
112,80
3g
451,20
-
0321401
J01DC02
cefuroksim
DICEF
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
750 mg
PharmaSwiss d.o.o.
Republika Srbija
5.640,00
3g
451,20
-
0321404
J01DC02
cefuroksim
DICEF
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
1500 mg
PharmaSwiss d.o.o.
Republika Srbija
9.775,00
3g
391,00
-
0321640
J01DC02
cefuroksim
XORIM
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju
750 mg
Sandoz GmbH
Austrija
1.128,00
3g
451,20
-
0321643
J01DC02
cefuroksim
XORIM
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju
1500 mg
Sandoz GmbH
Austrija
1.955,00
3g
391,00
-
/LVWD%*UXSD-/HNRYLNRMLSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
INN
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
JKL
ATC
0321882
J01DC02
cefuroksim
CEFUROXIM-MIP
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju
750 mg
Chephasaar Chem.
Pharm.
1HPDþND
1.128,00
3g
451,20
-
0321883
J01DC02
cefuroksim
CEFUROXIM-MIP
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
1500 mg/50 ml
Chephasaar Chem.
Pharm.
1HPDþND
1.955,00
3g
391,00
-
0321884
J01DC02
cefuroksim
CEFUROXIM-MIP
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
1500 mg/100 ml
Chephasaar Chem.
Pharm.
1HPDþND
1.955,00
3g
391,00
-
0321955
J01DC02
cefuroksim
CEFUROXIM
MEDOCHEMIE
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
750 mg
Medochemie Ltd.
Kipar
1.128,00
3g
451,20
-
0321874
J01DC02
cefuroksim
CEFUROXIM
MEDOCHEMIE
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
1500 mg
Medochemie Ltd.
Kipar
1.955,00
3g
391,00
-
Jugoremedija a.d.
Republika Srbija
100,10
4g
800,80
-
J01DD
J01DD01
cefotaksim
0321140
J01DD01
cefotaksim
TOLYCAR
prašak za rastvor za
injekciju/infuziju
0321141
J01DD01
cefotaksim
TOLYCAR
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
g
Jugoremedija a.d.
Republika Srbija
200,10
4g
800,40
-
0321142
J01DD01
cefotaksim
TOLYCAR
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
g
Jugoremedija a.d.
Republika Srbija
400,30
4g
800,60
-
0321143
J01DD01
cefotaksim
TOLYCAR
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
0,5 g
Jugoremedija a.d.
Republika Srbija
2.002,00
4g
800,80
-
0321144
J01DD01
cefotaksim
TOLYCAR
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
1g
Jugoremedija a.d.
Republika Srbija
4.002,00
4g
800,40
-
Cefalosporini III generacije
ERþLFDVWDNOHQDSR
0,5 g
/LVWD%*UXSD-/HNRYLNRMLSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
ATC
0321145
J01DD01
0321981
0321980
0321983
0321984
J01DD01
J01DD01
J01DD01
J01DD01
NAPOMENA
J01DD02
0321600
J01DD02
INN
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
TOLYCAR
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
2g
Jugoremedija a.d.
Republika Srbija
8.006,00
4g
800,60
-
CEFOTAKSIM
prašak za rastvor za
injekciju
ERþLFDVWDNOHQDSR
1000 mg
Zdravlje a.d.
Republika Srbija
200,10
4g
800,40
-
cefotaksim
CEFOTAKSIM
prašak za rastvor za
injekciju
ERþLFDVWDNOHQDSR
1000 mg
Zdravlje a.d.
Republika Srbija
1.000,50
4g
800,40
-
cefotaksim
CEFOTAXIM
MEDOCHEMIE
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
1g
Medochemie Ltd.
Kipar
2.001,00
4g
800,40
-
cefotaksim
CEFOTAXIM
MEDOCHEMIE
prašak za rastvor za
injekciju/infuziju
ERþLFDVWDNOHQD
po 1 g
Medochemie Ltd.
Kipar
20.010,00
4g
800,40
-
prašak za rastvor za
injekciju
Hemofarm a.d. u
saradnji sa
ERþLFDVWDNOHQDSR GlaxoSmithKline Export
1000 mg
Limited, Velika Britanija
Republika Srbija
325,30
4g
1.301,20
-
Hemofarm a.d. u
saradnji sa
ERþLFDVWDNOHQDSR GlaxoSmithKline Export
500 mg
Limited, Velika Britanija
Republika Srbija
155,20
4g
1.241,60
-
cefotaksim
cefotaksim
STAC
ceftazidim
ceftazidim
FORCAS
0321601
J01DD02
ceftazidim
FORCAS
prašak za rastvor za
injekciju
0321023
J01DD02
ceftazidim
CEFTAZIDIM
prašak za rastvor za
injekciju
1 po 1 g
Galenika a.d.
Republika Srbija
325,30
4g
1.301,20
-
0321603
J01DD02
ceftazidim
CEFTAZIDIM
SANDOZ
prašak za rastvor za
injekciju
1 po 500 mg
Sandoz GmbH
Austrija
155,20
4g
1.241,60
-
0321602
J01DD02
ceftazidim
CEFTAZIDIM
SANDOZ
prašak za rastvor za
injekciju
1 po 1 g
Sandoz GmbH
Austrija
325,30
4g
1.301,20
-
0321707
J01DD02
ceftazidim
TIZACEF
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
1g
PharmaSwiss d.o.o.
Republika Srbija
16.265,00
4g
1.301,20
-
NAPOMENA
STAC
/LVWD%*UXSD-/HNRYLNRMLSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0321758
ATC
J01DD04
INN
ceftriakson
J01DD04
ceftriakson
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
AZARAN
prašak za rastvor za
injekciju
ERþLFDSR
mg
Hemofarm a.d.
Republika Srbija
14.624,70
2g
584,99
-
10 po 1 g
Galenika a.d.
Republika Srbija
2.924,90
2g
584,98
-
0321329
J01DD04
ceftriakson
LONGACEPH
prašak za rastvor za
injekciju
0321990
J01DD04
ceftriakson
CEFTRIAKSON
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju
250 mg
Jugoremedija a.d.
Republika Srbija
913,10
2g
730,48
-
0321993
J01DD04
ceftriakson
CEFTRIAKSON
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju
250 mg
Jugoremedija a.d.
Republika Srbija
4.565,70
2g
730,51
-
0321991
J01DD04
ceftriakson
CEFTRIAKSON
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju
500 mg
Jugoremedija a.d.
Republika Srbija
1.826,40
2g
730,56
-
0321994
J01DD04
ceftriakson
CEFTRIAKSON
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju
500 mg
Jugoremedija a.d.
Republika Srbija
9.132,00
2g
730,56
-
0321992
J01DD04
ceftriakson
CEFTRIAKSON
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju
1g
Jugoremedija a.d.
Republika Srbija
2.924,90
2g
584,98
-
0321995
J01DD04
ceftriakson
CEFTRIAKSON
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju
1g
Jugoremedija a.d.
Republika Srbija
14.624,70
2g
584,99
-
CEFTRIAKSON
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju
g
Zdravlje a.d.
Republika Srbija
292,50
2g
585,00
-
CEFTRIAKSON
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju
g
Zdravlje a.d.
Republika Srbija
1.462,50
2g
585,00
-
CEFTRIAKSON
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju
g
Zdravlje a.d.
Republika Srbija
615,50
2g
615,50
-
Zdravlje a.d.
Republika Srbija
3.077,50
2g
615,50
-
PharmaSwiss d.o.o.
Republika Srbija
14.624,70
2g
584,99
-
Sandoz GmbH
Austrija
2.924,90
2g
584,98
-
0321985
0321986
0321987
J01DD04
J01DD04
J01DD04
ceftriakson
ceftriakson
ceftriakson
0321988
J01DD04
ceftriakson
CEFTRIAKSON
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju
g
0321865
J01DD04
ceftriakson
3CEF
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
1g
0321863
J01DD04
ceftriakson
LENDACIN
prašak za rastvor za
injekciju/infuziju
ERþLFDSRJ
/LVWD%*UXSD-/HNRYLNRMLSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
JKL
ATC
0321996
J01DD04
ceftriakson
CEFTRIAXON-MIP
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
g
Chephasaar Chem.
Pharm.
1HPDþND
292,50
2g
585,00
-
0321997
J01DD04
ceftriakson
CEFTRIAXON-MIP
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
1g
Chephasaar Chem.
Pharm.
1HPDþND
2.924,90
2g
584,98
-
0321998
J01DD04
ceftriakson
CEFTRIAXON-MIP
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
g
Chephasaar Chem.
Pharm.
1HPDþND
615,50
2g
615,50
-
0321999
J01DD04
ceftriakson
CEFTRIAXON-MIP
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
2g
Chephasaar Chem.
Pharm.
1HPDþND
6.154,70
2g
615,47
-
0321989
J01DD04
ceftriakson
CEFTRIAKSON
PHARMANOVA
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
g
Pharmanova d.o.o.
Republika Srbija
1.462,50
2g
585,00
-
NAPOMENA
J01DE
J01DE01
INN
=DãWLüHQRLPH
leka
Država
proizvodnje
leka
STAC ** ; izuzetno u dermatologiji se mogu koristiti ambulantno ampule od 250 mg.
Cefalosporini IV generacije
cefepim
0321914
J01DE01
cefepim
MAXICEF
prašak za rastvor za
injekciju/infuziju
ERþLFDVWDNOHQDSR
1000 mg
Galenika a.d.
Republika Srbija
541,70
2g
1.083,40
-
0321631
J01DE01
cefepim
CEFIM
prašak za rastvor za
injekciju/infuziju
ERþLFDSRPJ
Hemofarm a.d.
Republika Srbija
270,90
2g
1.083,60
-
CEFIM
prašak za rastvor za
injekciju/infuziju
ERþLFDSRPJ
Hemofarm a.d.
Republika Srbija
541,70
2g
1.083,40
-
Velika Britanija
6.605,80
2g
2.642,32
-
0321630
J01DE01
NAPOMENA
J01DH
J01DH02
0029750
J01DH02
cefepim
STAC
Karbapenemi
meropenem
meropenem
MERONEM
prašak za rastvor za
injekciju/infuziju
ERþLFDSRPJ
AstraZeneca UK
Limited
/LVWD%*UXSD-/HNRYLNRMLSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
ATC
0029751
J01DH02
0029753
J01DH02
INN
meropenem
meropenem
=DãWLüHQRLPH
leka
FO
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
AstraZeneca UK
Limited
Velika Britanija
12.057,00
2g
2.411,40
-
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Cena leka Participacija
na veliko osiguranog
po DDD
lica
MERONEM
prašak za rastvor za
injekciju/infuziju
ERþLFDSRPJ
MEROCID
prašak za rastvor za
injekciju/infuziju
ERþLFDVWDNOHQDSR
500 mg
PharmaSwiss d.o.o.
Republika Srbija
6.605,80
2g
2.642,32
-
ERþLFDVWDNOHQDSR
1000 mg
PharmaSwiss d.o.o.
Republika Srbija
12.057,00
2g
2.411,40
-
0029754
J01DH02
meropenem
MEROCID
prašak za rastvor za
injekciju/infuziju
0029757
J01DH02
meropenem
MEROPENEM
PHARMANOVA
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
500 mg
Pharmanova d.o.o.
Republika Srbija
6.605,80
2g
2.642,32
-
0029758
J01DH02
meropenem
MEROPENEM
PHARMANOVA
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
1g
Pharmanova d.o.o.
Republika Srbija
12.057,00
2g
2.411,40
-
0029755
J01DH02
meropenem
ITANEM
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
500 mg
Galenika a.d.
Republika Srbija
6.605,80
2g
2.642,32
-
0029756
J01DH02
meropenem
ITANEM
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
1g
Galenika a.d.
Republika Srbija
12.057,00
2g
2.411,40
-
002975M
J01DH02
meropenem
MEROPENEM
PROVIDENS
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
500 mg
Pharmathen S.A.
*UþND
6.605,80
2g
2.642,32
-
0029759
J01DH02
meropenem
MEROPENEM
PROVIDENS
prašak za rastvor za ERþLFDVWDNOHQDSR
injekciju/infuziju
1000 mg
Pharmathen S.A.
*UþND
12.057,00
2g
2.411,40
-
Merck Sharp & Dohme
Francuska
4.709,80
1g
4.709,80
-
Belgija
23.664,70
1,5 g
7.099,41
-
NAPOMENA
J01DH03
0029780
J01DH03
NAPOMENA
J01DH04
0029508
J01DH04
NAPOMENA
**
ertapenem natrijum
ertapenem natrijum
INVANZ
injekcija
1 po 1 g
STAC
doripenem
doripenem
**
DORIBAX
prašak za rastvor za ERþLFDVWDNOHQDSR Janssen Pharmaceutica
infuziju
500 mg
N.V.
/LVWD%*UXSD-/HNRYLNRMLSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0029506
0029507
ATC
J01DH51
INN
imipenem, cilastatin
J01DH51
imipenem, cilastatin
J01DH51
NAPOMENA
J01E
J01EE
J01EE01
0026601
0325484
0325476
J01EE01
0326223
sulfametoksazol,
trimetoprim
J01FF01
MIPECID
ERþLFDVWDNOHQDSR
prašak za rastvor za 1000 mg (500 mg+500
infuziju
mg)
PharmaSwiss d.o.o.
Francuska
7.760,20
2g
3.104,08
-
Republika Srbija
7.760,20
2g
3.104,08
-
BACTRIM Roche
ampula, 10 po 5 ml
koncentrat za rastvor (400 mg/5 ml+80 mg/5 F. Hoffmann-La Roche
za infuziju
ml)
Ltd.
Švajcarska
2.568,10
1,92 g
1.027,24
-
Makrolidi, linkozamidi streptogramini
Makrolidi
azitromicin
NAPOMENA
prašak za koncentrat ERþLFDSRJ
Laboratories Merck
za rastvor za infuziju
mg + 500 mg)
Sharp & Dohme-Chibret
sulfametoksazol, trimetoprim
J01FA10
J01FF01
TIENAM I.V.
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
Sulfonamidi i trimetoprim
.RPELQDFLMHVXOIRQDPLGDVDWULPHWRSULPRPXNOMXþXMXüLGHULYDWH
azitromicin
J01FA10
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Cena leka
na veliko
za
pakovanje
**
J01F
J01FA
J01FA10
NAPOMENA
J01FF
J01FF01
0326041
imipenem, cilastatin
=DãWLüHQRLPH
leka
Država
proizvodnje
leka
azitromicin
HEMOMYCIN
prašak za rastvor za
infuziju
ERþLFDSRPJ
Hemofarm a.d.
Republika Srbija
556,90
0,5 g
556,90
-
SUMAMED
prašak za rastvor za
infuziju
ERþLFDVWDNOHQDSR
500 mg
Pliva Hrvatska d.o.o.
Hrvatska
2.784,50
0,5 g
556,90
-
STAC
Linkozamidi
klindamicin
klindamicin
klindamicin
STAC
KLINDAMICIN
CLINDAMYCIN-MIP
rastvor za injekciju
ampula, 10 po 2 ml
(150 mg/ml)
Hemofarm a.d.
Republika Srbija
1.244,70
1,8 g
746,82
-
rastvor za injekciju
ampula, 5 po 4 ml (600
mg/4 ml)
Chephasaar Chem.
Pharm.
1HPDþND
1.089,80
1,8 g
653,88
-
/LVWD%*UXSD-/HNRYLNRMLSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0024552
ATC
J01G
J01GB
J01GB03
INN
gentamicin
J01GB03
gentamicin
=DãWLüHQRLPH
leka
GENTAMICIN
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Aminoglikozidni antibakterijski lekovi
Ostali aminoglikozidi
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
rastvor za injekciju
ampula, 10 po 2 ml (80
mg/2 ml)
Galenika a.d.
Republika Srbija
460,50
0,24 g
138,15
-
Galenika a.d.
Republika Srbija
690,90
0,24 g
138,18
-
0024553
J01GB03
gentamicin
GENTAMICIN
rastvor za injekciju
ampula, 10 po 2 ml
(120 mg/2 ml)
0024423
J01GB03
gentamicin
GENTAMICIN
rastvor za injekciju
ampula, 10 po 2 ml (20
mg/2 ml)
Zdravlje a.d.
Republika Srbija
328,20
0,24 g
393,84
-
rastvor za injekciju
ampula, 10 po 2 ml (40
mg/2 ml)
Zdravlje a.d.
Republika Srbija
405,80
0,24 g
243,48
-
rastvor za injekciju
ampula, 10 po 2 ml (80
mg/2 ml)
Zdravlje a.d.
Republika Srbija
460,50
0,24 g
138,15
-
rastvor za injekciju
ampula, 10 po 2 ml
(120 mg/2 ml)
Zdravlje a.d.
Republika Srbija
690,90
0,24 g
138,18
-
Hemofarm a.d.
Republika Srbija
460,50
0,24 g
138,15
-
0024420
0024421
0024422
J01GB03
J01GB03
J01GB03
gentamicin
gentamicin
gentamicin
GENTAMICIN
GENTAMICIN
GENTAMICIN
0024580
J01GB03
gentamicin
GENTAMICIN
rastvor za injekciju
ampula, 10 po 2 ml (80
mg/2 ml)
0024582
J01GB03
gentamicin
GENTAMICIN
rastvor za injekciju
10 po 2 ml (120 mg/2
ml)
Hemofarm a.d.
Republika Srbija
690,90
0,24 g
138,18
-
J01GB06
amikacin
J01GB06
amikacin
AMIKACIN
rastvor za
injekciju/infuziju
ampula, 10 po 100
mg/2 ml
Galenika a.d.
Republika Srbija
591,10
1g
591,10
-
AMIKACIN
rastvor za
injekciju/infuziju
ampula, 10 po 500
mg/2 ml
Galenika a.d.
Republika Srbija
1.698,00
1g
339,60
-
AMINOCIN
rastvor za
injekciju/infuziju
ampula, 50 po 2 ml
(500 mg/2 ml)
PharmaSwiss d.o.o.
Republika Srbija
8.489,80
1g
339,59
-
0024282
0024283
0024633
J01GB06
J01GB06
NAPOMENA
J01M
J01MA
J01MA02
amikacin
amikacin
STAC
Hinolonski antibakterijski lekovi
Fluorhinoloni
ciprofloksacin
0329196
J01MA02
ciprofloksacin
CIPROCINAL
0329412
J01MA02
ciprofloksacin
MAROCEN
rastvor za infuziju
ERþLFDSR
mg/50 ml
Zdravlje a.d.
Republika Srbija
1.029,80
0,5 g
1.029,80
-
koncentrat za rastvor
za infuziju
ampula, 5 po 100
mg/10 ml
Hemofarm a.d.
Republika Srbija
1.029,80
0,5 g
1.029,80
-
/LVWD%*UXSD-/HNRYLNRMLSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0329403
ATC
J01MA02
NAPOMENA
J01MA12
0329081
J01MA12
NAPOMENA
J01X
J01XA
J01XA01
INN
ciprofloksacin
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
CITERAL
koncentrat za rastvor
za infuziju
ampula, 5 po 10 ml
(100 mg/10 ml)
Alkaloid d.o.o.
Republika Srbija
1.029,80
0,5 g
1.029,80
LEVOMAX
rastvor za infuziju
kesa, 10 po 100 ml
(500 mg/100 ml)
PharmaSwiss d.o.o.
Republika Srbija
13.545,30
0,5 g
1354,53
-
STAC
levofloksacin
levofloksacin
-
STAC
Ostali antibakterijski lekovi
Glikopeptidni antibakterijski lekovi
vankomicin
0029790
J01XA01
vankomicin
VANCOMYCIN-MIP
prašak za rastvor za
infuziju
ERþLFDVWDNOHQDSR
500 mg
Chephasaar Chem.
Pharm.
1HPDþND
2.442,50
2g
1.954,00
-
0029791
J01XA01
vankomicin
VANCOMYCIN-MIP
prašak za rastvor za
infuziju
ERþLFDVWDNOHQDSR
1000 mg
Chephasaar Chem.
Pharm.
1HPDþND
6.060,90
2g
2.424,36
-
1 po 500 mg
Lek farmacevtska
družba d.d.
Slovenija
488,50
2g
1.954,00
-
1 po 1 g
Lek farmacevtska
družba d.d.
Slovenija
1.212,20
2g
2.424,40
-
PharmaSwiss d.o.o.
Republika Srbija
4.885,00
2g
1.954,00
-
PharmaSwiss d.o.o.
Republika Srbija
12.121,80
2g
2.424,36
-
0029795
0029796
J01XA01
J01XA01
vankomicin
vankomicin
EDICIN
EDICIN
injekcija
injekcija
0029294
J01XA01
vankomicin
KOVANCIN
liofilizat za rastvor za ERþLFDVWDNOHQDSR
infuziju
500 mg
0029293
J01XA01
vankomicin
KOVANCIN
liofilizat za rastvor za ERþLFDVWDNOHQDSR
infuziju
1g
0029801
J01XA01
vankomicin
VOXIN
prašak za rastvor za
infuziju
ERþLFDVWDNOHQDSR
500 mg
Vianex S.A.
*UþND
488,50
2g
1.954,00
-
vankomicin
VANCOMYCIN
RIEMSER
prašak za rastvor za
infuziju
ERþLFDVWDNOHQDSR
1000 mg
Riemser Arzneimittel
AG
1HPDþND
6.061,00
2g
2.424,40
-
vankomicin
VANCOMYCIN
RIEMSER
prašak za rastvor za
infuziju
ERþLFDVWDNOHQDSR
500 mg
Riemser Arzneimittel
AG
1HPDþND
2.442,50
2g
1.954,00
-
TARGOCID
OLRERþLFDVD
UDVWYDUDþHPXDPSXOL
prašak za rastvor za 1 po 3 ml (200 mg/3
injekciju
ml)
Gruppo Lepetit SPA
Italija
1.981,20
0,4 g
3.962,40
-
0029797
0029798
J01XA01
J01XA01
NAPOMENA
J01XA02
0029760
J01XA02
**
teikoplanin
teikoplanin
/LVWD%*UXSD-/HNRYLNRMLSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0029761
ATC
J01XA02
NAPOMENA
J01XD
J01XD01
0029081
0029784
J01XD01
J01XD01
NAPOMENA
J01X
J01XX
J01XX08
1029050
J01XX08
INN
teikoplanin
=DãWLüHQRLPH
leka
TARGOCID
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
OLRERþLFDVD
UDVWYDUDþHPXDPSXOL
prašak za rastvor za 1 po 3 ml (400 mg/3
injekciju
ml)
Gruppo Lepetit SPA
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Italija
3.729,40
0,4 g
3.729,40
-
Cena leka Participacija
na veliko osiguranog
po DDD
lica
**
Derivati imidazola
metronidazol
metronidazol
ORVAGIL
metronidazol
METRONIDAZOLE B.
BRAUN
rastvor za infuziju
100 ml (500 mg/100
ml)
Galenika a.d.
Republika Srbija
225,80
1,5 g
677,40
-
rastvor za infuziju
20 po 100 ml (500
mg/100 ml)
B. Braun Melsungen
AG; B. Braun Medical
SA
1HPDþNDâSDQLMD
2.862,80
1,5 g
429,42
-
STAC
Ostali antibakterijski lekovi
Ostali antibakterijski lekovi
linezolid
linezolid
ZENIX
film tableta
blister, 10 po 600 mg
Hemofarm a.d.
Republika Srbija
41.717,70
1,2 g
8.343,54
-
Hemofarm a.d.
Republika Srbija
1.398,20
1,2 g
8.389,20
-
0029060
J01XX08
linezolid
ZENIX
rastvor za infuziju
boca staklena, 1 po
100 ml (2 mg/ml)
0029061
J01XX08
linezolid
ZENIX
rastvor za infuziju
boca staklena, 1 po
300 ml (2 mg/ml)
Hemofarm a.d.
Republika Srbija
4.194,60
1,2 g
8.389,20
-
film tableta
blister, 30 po 600 mg
Pfizer Pharmaceuticals
LLC
Portoriko
125.153,10
1,2 g
8.343,54
-
rastvor za infuziju
kesa, 10 po 300 ml (2
mg/ml)
Fresenius Kabi Norge
AS
Norveška
41.946,00
1,2 g
8.389,20
-
1029051
0029063
J01XX08
J01XX08
NAPOMENA
linezolid
linezolid
**
ZYVOX
ZYVOX
/LVWD%*UXSD-/HNRYLNRMLSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
FO
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
ATC
J02
J02A
J02AA
J02AA01
amfotericin b
0327490
J02AA01
amfotericin b
AMPHOCIL
liofilizat za rastvor za
infuziju
1 po 50 mg
Chiesi Pharmaceuticals
GmbH
Austrija
12.729,50
35 mg
8.910,65
-
0327491
J02AA01
amfotericin b
AMPHOCIL
liofilizat za rastvor za
infuziju
1 po 100 mg
Chiesi Pharmaceuticals
GmbH
Austrija
23.399,40
35 mg
8.189,79
-
NAPOMENA
J02AC
J02AC01
INN
=DãWLüHQRLPH
leka
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
ANTIMIKOTICI ZA SISTEMSKU PRIMENU
Antimikotici za sistemsku primenu
Antimikotici za sistemsku primenu
**
Derivati triazola
flukonazol
0327312
J02AC01
flukonazol
DIFLUCAN
rastvor za infuziju
1 po 100 ml (2 mg/ml)
Pfizer PGM
Francuska
1.016,60
0,2 g
1.016,60
-
0327357
J02AC01
flukonazol
FLUCONAL
rastvor za infuziju
ERþLFDVWDNOHQDSR
100 ml (2 mg/ml)
Hemofarm a.d.
Republika Srbija
1.016,60
0,2 g
1.016,60
-
flukonazol
FLUCONAZOLETEVA
rastvor za infuziju
kesa, 10 po 100 ml (2
mg/ml)
Teva Pharmaceutical
Works Private Ltd.
Company
0DÿDUVND
10.166,00
0,2 g
1.016,60
-
0327313
J02AC01
NAPOMENA
J02AC03
STAC
vorikonazol
0327534
J02AC03
vorikonazol
VFEND
prašak za rastvor za
infuziju
1 po 200 mg
Pfizer PGM
Francuska
12.000,90
0,4 g
24.001,80
-
1327530
J02AC03
vorikonazol
VFEND
film tableta
blister, 10 po 50 mg
Pfizer Manufacturing
Deutschland GmbH
1HPDþND
9.205,60
0,4 g
7.364,48
-
1327532
J02AC03
vorikonazol
VFEND
film tableta
blister, 10 po 200 mg
Pfizer Manufacturing
Deutschland GmbH
1HPDþND
37.965,60
0,4 g
7.593,12
-
NAPOMENA
STAC; Samo u zdravstvenim ustanovama koje obavljaju zdravstvenu delatnost na tercijarnom nivou zdravstvene zaštite.
/LVWD%*UXSD-/HNRYLNRMLSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
FO
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
ATC
J02AX
J02AX04
kaspofungin
0327560
J02AX04
kaspofungin
CANCIDAS
prašak za rastvor za
infuziju
1 po 50 mg
Merck Sharp & Dohme
B.V.
Holandija
44.382,90
50 mg
44.382,90
-
0327561
J02AX04
kaspofungin
CANCIDAS
prašak za koncentrat
za rastvor za infuziju
1 po 70 mg
Merck Sharp & Dohme
B.V.
Holandija
59.177,30
50 mg
42.269,50
-
NAPOMENA
J05
J05A
J05AB
J05AB01
INN
=DãWLüHQRLPH
leka
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
Ostali antimikotici za sistemsku primenu
**; Samo u zdravstvenim ustanovama koje obavljaju zdravstvenu delatnost na tercijarnom nivou zdravstvene zaštite.
ANTIVIRUSNI LEKOVI ZA SISTEMSKU PRIMENU
Lekovi sa direktnim delovanjem na viruse
1XNOHR]LGLLQXNOHRWLGLLVNOMXþXMXüLLQKLELWRUHUHYHU]QHWUDQVNULSWD]H
aciklovir
0328270
J05AB01
aciklovir
ZOVIRAX
prašak za rastvor za
infuziju
0328251
J05AB01
aciklovir
MEDOVIR
prašak za rastvor za ERþLFDVWDNOHQDSR
infuziju
250 mg
0328252
J05AB01
aciklovir
MEDOVIR
prašak za rastvor za
infuziju
CYMEVENE
prašak za rastvor za
infuziju
NAPOMENA
J05AB06
0328260
J05AB06
NAPOMENA
J05AX
J05AX07
0328650
J05AX07
NAPOMENA
GlaxoSmithKline
Manufacturing S.P.A.
Italija
3.678,20
4g
11.770,24
-
Medochemie Ltd.;
Lisapharma S.P.A.
Kipar; Italija
7.356,40
4g
11.770,24
-
ERþLFDVWDNOHQD
po 250 mg
Medochemie Ltd.;
Lisapharma S.P.A.
Kipar; Italija
73.564,00
4g
11.770,24
-
1 po 500 mg
F. Hoffmann-La Roche
Ltd.
Švajcarska
3.528,20
0,5 g
3.528,20
-
Švajcarska
156.723,20
0,18 g
5.224,11
-
ERþLFDSRPJ
**
ganciklovir
ganciklovir
**
Ostali
enfuvirtid
enfuvirtid
FUZEON
ERþLFDVDSUDãNRPL
ERþLFDVD
SUDãDNLUDVWYDUDþ]D UDVWYDUDþHPSR F. Hoffmann-La Roche
rastvor za injekciju
ml (90 mg/ml)
Ltd.
67$&/HNVHXYRGLXWHUDSLMXVDPRNRGRQLK+,9SR]LWLYQLKSDFLMHQDWDNRMLVXGXJROHþHQLDQWLUHWURYLUXVQLPOHNRYLPDLNRGNRMLKWHVWRYLJHQRWLSVNHUH]LVWHQFLMH
pokazuju da se kombinacije od tri antiretrovirusna leka može sastaviti samo uz upotrebu Peptida T-20.
/LVWD%*UXSD-/HNRYLNRMLSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0010200
INN
=DãWLüHQRLPH
leka
ATC
J06
J06A
J06AA
J06AA03
antiserum protiv zmijskog otrova (konjski)
J06AA03
antiserum protiv
zmijskog otrova
(konjski )
VIEKVIN
FO
rastvor za injekciju
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
IMUNOSERUMI I IMUNOGLOBULINI
Imunoserumi
Imunoserumi
ERþLFDVWDNOHQDSR
ml
Institut za virusologiju,
vakcine i serume
"Torlak"
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Republika Srbija
1.175,20
-
-
-
Cena leka Participacija
na veliko osiguranog
po DDD
lica
Imunoglobulini
,PXQRJOREXOLQLQHVSHFLILþQLKXPDQL
J06B
J06BA
J06BA02
imunoglobulin (IgG-7S), intravenski
J06BA02
imunoglobulin (IgG-7S),
intravenski
IG VENA
0013501
rastvor za infuziju
ERþLFDSRPO
mg/ml)
Kedrion S.P.A.
Italija
7.661,50
-
-
-
J06BA02
imunoglobulin (IgG-7S),
intravenski
IG VENA
rastvor za infuziju
ERþLFDSRPO
mg/ml)
Kedrion S.P.A.
Italija
19.153,70
-
-
-
0013502
J06BA02
imunoglobulin (IgG-7S),
intravenski
IG VENA
rastvor za infuziju
ERþLFDSRPO
mg/ml)
Kedrion S.P.A.
Italija
38.307,70
-
-
-
0013503
J06BA02
rastvor za infuziju
ERþLFDSRPO
(50mg/ml)
Kedrion S.P.A.
Italija
76.615,40
-
-
-
0013463
J06BA02
imunoglobulin (IgG-7S),
intravenski
IG VENA
HUMANI
imunoglobulin (IgG-7S), IMUNOGLOBULIN
intravenski
5%
rastvor za infuziju
ERþLFDSRPO
mg/ml)
Institut za transfuziju
krvi Srbije
Republika Srbija
19.065,30
-
-
-
J06BA02
imunoglobulin (IgG-7S),
intravenski
OCTAGAM
rastvor za infuziju
1 po 50 ml (50 mg/ml)
Octapharma
Pharmazeutika
Produktionsges m.b.H
Austrija
19.153,70
-
-
-
J06BA02
imunoglobulin (IgG-7S),
intravenski
OCTAGAM
rastvor za infuziju
ERþLFDSRPO
(50 mg/1ml)
Octapharma
Pharmazeutika
Produktionsges m.b.H
Austrija
38.307,70
-
-
-
J06BA02
HUMANI
imunoglobulin (IgG-7S), IMUNOGLOBULIN
intravenski
5%
rastvor za infuziju
ERþLFDSRPO
mg/ml)
Institut za transfuziju
krvi Srbije
Republika Srbija
9.568,90
-
-
-
0013500
0013510
0013511
0013462
/LVWD%*UXSD-/HNRYLNRMLSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0013602
0013600
0013601
0013505
0013507
0013506
0013605
0013606
ATC
INN
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
J06BA02
humani normalni
imunoglobulin za
intravensku upotrebu
INTRATECT
rastvor za infuziju
ERþLFDVWDNOHQDSR
50 ml (50 mg/ml)
Biotest Pharma GmbH
1HPDþND
19.153,30
-
-
-
J06BA02
humani normalni
imunoglobulin za
intravensku upotrebu
INTRATECT
rastvor za infuziju
ERþLFDVWDNOHQDSR
100 ml (50 mg/ml)
Biotest Pharma GmbH
1HPDþND
38.307,70
-
-
-
J06BA02
humani normalni
imunoglobulin za
intravensku upotrebu
INTRATECT
rastvor za infuziju
ERþLFDVWDNOHQDSR
200 ml (50 mg/ml)
Biotest Pharma GmbH
1HPDþND
76.612,70
-
-
-
J06BA02
humani normalni
imunoglobulin za
intravensku upotrebu
KIOVIG
rastvor za infuziju
ERþLFDVWDNOHQDSR
100 ml (10%)
Baxter S.A.
Belgija
76.612,70
-
-
-
J06BA02
humani normalni
imunoglobulin za
intravensku upotrebu
KIOVIG
rastvor za infuziju
ERþLFDVWDNOHQDSR
50 ml (10%)
Baxter S.A.
Belgija
38.306,10
-
-
-
J06BA02
humani normalni
imunoglobulin za
intravensku upotrebu
KIOVIG
rastvor za infuziju
ERþLFDVWDNOHQDSR
25 ml (10%)
Baxter S.A.
Belgija
19.153,30
-
-
-
J06BA02
humani normalni
imunoglobulin za
intravensku primenu
PRIVIGEN
rastvor za infuziju
ERþLFDVWDNOHQDSR
25 ml (100 mg/ml)
CSL Behring AG
Švajcarska
19.146,80
-
-
-
J06BA02
humani normalni
imunoglobulin za
intravensku primenu
PRIVIGEN
rastvor za infuziju
ERþLFDVWDNOHQDSR
50 ml (100 mg/ml)
CSL Behring AG
Švajcarska
38.305,80
-
-
-
/LVWD%*UXSD-/HNRYLNRMLSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0013607
ATC
J06BA02
NAPOMENA
J06BB
J06BB01
0013447
0013315
0013445
INN
humani normalni
imunoglobulin za
intravensku primenu
=DãWLüHQRLPH
leka
PRIVIGEN
CSL Behring AG
Švajcarska
76.611,50
-
-
-
Imunoglobulin anti -D
(RhO)
IMMUNORHO
SUDãDNLUDVWYDUDþ]D
rastvor za injekciju
1 po 300 mcg sa
rastv.
Kedrion S.P.A.
Italija
4.071,20
-
-
-
J06BB01
anti-D (Rho)
imunoglobulin 1250 i.j.
(izraženo na
supstancu)
RHESONATIV
rastvor za injekciju
ampula, 1 po 2 ml
(1250 i.j. / 2 ml)
Octapharma AB
Švedska
5.107,50
-
-
-
J06BB01
anti-D (Rho)
imunoglobulin, humani RHOPHYLAC 300
rastvor za injekciju u
napunjenom
injekcionom špricu
napunjen injekcioni
špric, 1 po 2 ml (300
mcg/2 ml)
CSL Behring AG
Švajcarska
5.107,50
í
í
-
STAC
imunoglobulin antitetanusni
imunoglobulin
antitetanusni
0013434
J06BB02
imunoglobulin
antitetanusni
0013160
J06BB02
tetanus imunoglobulin,
humani
ATEBULIN
J06BB02
antitetanusni
imunoglobulin, humani TETABULIN S/D
J06BB04
hepatitis B imunoglobulin
J06BB04
hepatitis B
imunoglobulin, humani IMMUNO HBS
0013312
ERþLFDVWDNOHQDSR
100 ml (100 mg/ml)
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
67$&/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVSHFLMDOLVWHRGJRYDUDMXüHJUDQHPHGLFLQHX]SRWSLVQDþHOQLNDLGLUHNWRUD]GUDYVWYHQHXVWDQRYHNRMD
obavlja zdravstvenu delatnost na tercijarnom nivou, a nastavak terapije, po potrebi u zdravstvenoj ustanovi koja obavlja zdravstvenu delatnost na sekundarnom
nivou.
,PXQRJOREXOLQLVSHFLILþQL
imunoglobulin anti -D (RhO)
J06BB02
0013165
rastvor za infuziju
Cena leka
na veliko
za
pakovanje
J06BB01
NAPOMENA
J06BB02
0013167
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
TETAGAM P
TETANUS GAMMA
injekcija
1 po 250 i.j./1 ml
ZLB Behring GmbH
1HPDþND
952,40
-
-
-
napunjen injekcioni
špric
1 po 250 i.j./1 ml
Kedrion S.P.A.
Italija
798,10
-
-
-
injekcija
1 po 250 i.j.
Institut za transfuziju
krvi Srbije
Republika Srbija
952,50
-
-
-
rastvor za injekciju
napunjen injekcioni
špric,1 po 1 ml (250
i.j./1 ml)
Baxter AG
Austrija
1.047,60
-
-
-
rastvor za injekciju
ERþLFDVWDNOHQDSR
ml (180 i.j./1ml)
Kedrion S.P.A.
Italija
7.685,10
-
-
-
/LVWD%*UXSD-/HNRYLNRMLSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
DDD
Italija
26.920,30
-
-
-
Cena leka Participacija
na veliko osiguranog
po DDD
lica
ATC
0013313
J06BB04
hepatitis B
imunoglobulin, humani IMMUNO HBS
rastvor za injekciju
ERþLFDVWDNOHQDSR
ml (540 i.j./3 ml)
J06BB04
humani hepatitis B
imunoglobulin za
intravensku primenu
HEPATECT CP
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (50 i.j./ml)
Biotest Pharma GmbH
1HPDþND
7.540,40
-
-
-
J06BB04
humani hepatitis B
imunoglobulin za
intravensku primenu
HEPATECT CP
rastvor za infuziju
ERþLFDVWDNOHQDSR
10 ml (50 i.j./ml)
Biotest Pharma GmbH
1HPDþND
34.660,70
-
-
-
J06BB04
humani hepatitis B
imunoglobulin za
intravensku primenu
HEPATECT CP
rastvor za infuziju
ERþLFDVWDNOHQDSR
40 ml (50 i.j./ml)
Biotest Pharma GmbH
1HPDþND
133.782,20
-
-
-
J06BB05
imunoglobulin protiv besnila
rabies imunoglobulin
IMUNOGLOBULIN
(LJUDSKI) PROTIV
BESNILA
rastvor za injekciju
ERþLFDSRPO
i.j/ml)
Imunološki zavod d.d.
Hrvatska
9.121,00
-
-
-
rabies imunoglobulin,
humani
HUMANI
ANTIRABIJSKI
IMUNOGLOBULIN
rastvor za injekciju
1 po 1 ml (najmanje
100 i.j./1 ml)
Institut za transfuziju
krvi Srbije
Republika Srbija
22,60/i.j.
-
-
-
rabies imunoglobulin,
humani
HUMANI
ANTIRABIJSKI
IMUNOGLOBULIN
rastvor za injekciju
1 po 2 ml (najmanje
100 i.j./1 ml)
Institut za transfuziju
krvi Srbije
Republika Srbija
22,60/i.j.
-
-
-
J06BB05
imunoglobulin protiv
besnila
HUMANI
ANTIRABIJSKI
IMUNOGLOBULIN
rastvor za injekciju
1 po 5 ml (najmanje
100 i.j./ml)
Institut za transfuziju
krvi Srbije
Republika Srbija
22,60/i.j.
-
-
-
J06BB16
palivizumab
Abbott S.R.L.
Italija
57.478,00
о
о
-
0013318
0013319
0013221
0013250
0013251
0013252
0013286
J06BB05
J06BB05
J06BB05
J06BB16
palivizumab
SYNAGIS
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Cena leka
na veliko
za
pakovanje
JKL
0013317
INN
=DãWLüHQRLPH
leka
Država
proizvodnje
leka
ERþLFDVDUDVWYDUDþHP
SUDãDNLUDVWYDUDþ]D u ampuli, 1 po 1 ml (50
rastvor za injekciju
mg)
Kedrion S.P.A.
/LVWD%*UXSD-/HNRYLNRMLSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0013285
ATC
J06BB16
INN
palivizumab
=DãWLüHQRLPH
leka
SYNAGIS
FO
SUDãDNLUDVWYDUDþ]D
rastvor za injekciju
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
ERþLFDVDUDVWYDUDþHP
u ampuli, 1 po 1 ml
(100 mg)
Abbott S.R.L.
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Italija
94.688,10
о
Cena leka Participacija
na veliko osiguranog
po DDD
lica
о
-
INDIKACIJE
1. Prevencija teških oblika oboljenja donjih disajnih puteva koji zahtevaju hospitalizaciju i koje izaziva respiratorni sincicijalni virus (RSV) kod dece sa visokim
rizikom od nastanka RSV oboljenja i to:
VYDGHFDURÿHQDXQHGHOMLJHVWDFLMHLOLUDQLMHNRMDVXQDSRþHWNX569VH]RQHVWDURVWLGRPHVHFL
GHFDURÿHQDXQHGHOMLJHVWDFLMHNRMDQDSRþHWNX569VH]RQHLPDMXGRPHVHFLLSULVXVWYREDUGYDRGQDYHGHQLKIDNWRUDUL]LNDRWSXãWHQLL]
EROQLFHSRURGLOLãWDXYUHPH569VH]RQHQDYHãWDþNRMLVKUDQLGHFDL]YLãHVWUXNLKWUXGQRüDERUDYDNXMDVOLFDPDWUHüHLGDOMHURÿHQRGHWHLSULVXVWYRWHãNLKSUDWHüLK
bolesti),
GHFDVDKURQLþQRPSOXüQRPEROHãüXEURQKRSXOPRQDUQDGLVSOD]LMDNRMDQDSRþHWNX569VH]RQHLPDMXGRPHVHFLLOLGRPHVHFDXNROLNRVXWRNRP
prethodnih šest meseci zahtevala primenu kiseonika ili drugu medikamentoznu terapiju,
GHFDVDXURÿHQLPVUþDQLPPDQDPDNRMDQDSRþHWNX569VH]RQHLPDMXGRPHVHFLDNRMDVXRSHULVDQDLOLüHXVNRURELWLRSHULVDQD
NAPOMENA
J07
J07A
J07AG
J07AG01
67$&/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVSHFLMDOLVWDRGJRYDUDMXüHJUDQHPHGLFLQHX]SRWSLVQDþHOQLNDLGLUHNWRUDNOLQLNH
VAKCINE
Bakterijske vakcine
Kapsulirani antigen hemofilus influence tip B
hemofilus influence tip B
0011857
0011917
J07AG01
vakcina protiv
Haemofilus influenzae
tip B, konjugovana
J07AG01
vakcina protiv
Haemofilus influenzae
tip B
NAPOMENA
ACT-HIB
ERþLFDVDSUDãNRPL
napunjeni injekcioni
ãSULFVDUDVWYDUDþHP
SUDãDNLUDVWYDUDþ]D
1 po 0,5 ml (10
rastvor za injekciju
mcg/0,5 ml)
Sanofi Pasteur
Francuska
790,00
-
-
-
HIBERIX
ERþLFDVDSUDãNRPL
ampula sa
SUDãDNLUDVWYDUDþ]D UDVWYDUDþHPSR
rastvor za injekciju 0,5 ml (10 mcg/0,5 ml)
GlaxoSmithKline
Biologicals S.A.
Belgija
79.003,50
-
-
-
Prema programu obavezne imunizacije.
/LVWD%*UXSD-/HNRYLNRMLSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0011858
ATC
J07AH
J07AH03
J07AH03
NAPOMENA
J07AJ
J07AJ51
0011147
J07AJ51
NAPOMENA
J07AJ52
0011865
0011922
J07AJ52
J07AJ52
NAPOMENA
INN
=DãWLüHQRLPH
leka
FO
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Francuska
819,10
-
-
-
Republika Srbija
16.309,10
-
-
-
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Vakcine protiv meningokoka
Cena leka Participacija
na veliko osiguranog
po DDD
lica
Vakcina protiv meningitisa (tip A i C)
vakcina protiv
meningitisa (tip A i
C),polisaharidna
MENINGOCOCCAL
A+C
OLRERþLFDVD
UDVWYDUDþHPXãSULFX
SUDãDNLUDVWYDUDþ]D
1 po 0,5 ml (50
suspenziju za
mcg/0,5 ml + 50
injekciju
mcg/0,5 ml)
Sanofi Pasteur S.A.
Prema programu obavezne imunizacije.
Vakcine protiv pertususa (veliki kašalj)
vakcina protiv difterije, tetanusa i velikog kašlja
vakcina protiv difterije,
tetanusa i velikog
kašlja, adsorbovana
ALDIPETE-T
suspenzija za
injekciju
ERþLFD[POLM
(najmanje)+40i.j.
(najmanje)+4i.j.
(najmanje))/0.5mL;
Institut za virusologiju,
vakcine i serume
"Torlak"
Prema programu obavezne imunizacije.
YDNFLQDSURWLYGLIWHULMHLWHWDQXVDLYHOLNRJNDãOMDWRNVRLG&GLSKWKHULDHWRNVRLG&WHWDQLLLQDNWLYLVDQHFHOHüHOLMH%SHUWXVVLV
vakcina protiv
difterije,tetanusa i
pertusisa (acelularna),
adsorbovana
vakcina protiv difterije,
tetanusa i pertusisa
(acelularna),
adsorbovana
TRIPACEL
TRIPACEL
Prema programu obavezne imunizacije.
suspenzija za
injekciju
ERþLFDVWDNOHQDSR
0,5 ml (10 mcg/0,5 ml
+ 5 mcg/0,5 ml + 5
mcg/0,5 ml + 3
mcg/0,5 ml + 30 i.j./0,5
ml + 40 i.j./0,5 ml)
Sanofi Pasteur Limited
Kanada
3.762,60
-
-
-
suspenzija za
injekciju
ERþLFDVWDNOHQDSR
0,5 ml (10 mcg/0,5 ml
+ 5 mcg/0,5 ml + 5
mcg/0,5 ml + 3
mcg/0,5 ml + 30 i.j./0,5
ml + 40 i.j./0,5 ml)
Sanofi Pasteur Limited
Kanada
752,50
-
-
-
/LVWD%*UXSD-/HNRYLNRMLSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0011856
Sanofi Pasteur S.A.
Francuska
1.033,40
-
-
-
Wyeth Pharmaceuticals
Velika Britanija
5.104,30
-
-
-
Belgija
4.976,10
-
-
-
Republika Srbija
184,30
-
-
-
J07AL01
vakcina protiv
pneumokoka,
polivalentna
=DãWLüHQRLPH
leka
PNEUMO 23
rastvor za injekciju
napunjen injekcioni
špric, 1 po 0,5 ml (25
mcg/0,5 ml)
pneumokokna saharidna konjugovana vakcina, adsorbovana
J07AL02
pneumokokna
saharidna konjugovana
vakcina, adsorbovana PREVENAR
J07AL52
J07AM01
Cena leka Participacija
na veliko osiguranog
po DDD
lica
Prema programu obavezne imunizacije.
J07AL02
INDIKACIJE
J07AM
J07AM01
0011840
DDD
ATC
J07AL
J07AL01
INDIKACIJE
J07AL52
0011860
Cena leka
na veliko
za
pakovanje
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
INN
FO
leka
leka
Vakcine protiv pneumokoka
YDNFLQDSURWLYSQHXPRNRNDSROLYDOHQWQDSUHþLãüHQLSROLVDKDULGQLDQWLJHQL6SQHXPRQLDH
NAPOMENA
0011920
Država
proizvodnje
leka
suspenzija za
injekciju u
napunjenom
injekcionom spricu
napunjen injekcioni
špric,1 po 0,5 ml
$QHPLMDVUSDVWLKüHOLMDVSOHQHNWRPLVDQLEROHVQLFLXURÿHQLLVWHþHQLLPXQRORãNLGHILFLWNRGGHFH
pneumokokna polisaharidna konjugovana vakcina, adsorbovana
pneumokokna
polisaharidna
konjugovana vakcina,
adsorbovana
SYNFLORIX
suspenzija za
injekciju u
napunjenom
injekcionom špricu
napunjen injekcioni
špric 1 po 0,5 ml (1
mcg/0,5 ml + 3
mcg/0,5 ml + 1
mcg/0,5 ml + 1
mcg/0,5 ml + 1
mcg/0,5 ml + 1
mcg/0,5 ml + 1
mcg/0,5 ml + 3
mcg/0,5 ml + 3
mcg/0,5 ml + 1
mcg/0,5 ml
GlaxoSmithKline
Biologicals S.A.
$QHPLMDVUSDVWLKüHOLMDVSOHQHNWRPLVDQLEROHVQLFLXURÿHQLLVWHþHQLLPXQRORãNLGHILFLWNRGGHFH
Vakcine protiv tetanusa
vakcina protiv tetanusa (toksoid C. tetani)
vakcina protiv tetanusa,
adsorbovana
TETAVAKSAL T
suspenzija za
injekciju
1 po 0,5 ml (najmanje
40 i.j./0,5 ml)
Institut za virusologiju,
vakcine i serume
"Torlak"
/LVWD%*UXSD-/HNRYLNRMLSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0011841
0011512
0011017
0011831
ATC
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
J07AM01
suspenzija za
injekciju
10 po 0,5 ml (najmanje
40 i.j./0,5 ml)
Institut za virusologiju,
vakcine i serume
"Torlak"
Republika Srbija
1.352,20
-
-
-
J07AM01
vakcina protiv tetanusa,
adsorbovana
TETAVAKSAL T
suspenzija za
injekciju
10 po 5 ml (najmanje
40 i.j./0,5 ml)
Institut za virusologiju,
vakcine i serume
"Torlak"
Republika Srbija
8.877,30
-
-
-
J07AM51
vakcina protiv tetanusa i difterije (toksoid C. tetani i toksoid C. diphtheriae)
J07AM51
vakcina protiv difterije i DITEVAKSAL-T ZA
tetanusa, adsorbovana ODRASLE
suspenzija za
injekciju
10 po 5 ml (najviše 30
i.j./0,5ml + najmanje
40 i.j./0,5 ml)
Institut za virusologiju,
vakcine i serume
"Torlak"
Republika Srbija
8.271,80
-
-
-
J07AM51
vakcina protiv difterije i
tetanusa, adsorbovana DITEVAKSAL-T
suspenzija za
injekciju
10 po 5 ml (najmanje Institut za virusologiju,
30 i.j./0,5ml +
vakcine i serume
najmanje 40 i.j./0,5 ml)
"Torlak"
Republika Srbija
8.271,80
-
-
-
Republika Srbija
4.878,20
-
-
-
501,70
-
-
-
J07AN01
NAPOMENA
J07B
J07BB
J07BB02
0011868
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Cena leka
na veliko
za
pakovanje
vakcina protiv tetanusa,
adsorbovana
TETAVAKSAL T
NAPOMENA
J07AN
J07AN01
0011185
INN
=DãWLüHQRLPH
leka
Država
proizvodnje
leka
J07BB02
Prema programu obavezne imunizacije.
Vakcine protiv tuberkuloze
vakcina protiv tuberkuloze (živi inaktivisani bacili M. bovis, soj BCG)
vakcina protiv
tuberkuloze
BCG VAKCINA,
LIOFILIZOVANA
SUDãDNLUDVWYDUDþ]D ERþLFDVDUDVWYDUDþHP Institut za virusologiju,
suspenziju za
u ampuli 5 po 1 ml,
vakcine i serume
injekciju
1mg/mL
"Torlak"
Prema programu obavezne imunizacije.
Virusne vakcine
Virusne vakcine protiv influence (grip)
YDNFLQDSURWLYJULSDWURYDOHQWQDSUHþLãüHQLDQWLJHQLYLUXVDLQIOXHQFH$+1$+1L%
vakcina protiv gripa
(inaktivisana,rascepana
YLUXVQDþHVWLFD
FLUARIX
suspenzija za
injekciju u
napunjenom
injekcionom špricu
1 po 0,5 ml (15 mcg +
15 mcg + 15
mcg)/doza
GlaxoSmithKline
Biologicals
1HPDþND
/LVWD%*UXSD-/HNRYLNRMLSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0011876
0011877
0011913
ATC
0011551
0011891
0011904
0011890
0011907
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
J07BB02
vakcina protiv gripa,
WURYDOHQWQDSUHþLãüHQL
antigeni virusa
influence A (H1N1), A
(H3N2) I B
VAXIGRIP
suspenzija za
injekciju u
napunjenom
injekcionom špricu
1 po 0,5ml (15 mcg +
15 mcg + 15
mcg)/doza
Sanofi Pasteur S.A.
Francuska
501,70
-
-
-
J07BB02
vakcina protiv gripa,
WURYDOHQWQDSUHþLãüHQL
antigeni virusa
influence A (H1N1), A
(H3N2) I B
VAXIGRIP JUNIOR
suspenzija za
injekciju u
napunjenom
injekcionom špricu
1 po 0,25 ml (7,5 mcg
+ 7,5 mcg + 7,5
mcg)/doza
Sanofi Pasteur S.A.
Francuska
487,70
-
-
-
vakcina protiv gripa
(fragmentisani virus,
inaktivisana)
suspenzija za
injekciju u
napunjenom
injekcionom špricu
napunjen injekcioni
špric, 20 po 0,5 ml (15
mcg/doza + 15
mcg/doza + 15
mcg/doza)
Sanofi Pasteur S.A.
Francuska
10.034,10
-
-
-
J07BB02
NAPOMENA
J07BC
J07BC01
0011553
INN
=DãWLüHQRLPH
leka
Država
proizvodnje
leka
VAXIGRIP
Prema programu obavezne imunizacije.
9DNFLQDSURWLYKHSDWLWLVD]XWLFDSUHFLãüHQLDQWLJHQLYLUXVDKHSDWLWLVD%
vakcina protiv hepatitisa B
J07BC01
vakcina protiv
hepatitisa B,
rekombinantna
ENGERIX B
suspenzija za
injekciju
25 po 0,5 ml (10
mcg/0,5 ml)
GlaxoSmithKline
Biologicals S.A.
Belgija
11.932,50
-
-
-
J07BC01
vakcina protiv
hepatitisa B,
rekombinantna
ENGERIX B
suspenzija za
injekciju
25 po 1 ml (20 mcg/1
ml)
GlaxoSmithKline
Biologicals S.A.
Belgija
18.617,50
-
-
-
J07BC01
vakcina protiv
hepatitisa B,
rekombinantna
EUVAX B
suspenzija za
injekciju
ERþLFDSRPO
(10 mcg/0,5 ml)
LG Life Sciences
Južna Koreja
9.546,00
-
-
-
J07BC01
vakcina protiv
hepatitisa B,
rekombinantna
EUVAX B
suspenzija za
injekciju
ERþLFDSRPO
mcg/ml)
LG Life Sciences
Južna Koreja
744,70
-
-
-
J07BC01
vakcina protiv
hepatitisa B,
rekombinantna
EUVAX B
suspenzija za
injekciju
ERþLFDSRPO
mcg/ml)
LG Life Sciences
Južna Koreja
14.894,00
-
-
-
J07BC01
vakcina protiv
hepatitisa B,
rekombinantna
EUVAX B
suspenzija za
injekciju
ERþLFDSRPO
mcg/0,5 ml)
LG Life Sciences
Južna Koreja
477,30
-
-
-
/LVWD%*UXSD-/HNRYLNRMLSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0011906
0011905
ATC
0011866
0011909
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
J07BC01
vakcina protiv
hepatitisa B,
rekombinantna
EUVAX B
suspenzija za
injekciju
ERþLFDSRPO
(10 mcg/0,5 ml)
LG Life Sciences
Južna Koreja
4.773,10
-
-
-
J07BC01
vakcina protiv
hepatitisa B,
rekombinantna
EUVAX B
suspenzija za
injekciju
ERþLFDSRPO
mcg/1 ml)
LG Life Sciences
Južna Koreja
7.447,10
-
-
-
NAPOMENA
J07BD
J07BD52
0011855
INN
=DãWLüHQRLPH
leka
Država
proizvodnje
leka
J07BD52
J07BD52
J07BD52
NAPOMENA
Prema programu obavezne imunizacije.
Vakcina protiv morbila (malih boginja)
živi atenuirani virusi morbila, rubeole i parotitis
OLRERþLFDVD
UDVWYDUDþHPX
ampuli,10 po 0,5ml (3
log CCID50 + 3,7 log
SUDãDNLUDVWYDUDþ]D
CCID50 + 3 log
rastvor za injekciju
CCID50)
Sanofi Pasteur S.A.
Francuska
6.967,30
-
-
-
vakcina protiv malih
boginja,crvenke i
zauški (živi atenuisani
virusi morbila, rubeole i
parotitisa)
PRIORIX
OLRERþLFDVD
UDVWYDUDþHPXDPSXOL
1 doza i 1 po 0,5 ml
(10 exp3 CCID50/0,5
ml + 10 exp3,7
SUDãDNLUDVWYDUDþ]D CCID50/0,5 ml + 10
rastvor za injekciju
exp3 CCID50/0,5 ml)
GlaxoSmithKline
Biologicals S.A.
Belgija
971,90
-
-
-
vakcina protiv malih
boginja,crvenke i
zauški (živi atenuirani
virusi morbila, rubeole i
parotitisa)
PRIORIX
OLRERþLFDVD
UDVWYDUDþHPXDPSXOL
100 po 0,5 ml (10 exp3
CCID50/0,5 ml + 10
exp3,7 CCID50/0,5 ml
SUDãDNLUDVWYDUDþ]D + 10 exp3 CCID50/0,5
rastvor za injekciju
ml)
GlaxoSmithKline
Biologicals S.A.
Belgija
98.043,10
-
-
-
živi atenuirani virusi
morbila, rubeole i
parotitisa (vakcina
protiv malih boginja,
crvenke i zauški)
TRIMOVAX
Prema programu obavezne imunizacije.
/LVWD%*UXSD-/HNRYLNRMLSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
2011710
ATC
J07BF
J07BF02
J07BF02
NAPOMENA
J07BF03
0011895
J07BF03
NAPOMENA
J07BG
J07BG01
0011863
J07BG01
NAPOMENA
=DãWLüHQRLPH
leka
INN
FO
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
9DNFLQHSURWLYSROLRPLMHOLWLVDGHþLMDSDUDOL]D
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
YDNFLQDSURWLYGHþLMHSDUDOL]HRUDOQD
YDNFLQDSURWLYGHþLMH
paralize (oralna)
OPVERO
oralna suspenzija
ERþLFDSRPO
(najmanje 10΂
CCIDΐ΋/0,1ml+
najmanje 10΁
CCIDΐ΋/0,1ml+
najmanje 10΁'΄
CCIDΐ΋/0,1ml)
Sanofi Pasteur S.A.
Francuska
4.512,80
-
-
-
Sanofi Pasteur
Francuska
630,00
-
-
-
Francuska
5.600,30
-
-
-
Prema programu obavezne imunizacije.
YDNFLQDSURWLYGHþLMHSDUDOL]HWURYDOHQWQD
vakcina protiv
poliomijelitisa,
inaktivisana
suspenzija za
injekciju u
napunjenom
injekcionom špricu
IMOVAX POLIO
1 po 0,5 ml (40 D.j./0,5
ml + 8 D.j./0,5 ml + 32
D.j./0,5 ml)
Prema programu obavezne imunizacije.
Vakcine protiv rabijesa ( besnila )
vakcina protiv besnila
vakcina protiv besnila
VERORAB
SUDãDNLUDVWYDUDþ]D ERþLFDVDUDVWYDUDþHP
suspenziju za
u ampuli, 5 po 0,5 ml
injekciju
(2,5 i.j./0,5ml)
Prema programu obavezne imunizacije.
Sanofi Pasteur
/LVWD%*UXSD//HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0031500
0031501
0031051
ATC
L
L01
L01A
L01AA
L01AA01
INN
ciklofosfamid
L01AA01
ciklofosfamid
L01AA01
ciklofosfamid
L01AA06
ifosfamid
L01AA06
ifosfamid
=DãWLüHQRLPHOHND
FO
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
ANTINEOPLASTICI I IMUNOMODULATORI
ANTINEOPLASTICI
Alkilirajuci antineoplastici
Azotni plikavci
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
ENDOXAN
prašak za rastvor za
injekciju
ERþLFDSRPJ
Baxter Oncology GmbH
1HPDþND
370,30
-
-
-
ENDOXAN
prašak za rastvor za
injekciju
ERþLFDSRJ
Baxter Oncology GmbH
1HPDþND
694,90
-
-
-
HOLOXAN
prašak za rastvor za
injekciju
ERþLFDSRJ
Baxter Oncology GmbH
1HPDþND
2.157,10
-
-
-
L01B
L01BA
L01BA01
metotreksat
0034180
L01BA01
metotreksat
METHOTREXATE
rastvor za injekciju
5 po 50 mg/2 ml
Pfizer PTY. Limited
Australija
1.766,40
-
-
-
0034181
L01BA01
metotreksat
METHOTREXATE
rastvor za injekciju
1 po 500 mg/20 ml
Pfizer PTY. Limited
Australija
2.476,50
-
-
-
0034183
L01BA01
metotreksat
METHOTREXATETeva
rastvor za injekciju
ERþLFDSRPO
mg/ml)
Pharmachemie B.V.
Holandija
353,30
-
-
-
0034182
L01BA01
metotreksat
METHOTREXATETeva
rastvor za injekciju
ERþLFDSRPO
mg/ml)
Pharmachemie B.V.
Holandija
2.476,50
-
-
-
METOJECT
Medac Gesellschaft fur
napunjen injekcioni špric,
Klinische
rastvor za injekciju
1 po 1 ml, 10 mg/ml
Spezialpraparate M.B.H
1HPDþND
513,50
-
-
-
METOJECT
napunjen injekcioni špric, Medac Gesellschaft fur
1 po 1,5 ml, 15 mg/1,5
Klinische
rastvor za injekciju
ml
Spezialpraparate M.B.H
1HPDþND
1.216,00
-
-
-
METOJECT
Medac Gesellschaft fur
napunjen injekcioni špric,
Klinische
rastvor za injekciju
1 po 2 ml, 20 mg/2 ml
Spezialpraparate M.B.H
1HPDþND
1.467,20
-
-
-
METOJECT
napunjen injekcioni špric, Medac Gesellschaft fur
1 po 2,5 ml, 25 mg/2,5
Klinische
rastvor za injekciju
ml
Spezialpraparate M.B.H
1HPDþND
1.807,10
-
-
-
0034152
0034151
0034153
0034154
L01BA01
L01BA01
L01BA01
L01BA01
Antimetaboliti
Analozi folne kiseline
metotreksat
metotreksat
metotreksat
metotreksat
/LVWD%*UXSD//HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0034025
ATC
L01BB
L01BB04
kladribin
L01BB04
kladribin
NAPOMENA
L01BB05
INN
=DãWLüHQRLPHOHND
LITAK
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Analozi purina
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
rastvor za injekciju
ERþLFDVWDNOHQDSR
mg/5 ml
Lipomed AG
Švajcarska
146.745,30
-
-
-
STAC
fludarabin
0034020
L01BB05
fludarabin
FLUDARA ¸
prašak za rastvor za
injekciju/infuziju
5 po 50 mg
Bayer Schering Pharma
AG
1HPDþND
35.334,00
-
-
-
0034801
L01BB05
fludarabin
SINDARABIN ¸
prašak za rastvor za
injekciju/infuziju
ERþLFDSRPJ
S.C. Sindan-Pharma
S.R.L.
Rumunija
7.066,80
-
-
-
koncentrat za
rastvor za
injekciju/infuziju
ERþLFDVWDNOHQDSR
ml (25 mg/ml)
Pharmachemie B.V.
Holandija
7.066,80
-
-
-
0034800
L01BB05
fludarabin
FLUDARABINE-Teva
¸
INDIKACIJE
+URQLþQDOLPIRFLWQDOHXNHPLMDLQHKRþNLQVNLOLPIRPLIROLNXODUQLOLPIRPLOLPIRPLPDUJLQDOQH]RQH0$17/(üHOLMVNLOLPIRPOLPIRSOD]PRFLWQLOLPIRP
NAPOMENA
L01BC
L01BC01
67$&/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- Klinika za hematologiju KC Srbije,
- KBC Bežanijska Kosa,
- Institut za onkologiju Vojvodine,
- Klinika za hematologiju KC Vojvodine,
.OLQLND]DKHPDWRORJLMXLNOLQLþNXLPXQRORJLMX.&1Lã
- KC Kragujevac,
,QVWLWXW]D]GUDYVWYHQX]DãWLWXPDMNHLGHWHWD6UELMHÄ'U9XNDQýXSLü´
- Institut za zdravstvenu zaštitu dece i omladine Vojvodine,
.OLQLND]DGHþMHLQWHUQHEROHVWL.&1Lã
8QLYHU]LWHWVNDGHþMDNOLQLND
Nastavak terapije u zdravstvenim ustanovama koje obavljaju zdravstvenu delatnost na sekundarnom ili tercijarnom nivou u mestu prebivališta osiguranog lica.
Analozi pirimidina
citarabin
0034140
L01BC01
citarabin
CYTOSAR
OLRERþLFDVDUDVWYDUDþHP
SUDãDNLUDVWYDUDþ]D u ampuli,1 po 5 ml (100
rastvor za injekciju
mg/5 ml)
Actavis Italy S.P.A.
Italija
241,80
-
-
-
/LVWD%*UXSD//HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
ATC
INN
=DãWLüHQRLPHOHND
FO
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
Actavis Italy S.P.A.
Italija
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1.184,70
-
-
-
0034141
L01BC01
citarabin
CYTOSAR
OLRERþLFDVDUDVWYDUDþHP
SUDãDNLUDVWYDUDþ]D u ampuli,1 po 10 ml (500
rastvor za injekciju
mg/10 ml)
0034142
L01BC01
citarabin
CYTOSAR
SUDãDNLUDVWYDUDþ]D
rastvor za injekciju
ERþLFDSRPJ
Actavis Italy S.P.A.
Italija
2.103,10
-
-
-
ALEXAN Ebewe
rastvor za
injekciju/infuziju
ERþLFDVWDNOHQDSR
mg/5 ml
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
241,80
-
-
-
ALEXAN Ebewe
rastvor za
injekciju/infuziju
ERþLFDVWDNOHQDSR
mg/10 ml
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
1.184,70
-
-
-
ALEXAN Ebewe
rastvor za
injekciju/infuziju
ERþLFDVWDNOHQDSR
1000 mg/20 ml
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
2.103,10
-
-
-
5-FLUOROURACIL
"Ebewe"
koncentrat za
rastvor za
injekciju/infuziju
ampula, 5 po 5 ml (250
mg/5 ml)
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
734,50
-
-
-
fluorouracil
5-FLUOROURACIL
"Ebewe"
koncentrat za
rastvor za
injekciju/infuziju
ampula, 5 po 10 ml (500
mg/10 ml)
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
1.166,50
-
-
-
fluorouracil
FLUOROURACIL TEVA
rastvor za injekciju
ERþLFDSRPO
mg/ml)
Pharmachemie B.V.
Holandija
146,90
-
-
-
L01BC02
fluorouracil
FLUOROURACIL TEVA
rastvor za injekciju
ERþLFDSRPO
mg/ml)
Pharmachemie B.V.
Holandija
233,30
-
-
-
L01BC05
gemcitabin
0034210
L01BC05
gemcitabin
GEMZAR ¸
prašak za rastvor za
infuziju
ERþLFDSRPJ
Lilly France S.A.S.
Francuska
1.209,00
-
-
-
0034211
L01BC05
gemcitabin
GEMZAR ¸
prašak za rastvor za
infuziju
ERþLFDSRPJ
Lilly France S.A.S.
Francuska
5.716,10
-
-
-
0034213
L01BC05
gemcitabin
GEMCITABIN
SANDOZ ¸
prašak za rastvor za
infuziju
ERþLFDSRPJ
Sandoz S.A.
Argentina
1.209,00
-
-
-
0034212
L01BC05
gemcitabin
GEMCITABIN
SANDOZ ¸
prašak za rastvor za
infuziju
ERþLFDSRJ
Sandoz S.A.
Argentina
5.716,10
-
-
-
0034350
0034351
0034352
0034324
0034325
0034023
0034024
L01BC01
L01BC01
citarabin
citarabin
L01BC01
citarabin
L01BC02
fluorouracil
L01BC02
L01BC02
L01BC02
fluorouracil
/LVWD%*UXSD//HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
=DãWLüHQRLPHOHND
FO
3DNRYDQMHLMDþLQD
leka
gemcitabin
GEMCITABIN EBEWE
¸
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
200 mg/20 ml
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
1.209,00
-
-
-
L01BC05
gemcitabin
GEMCITABIN EBEWE
¸
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
1000 mg/100 ml
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
5.716,10
-
-
-
0034215
L01BC05
gemcitabin
GEMCITABIN
PharmaSwiss ¸
prašak za rastvor za
infuziju
ERþLFDVWDNOHQDSR
200 mg
PharmaSwiss d.o.o.
Republika Srbija
1.209,00
-
-
-
0034216
L01BC05
gemcitabin
GEMCITABIN
PharmaSwiss ¸
prašak za rastvor za
infuziju
ERþLFDVWDNOHQDSRJ
PharmaSwiss d.o.o.
Republika Srbija
5.716,10
-
-
-
0034214
L01BC05
gemcitabin
GEMCITABIN
PharmaSwiss ¸
prašak za rastvor za
infuziju
ERþLFDVWDNOHQDSRJ
PharmaSwiss d.o.o.
Republika Srbija
11.432,20
-
-
-
prašak za rastvor za
infuziju
1 po 200 mg
Actavis Italy S.p.a.;
S.C.Sindan-Pharma
S.R.L.
Italija; Rumunija
1.209,00
-
-
-
Italija; Rumunija
5.716,10
-
-
-
JKL
ATC
0034426
L01BC05
0034425
0034220
L01BC05
INN
gemcitabin
GITRABIN ¸
0034221
L01BC05
gemcitabin
GITRABIN ¸
prašak za rastvor za
infuziju
1 po 1000 mg
Actavis Italy S.p.a.;
S.C.Sindan-Pharma
S.R.L.
0034551
L01BC05
gemcitabin
GEMNIL ¸
prašak za rastvor za
infuziju
ERþLFDVWDNOHQDSR
200 mg
Vianex S.A
*UþND
1.209,00
-
-
-
0034550
L01BC05
gemcitabin
GEMNIL ¸
prašak za rastvor za
infuziju
ERþLFDVWDNOHQDSR
1000 mg
Vianex S.A
*UþND
5.716,10
-
-
-
ERþLFDVWDNOHQDSR
200 mg
Works Private Ltd.
Company; Pliva Hrvatska
d.o.o.
0DÿDUVND
Hrvatska
1.209,00
-
-
-
0034428
L01BC05
gemcitabin
GEMCITABIN PLIVA
200 ¸
prašak za rastvor za
infuziju
/LVWD%*UXSD//HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0034427
ATC
L01BC05
INDIKACIJE
NAPOMENA
INN
gemcitabin
=DãWLüHQRLPHOHND
GEMCITABIN PLIVA
1000 ¸
FO
prašak za rastvor za
infuziju
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
ERþLFDVWDNOHQDSR
1000 mg
Works Private Ltd.
Company; Pliva Hrvatska
d.o.o.
0DÿDUVND
Hrvatska
Cena leka
na veliko
za
pakovanje
5.716,10
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
-
-
-
1HPLNURFHOXODUQLNDUFLQRPSOXüDNOLQLþNLVWDGLMXP,,,LOL,9EH]VLPSWRPDWVNLK&16PHWDVWD]D36LOL
2. Urotelijalni karcinom (TCC):
DQHRDGMXYDQWQDWHUDSLMDNRGORNDOQRX]QDSUHGRYDOHEROHVWLNOLQLþNLVWDGLMXP,,,,,
EVLVWHPVNDWHUDSLMDXPHWDVWDWVNRMEROHVWLNOLQLþNLVWDGLMXP,936LOL
3. Karcinom dojke, metastatska bolest, posle prethodne primene antraciklina i/ili taksana i/ili kapecitabina, PS 0 ili 1;
4. Adenokarcinom pankreasa, prva linija hemioterapije, uznapredovala neresektabilna ili metastatska bolest, PS 0 ili 1.
67$&=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- Klinika za pulmologiju KC Srbije,
- KBC Bežanijska Kosa,
,QVWLWXW]DSOXüQHEROHVWL9RMYRGLQH
.OLQLND]DSOXüQHEROHVWLÄ.QH]VHOR³.&1Lã
- KC Kragujevac;
=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- Klinika za urologiju KC Srbije,
- KBC Bežanijska Kosa,
- Institut za onkologiju Vojvodine,
- Klinika za onkologiju KC Niš,
- KC Kragujevac;
=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- KBC Bežanijska Kosa,
- Institut za onkologiju Vojvodine,
- Klinika za onkologiju KC Niš,
- KC Kragujevac;
=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- Klinika za gastroenterologiju KC Srbije,
- KBC Bežanijska Kosa,
- Institut za onkologiju Vojvodine,
- Klinika za onkologiju KC Niš,
- KC Kragujevac;
Nastavak terapije u zdravstvenim ustanovama koje obavljaju zdravstvenu delatnost na sekundarnom ili tercijarnom nivou u mestu prebivališta osiguranog lica.
/LVWD%*UXSD//HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0030092
0030040
0030061
ATC
L01C
L01CA
L01CA01
INN
FO
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
vinblastin
L01CA01
vinblastin
L01CA02
vinkristin
L01CA02
vinkristin
L01CA02
=DãWLüHQRLPHOHND
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
Biljni alkaloidi i drugi prirodni proizvodi
Alkaloidi vinke i analozi
vinkristin
OLRERþLFDVDUDVWYDUDþHP
SUDãDNLUDVWYDUDþ]D u ampulu, 1 po 5 ml (10
rastvor za injekciju
mg/5 ml)
Gedeon Richter Ltd.
0DÿDUVND
1.044,50
-
-
-
Pfizer PTY. Limited
Australija
2.118,00
-
-
-
VINCRISTIN
SUDãDNLUDVWYDUDþ]D OLRERþLFDVDUDVWYDUDþHP
rastvor za
u ampuli, 1 po 10 ml (1
injekciju/infuziju
mg/10 ml)
Gedeon Richter Ltd.
0DÿDUVND
423,60
-
-
-
SINDOVIN
prašak za rastvor za
injekciju/infuziju
1 po 1 mg
S.C. Sindan-Pharma
S.R.L.
Rumunija
423,60
-
-
-
VINBLASTIN
VINCRISTINE
injekcija
5 po 1 mg/1 ml
L01CA02
vinkristin
L01CA04
vinorelbin
0030240
L01CA04
vinorelbin
VINORELSIN
koncentrat za
rastvor za infuziju
1 po 1 ml (10 mg/ml)
Actavis Italy S.P.A; S.C.
Sindan-Pharma S.R.L.
Italija; Rumunija
1.519,20
-
-
-
0030241
L01CA04
vinorelbin
VINORELSIN
koncentrat za
rastvor za infuziju
1 po 5 ml (50 mg/5 ml)
Actavis Italy S.P.A; S.C.
Sindan-Pharma S.R.L.
Italija; Rumunija
6.152,50
-
-
-
0030243
L01CA04
vinorelbin
VINORELBIN "Ebewe"
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (10 mg/ml)
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
1.519,20
-
-
-
0030242
L01CA04
vinorelbin
VINORELBIN "Ebewe"
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (50 mg/5 ml)
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
6.152,50
-
-
-
0030230
Derivati podofilotoksina
L01CB
L01CB01
etopozid
0030111
L01CB01
etopozid
ETOPOSID "Ebewe"
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (100 mg/5 ml)
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
708,40
-
-
-
0030220
L01CB01
etopozid
LASTET
koncentrat za
rastvor za infuziju
ampula, 10 po 5 ml (100
mg/5 ml)
Nippon Kayaku Co. Ltd.
Japan
7.083,70
-
-
-
0030121
L01CB01
etopozid
ETOPOSIDE-TEVA
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (100 mg/5 ml)
Pharmachemie B.V.
Holandija
708,40
-
-
-
/LVWD%*UXSD//HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
ATC
0030122
L01CB01
0039350
INN
etopozid
L01CD
L01CD01
paklitaksel
L01CD01
paklitaksel
=DãWLüHQRLPHOHND
SINTOPOZID
FO
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (100 mg/5 ml)
S.C. Sindan-Pharma
S.R.L.
Rumunija
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
708,40
-
-
-
Taksani
PACLITAXEL Ebewe ¸
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (30 mg/5 ml)
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
3.077,30
-
-
-
ERþLFDVWDNOHQDSR
100 mg/16,7 ml
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
9.744,90
-
-
-
0039351
L01CD01
paklitaksel
PACLITAXEL Ebewe ¸
koncentrat za
rastvor za infuziju
0039352
L01CD01
paklitaksel
PACLITAXEL Ebewe ¸
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (150 mg/25 ml)
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
14.430,40
-
-
-
paklitaksel
PACLITAXEL Ebewe ¸
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
300 mg/50 ml
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
28.293,50
-
-
-
paklitaksel
PACLITAXEL
PHARMASWISS ¸
koncentrat za
rastvor za infuziju
ERþLFDSRPO
mg/5 ml)
PharmaSwiss d.o.o.
Republika Srbija
3.077,30
-
-
-
koncentrat za
rastvor za infuziju
ERþLFDSRPO
mg/5 ml)
Pharmachemie B.V.
Holandija
3.077,30
-
-
-
ERþLFDSRPO
mg/16,7 ml)
Pharmachemie B.V.
Holandija
9.744,90
-
-
-
1 po 30 mg/ 5 ml
S.C. Sindan-Pharma
S.R.L.; Actavis Italy
S.P.A
Rumunija; Italija
3.077,30
-
-
-
Rumunija; Italija
9.744,90
-
-
-
0039353
0039282
L01CD01
L01CD01
0039500
L01CD01
paklitaksel
PACLITAXEL - TEVA
¸
0039501
L01CD01
paklitaksel
PACLITAXEL - TEVA
¸
koncentrat za
rastvor za infuziju
SINDAXEL ¸
koncentrat za
rastvor za infuziju
1 po 100 mg/16,67 ml
S.C. Sindan-Pharma
S.R.L.; Actavis Italy
S.P.A
0039020
L01CD01
paklitaksel
0039021
L01CD01
paklitaksel
SINDAXEL ¸
koncentrat za
rastvor za infuziju
1039852
L01CD01
paklitaksel
PATAXEL ¸
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml, 30 mg/5 ml
Vianex S.A.
*UþND
3.077,30
-
-
-
1039850
L01CD01
paklitaksel
PATAXEL ¸
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
16,7 ml, 100 mg/16,7 ml
Vianex S.A.
*UþND
9.744,90
-
-
-
/LVWD%*UXSD//HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
1039851
ATC
L01CD01
INDIKACIJE
NAPOMENA
INN
paklitaksel
=DãWLüHQRLPHOHND
PATAXEL ¸
FO
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml, 300 mg/50ml
Vianex S.A.
*UþND
Cena leka
na veliko
za
pakovanje
28.293,50
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
-
-
-
1. Karcinom dojke:
a) metastatska bolest, prva linija posle antraciklina, PS 0 ili 1 (sem kod pacijenata sa kontraindikacijama za primenu antraciklina gde može biti prva linija za metastatsku bolest bez
obzira na vrstu prethodne adjuvantne hemioterapije);
b) metastatska bolest, PS 0 ili 1 - retretman kod taksan senzitivne bolesti;
c) adjuvantna hemioterapija kod nodus pozitivne bolesti, kao sekvencijalni pristup u kombinaciji sa antraciklinima, u nedeljnom režimu kod pacijenata bez komorbiditeta vezanih za
moguüa neželjena dejstva leka (npr: kod pacijenata bez preegzistirajuüe neuropatije);
d) adjuvantna hemioterapija kod nodus negativne bolesti, kao sekvencijalni pristup u kombinaciji sa antraciklinima, u nedeljnom režimu, u sluþaju da drugi prognostiþki faktori
doprinose visokom riziku za relaps (HER 2-3+ ili ER i PGR 0 ili G3);
e) lokalno uznapredlovali karcinom dojke, sekvencijalna primena nakon prethodne primene antraciklina, u sluþaju izostanka terapijskog odgovora na antracikline (SD, PD), najviše do
þetiri ciklusa nedeljnog režima (12 nedelja);
2. Karcinom ovarijuma:
a) primarna hemioterapija za kliniþki stadijum Ic i IIa, sa visokim rizikom za relaps (svetloüelijski podtip) i gradus 3;
b) primarna hemioterapija za uznapredovali kliniþki stadijum (IIb-IV);
c) prva linija u relapsu bolesti, za inicijalno rani kliniþki stadijum (Ia-IIa), za pacijente koji nisu primali paklitaksel u postoperativnom pristupu;
d) relaps bolesti u paklitaksel-senzitivnih pacijenata (vreme od prethodne primene leka • 6 meseci);
e) paklitaksel u nedeljnim intervalima kao "salvage“ hemioterapija metastatskog karcinoma ovarijuma;
3. Nemikrocelularni karcinom pluüa, prva linija u kombinaciji sa platinskim derivatima, kliniþki stadijum IIIb/IV, PS 0 ili 1.
67$&=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- KBC Bežanijska Kosa,
- Institut za onkologiju Vojvodine,
- Klinika za onkologiju KC Niš,
- KC Kragujevac;
=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- Institut za onkologiju Vojvodine,
- Klinika za onkologiju KC Niš,
- KC Kragujevac;
=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Klinika za pulmologiju KC Srbije,
- Institut za onkologiju i radiologiju Srbije,
,QVWLWXW]DSOXüQHEROHVWL9RMYRGLQH
.OLQLND]DSOXüQHEROHVWLÄ.QH]VHOR´.&1Lã
- KCB Bežanijska kosa;
Nastavak terapije u zdravstvenim ustanovama koje obavljaju zdravstvenu delatnost na sekundarnom ili tercijarnom nivou u mestu prebivališta osiguranog lica.
/LVWD%*UXSD//HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
doksorubicin
0033102
L01DB01
doksorubicin
ADRIBLASTINA R.D.
0033103
L01DB01
doksorubicin
ADRIBLASTINA R.D.
0033050
L01DB01
INN
=DãWLüHQRLPHOHND
ATC
L01D
L01DB
L01DB01
doksorubicin
FO
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
&LWRWRNVLþQLDQWLELRWLFLLVURGQHVXSVWDQFH
Antraciklini i srodni preparati
injekcija
1 po 10 mg sa rastv.
injekcija
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
Actavis Italy S.P.A.
Italija
368,70
-
-
-
1 po 50 mg sa rastv.
Actavis Italy S.P.A.
Italija
1.854,50
-
-
-
SINDROXOCIN
prašak za rastvor za
injekciju/infuziju
1 po 10 mg
S.C. Sindan-Pharma
S.R.L.
Rumunija
368,70
-
-
-
1 po 50 mg
S.C. Sindan-Pharma
S.R.L.
Rumunija
1.854,50
-
-
-
0033051
L01DB01
doksorubicin
SINDROXOCIN
prašak za rastvor za
injekciju/infuziju
0033170
L01DB01
doksorubicin
DOXORUBICIN TEVA
prašak za rastvor za
injekciju
ERþLFDSRPJ
Pharmachemie B.V.
Holandija
368,70
-
-
-
0033171
L01DB01
doksorubicin
DOXORUBICIN TEVA
prašak za rastvor za
injekciju
ERþLFDSRPJ
Pharmachemie B.V.
Holandija
1.854,50
-
-
-
0033190
L01DB01
doksorubicin
DOXORUBICIN
"Ebewe"
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (10 mg/5 ml)
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
368,70
-
-
-
0033191
L01DB01
doksorubicin
DOXORUBICIN
"Ebewe"
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (50 mg/25 ml)
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
1.854,50
-
-
-
L01DB02
daunorubicin
Actavis Italy S.P.A.
Italija
741,50
-
-
-
L01DB02
daunorubicin
L01DB03
epirubicin
0033112
L01DB03
epirubicin
FARMORUBICIN R.D.
injekcija
1 po 10 mg sa rastv.
Actavis Italy S.P.A.
Italija
547,10
-
-
-
0033113
L01DB03
epirubicin
FARMORUBICIN R.D.
injekcija
1 po 50 mg sa rastv.
Actavis Italy S.P.A.
Italija
2.734,50
-
-
-
ERþLFDVWDNOHQDSR
ml (2 mg/ml)
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
547,10
-
-
-
ERþLFDVWDNOHQDSR
ml (2 mg/ml)
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
2.734,50
-
-
-
0033060
DAUNOBLASTINA
OLRERþLFDVDUDVWYDUDþHP
SUDãDNLUDVWYDUDþ]D u ampuli, 1 po 10 ml (20
rastvor za injekciju
mg/10 ml)
0033115
L01DB03
epirubicin
EPIRUBICIN "Ebewe"
0033116
L01DB03
epirubicin
EPIRUBICIN "Ebewe"
koncentrat za
rastvor za
injekciju/infuziju
koncentrat za
rastvor za
injekciju/infuziju
/LVWD%*UXSD//HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
ATC
INN
=DãWLüHQRLPHOHND
FO
0033130
L01DB03
epirubicin
EPISINDAN
liofilizat za rastvor
za infuziju
0033131
L01DB03
epirubicin
EPISINDAN
liofilizat za rastvor
za infuziju
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
1 po 10 mg
S.C. Sindan-Pharma
S.R.L.
Rumunija
1 po 50 mg
S.C. Sindan-Pharma
S.R.L.
Rumunija
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
547,10
-
-
-
2.734,50
-
-
-
&LWRWRNVLþQLDQWLELRWLFLLVURGQHVXSVWDQFH
Antraciklini i srodni preparati
L01D
L01DB
L01DB07
mitoksantron
0033241
L01DB07
mitoksantron
MITOXANTRON
"Ebewe" ¸
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
mg/5 ml
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
5.340,80
-
-
-
0033242
L01DB07
mitoksantron
MITOXANTRON
"Ebewe" ¸
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
mg/10 ml
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
10.241,80
-
-
-
INDIKACIJE
1. Svi oblici akutne mijeloidne leukemije;
2. Sekundarna progresivna multipla skleroza.
NAPOMENA
L01DC
L01DC01
67$&=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- Klinika za hematologiju KC Srbije,
- KCB Bežanijska kosa,
8QLYHU]LWHWVNDGHþMDNOLQLND
- Institut za onkologiju Vojvodine,
- Klinika za hematologiju KC Vojvodine,
.OLQLND]DKHPDWRORJLMXLNOLQLþNXLPXQRORJLMX.&1Lã
- KC Kragujevac,
,QVWLWXW]D]GUDYVWYHQX]DãWLWXPDMNHLGHWHWD6UELMHÄ'U9XNDQýXSLü´
- Institut za zdravstvenu zaštitu dece i omladine Vojvodine,
.OLQLND]DGHþMHLQWHUQHEROHVWL.&1Lã
Nastavak terapije u zdravstvenim ustanovama koje obavljaju zdravstvenu delatnost na sekundarnom ili tercijarnom nivou u mestu prebivališta osiguranog lica.
2VWDOLFLWRWRNVLþQLDQWLELRWLFL
bleomicin
0033220
L01DC01
bleomicin
BLEOCIN-S
prašak za rastvor za
injekciju/infuziju
ERþLFDVWDNOHQDSR
15000 i.j.
Nippon Kayaku Co. Ltd.
Japan
2.110,70
-
-
-
/LVWD%*UXSD//HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0031330
ATC
L01X
L01XA
L01XA01
INN
cisplatin
L01XA01
cisplatin
=DãWLüHQRLPHOHND
CISPLATIN "Ebewe"
FO
rastvor za infuziju
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Ostali antineoplastici
Jedinjenja platine
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1 po 10 mg/20 ml
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
334,60
-
-
-
Austrija
1.059,40
-
-
-
0031332
L01XA01
cisplatin
CISPLATIN "Ebewe"
rastvor za infuziju
1 po 50 mg/100 ml
Ebewe Pharma Ges.
M.B.H NFG. KG
0031251
L01XA01
cisplatin
CISPLATIN
rastvor za infuziju
1 po 50 ml (1 mg/ml)
Pfizer PTY. Limited
Australija
1.059,40
-
-
-
0031283
L01XA01
cisplatin
PLATOSIN
koncentrat za
rastvor za infuziju
ERþLFDSRPO
mg/20 ml)
Pharmachemie B.V.
Holandija
334,60
-
-
-
0031282
L01XA01
cisplatin
CISPLATIN-TEVA
koncentrat za
rastvor za infuziju
ERþLFDSRPO
mg/100 ml)
Pharmachemie B.V.
Holandija
1.059,40
-
-
-
0031223
L01XA01
cisplatin
SINPLATIN
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (10 mg/10 ml)
S.C. Sindan-Pharma
S.R.L.
Rumunija
337,50
-
-
-
0031224
L01XA01
cisplatin
SINPLATIN
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (50 mg/50 ml)
S.C. Sindan-Pharma
S.R.L.
Rumunija
1.059,40
-
-
-
L01XA02
karboplatin
L01XA02
karboplatin
CARBOPLATIN
"Ebewe"
koncentrat za
rastvor za infuziju
1 po 150 mg/15 ml
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
1.758,60
-
-
-
karboplatin
CARBOPLATIN
"Ebewe"
koncentrat za
rastvor za infuziju
1 po 450 mg/45 ml
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
6.021,30
-
-
-
1 po 15 ml (10 mg/ml)
Pfizer PTY. Limited
Australija
1.758,60
-
-
-
0031341
0031342
L01XA02
0031240
L01XA02
karboplatin
CARBOPLATIN
koncentrat za
rastvor za infuziju
0031304
L01XA02
karboplatin
CARBOPLATIN-TEVA
koncentrat za
rastvor za infuziju
ERþLFDSRPO
mg/15 ml)
Pharmachemie B.V.
Holandija
1.758,60
-
-
-
0031305
L01XA02
karboplatin
CARBOPLATIN-TEVA
koncentrat za
rastvor za infuziju
ERþLFDSRPO
mg/45 ml)
Pharmachemie B.V.
Holandija
6.021,30
-
-
-
0031308
L01XA02
karboplatin
CARBOPLASIN
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (10 mg/ml)
S.C. Sindan-Pharma
S.R.L.
Rumunija
669,20
-
-
-
/LVWD%*UXSD//HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
=DãWLüHQRLPHOHND
FO
1D]LYSURL]YRÿDþD
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
JKL
ATC
0031306
L01XA02
karboplatin
CARBOPLASIN
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (10 mg/ml)
S.C. Sindan-Pharma
S.R.L.
Rumunija
1.758,60
-
-
-
0031307
L01XA02
karboplatin
CARBOPLASIN
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (10 mg/ml)
S.C. Sindan-Pharma
S.R.L.
Rumunija
6.021,30
-
-
-
0031309
L01XA02
karboplatin
CARBOPLASIN
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (10 mg/ml)
S.C. Sindan-Pharma
S.R.L.
Rumunija
8.571,00
-
-
-
L01XA03
oksaliplatin
0031395
L01XA03
oksaliplatin
ELOXATIN ¸
prašak za rastvor za
infuziju
ERþLFDSRPJ
Aventis Pharma Ltd.
Velika Britanija
6.152,90
-
-
-
0031396
L01XA03
oksaliplatin
ELOXATIN ¸
prašak za rastvor za
infuziju
ERþLFDSRPJ
Aventis Pharma Ltd.
Velika Britanija
12.305,80
-
-
-
0031397
L01XA03
oksaliplatin
ELOXATIN ¸
koncentrat za
rastvor za infuziju
1 po 10 ml (5 mg/ml)
Aventis Pharma Ltd.
Velika Britanija
6.152,90
-
-
-
0031398
L01XA03
oksaliplatin
ELOXATIN ¸
koncentrat za
rastvor za infuziju
1 po 20 ml (5 mg/ml)
Aventis Pharma Ltd.
Velika Britanija
12.305,80
-
-
-
ERþLFDSRPJ
S.C. Sindan-Pharma
S.R.L.; Actavis Italia
S.P.A
Rumunija; Italija
12.305,80
-
-
-
ERþLFDSRPJ
S.C. Sindan-Pharma
S.R.L.; Actavis Italia
S.P.A
Rumunija; Italija
6.152,90
-
-
-
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
6.152,90
-
-
-
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
12.305,80
-
-
-
0031361
L01XA03
INN
3DNRYDQMHLMDþLQD
leka
Država
proizvodnje
leka
oksaliplatin
SINOXAL ¸
prašak za rastvor za
infuziju
0031360
L01XA03
oksaliplatin
SINOXAL ¸
prašak za rastvor za
infuziju
0031503
L01XA03
oksaliplatin
OXALIPLATIN
"Ebewe" ¸
prašak za rastvor za ERþLFDVWDNOHQDSR
infuziju
mg
0031502
L01XA03
oksaliplatin
OXALIPLATIN
"Ebewe" ¸
prašak za rastvor za
infuziju
ERþLFDVWDNOHQDSR
100 mg
/LVWD%*UXSD//HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0031364
0031365
ATC
L01XA03
L01XA03
INN
oksaliplatin
oksaliplatin
=DãWLüHQRLPHOHND
OXALIPLATIN-PLIVA
¸
OXALIPLATIN-PLIVA
¸
FO
koncentrat za
rastvor za infuziju
koncentrat za
rastvor za infuziju
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
ERþLFDSRPO
mg/ml)
Teva Pharmaceutical
Works Private Ltd.
Company;
Pharmachemie B.V.;
Pliva Hrvatska d.o.o.
0DÿDUVND
Holandija;
Hrvatska
ERþLFDSRPO
mg/ml)
Teva Pharmaceutical
Works Private Ltd.
Company;
Pharmachemie B.V.;
Pliva Hrvatska d.o.o.
0DÿDUVND
Holandija;
Hrvatska
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
6.152,90
-
-
-
12.305,80
-
-
-
INDIKACIJE
Kolorektalni karcinom, hemioterapija lokalno odmaklog/neresektabilnog ili metastatskog stadijuma bolesti, PS 0 ili 1, u kombinaciji sa fluoropirimidinima.
NAPOMENA
L01XX
L01XX19
67$&/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- Klinika za gastroenterologiju KC Srbije,
- KBC Bežanijska Kosa,
- Institut za onkologiju Vojvodine,
- Klinika za onkologiju KC Niš,
- KC Kragujevac;
Nastavak terapije u zdravstvenim ustanovama koje obavljaju zdravstvenu delatnost na sekundarnom ili tercijarnom nivou u mestu prebivališta osiguranog lica.
Ostali antineoplastici
irinotekan
0039291
L01XX19
irinotekan
CAMPTO ¸
koncentrat za
rastvor za infuziju
1 po 100 mg /5 ml
Pfizer (Perth) PTY. Ltd.
Australija
6.550,20
-
-
-
0039290
L01XX19
irinotekan
CAMPTO ¸
koncentrat za
rastvor za infuziju
ERþLFDSODVWLþQDSR
ml (40 mg/2 ml)
Pfizer (Perth) PTY. Ltd.
Australija
3.179,90
-
-
-
0039296
L01XX19
irinotekan
CAMPTO ¸
koncentrat za
rastvor za infuziju
ERþLFDSODVWLþQDSR
ml (300 mg/15 ml)
Pfizer (Perth) PTY. Ltd.
Australija
25.853,10
-
-
-
0039292
L01XX19
irinotekan
IRINOTEKAN
SANDOZ ¸
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (100 mg/5 ml)
Sandoz S.A.
Argentina
6.550,20
-
-
-
0039295
L01XX19
irinotekan
IRINOTESIN ¸
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (40 mg/2 ml)
S.C. Sindan-Pharma
S.R.L.
Rumunija
3.179,90
-
-
-
/LVWD%*UXSD//HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
ATC
INN
=DãWLüHQRLPHOHND
FO
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
Rumunija; Italija
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
6.550,20
-
-
-
0039294
L01XX19
irinotekan
IRINOTESIN ¸
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (100 mg/5 ml)
S.C. Sindan-Pharma
S.R.L.; Actavis Italia
S.P.A
0039355
L01XX19
irinotekan
IRINOTESIN ¸
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (100 mg/5 ml)
S.C. Sindan-Pharma
S.R.L.
Rumunija
36.390,00
-
-
-
0039551
L01XX19
irinotekan
IRINOTECAN ¸
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (40 mg/2 ml)
Cipla LTD.
Indija
3.179,90
-
-
-
0039550
L01XX19
irinotekan
IRINOTECAN ¸
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (100 mg/5 ml)
Cipla LTD.
Indija
6.550,20
-
-
-
INDIKACIJE
Kolorektalni karcinom, hemioterapija lokalno odmaklog/neresektabilnog ili metastatskog stadijuma bolesti, PS 0 ili 1.
NAPOMENA
L02
L02A
L02AE
L02AE02
67$&/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- Klinika za gastroenterologiju KC Srbije,
- KBC Bežanijska Kosa,
- Institut za onkologiju Vojvodine,
- Klinika za onkologiju KC Niš,
- KC Kragujevac;
Nastavak terapije u zdravstvenim ustanovama koje obavljaju zdravstvenu delatnost na sekundarnom ili tercijarnom nivou u mestu prebivališta osiguranog lica.
ENDOKRINOLOŠKA TERAPIJA
Hormoni I srodni lekovi
$QDOR]LKRUPRQDNRMLRVOREDÿDMXJRQDGRWURSLQ
leuprorelin
0037021
L02AE02
leuprorelin
LUPRON
SUDãDNLUDVWYDUDþ]D
suspenziju za
injekciju u
napunjenom
napunjen injekcioni špric,
injekcionom špricu 1 po 1 ml (3,75 mg/ml) Abbott Laboratories S.A.
Španija
9.444,40
0,134 mg
337,48
-
/LVWD%*UXSD//HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0037020
ATC
L02AE02
INDIKACIJE
NAPOMENA
L02AE03
0037070
0037071
L02AE03
L02AE03
INDIKACIJE
NAPOMENA
L02AE04
0037091
L02AE04
INN
leuprorelin
=DãWLüHQRLPHOHND
LUPRON
FO
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
SUDãDNLUDVWYDUDþ]D
suspenziju za
injekciju u
napunjenom
napunjen injekcioni špric,
injekcionom špricu 1 po 1 ml (11,25 mg/ml) Abbott Laboratories S.A.
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
Španija
28.333,10
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
0,134 mg
337,48
-
1. Endometrioza (N80);
2. Medikamentna kastracija za karcinom dojke (C50) u trajanju terapije do 36 meseci;
3. Karcinom prostate, lokalno uznapredovali, u kombinaciji sa radioterapijom, u trajanju od 12 meseci, kod pacijenata sa PS 0 ili 1 (C61);
4. Karcinom prostate, metastatski PS 0-2 (C61).
67$&/HNVHXYRGLXWHUDSLMXSRGWDþNRPQDRVQRYXPLãOMHQMDWULOHNDUD]GUDYVWYHQHXVWDQRYHNRMDREDYOMD]GUDYVWYHQXGHODWQRVWQDVHNXQGDUQRPLOL
WHUFLMDUQRPQLYRXSRGWDþNRPQDRVQRYXPLãOMHQMDNRQ]LOLMXPD]DHQGRNULQR]DYLVQHWXPRUHNRJDþLQHHQGRNULQRORJRQNRORJLJLQHNRORJDSRGWDþNRPL
na osnovu mišljenja tri lekara - urologa zdravstvene ustanove koja obavlja zdravstvenu delatnost na tercijarnom nivou.
goserelin
goserelin
goserelin
ZOLADEX
ZOLADEX LA
implant
implant
napunjen injekcioni
špric,1 po 3,6 mg
AstraZeneca UK Limited
Velika Britanija
10.388,10
0.129 mg
372,24
-
napunjen injekcioni špric,
1 po 10,8 mg
AstraZeneca UK Limited
Velika Britanija
30.629,10
0.129 mg
365,85
-
1. Endometrioza (N80);
2. Medikamentna kastracija za karcinom dojke (C50), u trajanju terapije do 36 meseci;
3. Karcinom prostate, lokalno uznapredovali, u kombinaciji sa radioterapijom, u trajanju od 12 meseci, kod pacijenata sa PS 0 ili 1 (C61);
4. Karcinom prostate, metastatski PS 0-2, (C61);
5. Karcinom prostate, lokalizovana bolest (PS 0 ili 1), sa visokim rizikom (PSA>20, Gleason score•8), uz radioterapiju, u trajanju od 12 meseci.
67$&/HNVHXYRGLXWHUDSLMXSRGWDþNRPQDRVQRYXPLãOMHQMDWULOHNDUD]GUDYVWYHQHXVWDQRYHNRMDREDYOMD]GUDYVWYHQXGHODWQRVWQDVHNXQGDUQRPLOL
WHUFLMDUQRPQLYRXSRGWDþNRPQDRVQRYXPLãOMHQMDNRQ]LOLMXPD]DHQGRNULQR]DYLVQHWXPRUHNRJDþLQHHQGRNULQRORJRQNRORJLJLQHNRORJDSRGWDþNRPL
5. na osnovu mišljenja tri lekara - urologa zdravstvene ustanove koja obavlja zdravstvenu delatnost na tercijarnom nivou.
triptorelin
triptorelin
DIPHERELINE
liofilizat za rastvor
za injekciju
1 po 3,75 mg i 1 ampula
SRPOUDVWYDUDþD
Ipsen Pharma Biotech;
PharmaSwiss d.o.o.
Francuska;
Republika Srbija
9.527,80
0,134 mg
340,46
-
/LVWD%*UXSD//HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0037092
0037093
ATC
L02AE04
L02AE04
INDIKACIJE
NAPOMENA
L03
L03A
L03AA
L03AA02
0069135
0069134
L03AA02
L03AA02
NAPOMENA
L03AB
L03AB04
=DãWLüHQRLPHOHND
INN
triptorelin
triptorelin
DIPHERELINE
DIPHERELINE
FO
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
liofilizat za rastvor
za injekciju
1 po 11,25 mg i 1
ampula po 2 ml
UDVWYDUDþD
Ipsen Pharma Biotech;
PharmaSwiss d.o.o.
Francuska;
Republika Srbija
Ipsen Pharma Biotech
Francuska
SUDãDNLUDVWYDUDþ]D
suspenziju za
injekciju sa
ERþLFDVDSUDãNRPL
produženim
DPSXODVDUDVWYDUDþHP
RVOREDÿDQMHP
1 po 2 ml (22,5 mg/2 ml)
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
28.583,10
0,134 mg
340,46
-
57.166,20
0,134 mg
340,46
-
1. Endometrioza (N80);
2. Karcinom prostate, lokalno uznapredovali, u kombinaciji sa radioterapijom, u trajanju od 12 meseci , kod pacijenata sa PS 0 ili 1 (C61);
3. Karcinom prostate, metastatski PS 0 ili 2, (C61),
4. Pravi (centralni) prerani pubertet (E22.8).
67$&/HNVHXYRGLXWHUDSLMXSRGWDþNRPQDRVQRYXPLãOMHQMDWULOHNDUD]GUDYVWYHQHXVWDQRYHNRMDREDYOMD]GUDYVWYHQXGHODWQRVWQDVHNXQGDUQRPLOL
WHUFLMDUQRPQLYRXSRGWDþNRPLQDRVQRYXPLãOMHQMDWULOHNDUDXURORJD]GUDYVWYHQHXVWDQRYHNRMDREDYOMD]GUDYVWYHQXGHODWQRVWQDWHUFLMDUQRPQLYRXDSRG
WDþNRPQDRVQRYXPLãOMHQMD]GUDYVWYHQHXVWDQRYHNRMDREDYOMD]GUDYVWYHQXGHODWQRVWQDVHNXQGDUQRPLOLWHUFLMDUQRPQLYRX
IMUNOSTIMULANSI
Citokini I imunomodulatori
Faktori stimulisanja kolonije (citokini)
filgrastim
filgrastim
filgrastim
NEUPOGEN
rastvor za
infuziju/injekciju,
špric
napunjen injekcioni
špric, 1 po 0,5
ml/30000000 i.j.
F. Hoffmann-La Roche
Ltd.
Švajcarska
7.522,00
0,35 mg
8.775,67
-
NEUPOGEN
rastvor za
infuziju/injekciju,
špric
napunjen injekcioni
špric,1 po 0,5
ml/48000000 i.j.
F. Hoffmann-La Roche
Ltd.
Švajcarska
11.378,20
0,35 mg
8.296,60
-
F. Hoffmann-La Roche
Ltd.
Švajcarska
1.365,20
2 Mi.j.
910,13
-
F. Hoffmann-La Roche
Ltd.
Švajcarska
1.979,30
2 Mi.j.
879,69
-
STAC
Interferoni
interferon alfa 2a
napunjen injekcioni
špric,1 po 3000000
i.j./0,5 ml
0328336
L03AB04
interferon alfa 2a
ROFERON A
rastvor za injekciju,
špric
0328337
L03AB04
interferon alfa 2a
ROFERON A
rastvor za injekciju, napunjen injekcioni špric,
špric
1 po 4500000 i.j./0,5 ml
/LVWD%*UXSD//HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
ATC
INN
=DãWLüHQRLPHOHND
FO
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
F. Hoffmann-La Roche
Ltd.
Švajcarska
F. Hoffmann-La Roche
Ltd.
Švajcarska
0328339
L03AB04
interferon alfa 2a
ROFERON A
rastvor za injekciju,
špric
napunjen injekcioni
špric, 1 po 9000000
i.j./0.5 ml
0328645
L03AB04
interferon alfa 2a
ROFERON A
rastvor za injekciju
uložak, 1 po 0,6ml (18
Mij/0,6 ml)
INDIKACIJE
L03AB05
0328183
L03AB05
Cena leka
na veliko
za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
4.019,20
2 Mi.j.
893,16
-
10.036,70
2 Mi.j.
1.115,19
-
+URQLþQLKHSDWLWLV%
D2EHIRUPHKURQLþQRJKHSDWLWLVD%+%H$JSR]LWLYDQL+%H$JQHJDWLYDQKURQLþQLKHSDWLWLV%+%9'1.3&5
b) Prisutna replikacija virusa > 6 meseci
c) Biohemijski povišena aktivnost transaminaza (ALT>2x iznad normalne vrednosti)
G+LVWRORãNLDNWLYQDQHNURLQIODPDFLMDLLOLILEUR]DEROHVWMHWUHKURQLþQLKHSDWLWLVLNRPSHQ]RYDQDFLUR]DMHWUH
H,VNOMXþLWLEROHVQLNHVDNRQWUDLQGLNDFLMDPD]DSULPHQXLQWHUIHURQD
I'R]H+%H$JSR]LWLYDQKURQLþQLKHSDWLWLV%PLOLRQDLM[QHGHOMQRPHVHFL
+%H$JQHJDWLYDQKURQLþQLKHSDWLWLV%PLOLRQDLM[QHGHOMQRPHVHFL
za decu: 5-6 miliona i.j./m² 3x nedeljno, 4-6 meseci.
-Lek se daje na osnovu mišljenja infektologa i hepatologa/gastroenterologa.
+URQLþQLKHSDWLWLV&
a) Antitela na virus hepatitisa C pozitivna u serumu >6 meseci.
b) Prisutna replikacija HCV (HCV RNK-PCR+)
c) Biohemijski povišena aktivnost transaminaza (ALT>2x iznad normalne vrednosti)
G+LVWRORãNLGRND]DQDDNWLYQDQHNURLQIODPDFLMDLLOLILEUR]DEROHVWMHWUHKURQLþQLKHSDWLWLVLNRPSHQ]RYDQDFLUR]DMHWUH
e)Doza: rekombinirani interferon alfa se primenjuje u dozi od 3 miliona i.j. 3x nedeljno, 52 nedelje.
za decu: 5 miliona i.j./m² 3x nedeljno, 52 nedelje.
+URQLþQDPLMHORLGQDOHXNHPLMD
4. Triholeukemija.
5. Održavanje remisije multiplog mijeloma.
6. Neuroendokrini tumori na osnovu mišljenja konzilijuma za neuroendokrinie tumore Klinike za endokrinologiju, dijabetes i bolesti metabolizma
.OLQLþNRJFHQWUD
interferon alfa 2b
interferon alfa 2b –
rekombinantni
INTRON A
rastvor za injekciju,
pen sa uloskom
1 po 18 Mi.j./1,2 ml
Schering Plough Central
East AG
Irska
10.361,20
2 Mi.j.
1.151,24
-
/LVWD%*UXSD//HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
ATC
0328657
L03AB05
INDIKACIJE
L03AX
L03AX03
0039421
L03AX03
NAPOMENA
INN
=DãWLüHQRLPHOHND
interferon alfa 2b –
rekombinantni
REALDIRON
FO
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
prašak za rastvor za
injekciju
ERþLFDSR0LM
Sicor Biotech UAB
Litvanija
Cena leka
na veliko
za
pakovanje
4.419,50
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
2 Mi.j.
589,27
-
+URQLþQLKHSDWLWLV%
D2EHIRUPHKURQLþQRJKHSDWLWLVD%+%H$JSR]LWLYDQL+%H$JQHJDWLYDQKURQLþQLKHSDWLWLV%+%9'1.3&5
b) Prisutna replikacija virusa > 6 meseci
c) Biohemijski povišena aktivnost transaminaza (ALT>2x iznad normalne vrednosti)
G+LVWRORãNLDNWLYQDQHNURLQIODPDFLMDLLOLILEUR]DEROHVWMHWUHKURQLþQLKHSDWLWLVLNRPSHQ]RYDQDFLUR]DMHWUH
H,VNOMXþLWLEROHVQLNHVDNRQWUDLQGLNDFLMDPD]DSULPHQXLQWHUIHURQD
I'R]H+%H$JSR]LWLYDQKURQLþQLKHSDWLWLV%PLOLRQDLM[QHGHOMQRPHVHFL
+%H$JQHJDWLYDQKURQLþQLKHSDWLWLV%PLOLRQDLM[QHGHOMQRPHVHFL
za decu: 5-6 miliona i.j./m² 3x nedeljno, 4-6 meseci.
-Lek se daje na osnovu mišljenja infektologa i hepatologa/gastroenterologa.
+URQLþQLKHSDWLWLV&
a) Antitela na virus hepatitisa C pozitivna u serumu >6 meseci.
b) Prisutna replikacija HCV (HCV RNK-PCR+)
c) Biohemijski povišena aktivnost transaminaza (ALT>2x iznad normalne vrednosti)
G+LVWRORãNLGRND]DQDDNWLYQDQHNURLQIODPDFLMDLLOLILEUR]DEROHVWMHWUHKURQLþQLKHSDWLWLVLNRPSHQ]RYDQDFLUR]DMHWUH
e)Doza: rekombinirani interferon alfa se primenjuje u dozi od 3 miliona i.j. 3x nedeljno, 52 nedelje.
za decu: 5 miliona i.j./m² 3x nedeljno, 52 nedelje.
+URQLþQDPLMHORLGQDOHXNHPLMD
4. Triholeukemija.
5. Održavanje remisije multiplog mijeloma.
6. Neuroendokrini tumori na osnovu mišljenja konzilijuma za neuroendokrinie tumore Klinike za endokrinologiju, dijabetes i bolesti metabolizma
.OLQLþNRJFHQWUD
Ostali citokini i imunomodulatori
živi atenuirani bacili M.bovis, soj BCG
živi atenuirani
bacili M.bovis, soj
BCG
STAC
IMMUCYST
prašak za
intravezikalnu
suspenziju
ERþLFDSRPJ
Sanofi Pasteur Limited;
Sanofi-Aventis ZRT.
Kanada;
0DÿDUVND
8.789,60
1,8 mg
195,32
-
/LVWD%*UXSD//HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0010221
0010220
0014111
=DãWLüHQRLPHOHND
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
LPXQRJOREXOLQNXQLüD
L04AA04
anti-humani T
limfocitni
imunoglobulin
NXQLüD
ATG FRESENIUS S
koncentrat za
rastvor za infuziju
10 po 5 ml (20 mg/ml)
Fresenius Biotech GmbH
1HPDþND
278.807,20
-
-
-
L04AA04
anti-humani T
limfocitni
imunoglobulin
NXQLüD
ATG FRESENIUS S
koncentrat za
rastvor za infuziju
1 po 5 ml (20 mg/ml)
Fresenius Biotech GmbH
1HPDþND
27.880,60
-
-
-
Švajcarska
9.996,50
0,25 g
999,65
-
L04AD01
NAPOMENA
FO
Cena leka
na veliko
za
pakovanje
ATC
L04
L04A
L04AA
L04AA04
NAPOMENA
L04AD
L04AD01
INN
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
IMUNOSUPRESIVNA SREDSTVA
Imunosupresivi
Selektivni imunosupresivi
Država
proizvodnje
leka
STAC
Inhibitori kalcineurina
ciklosporin
ciklosporin
SANDIMMUN
koncentrat za
rastvor za infuziju
STAC; Samo za pacijente nakon transplantacije.
ampula,10 po 250 mg/5
ml (50 mg/ml)
Novartis Pharma Stein
AG
/LVWD%*UXSD0/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
ATC
INN
=DãWLüHQRLPH
leka
M
M01
M01A
M01AB
M01AB05 diklofenak
Cena leka
Država
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
proizvodnje
za
FO
leka
leka
leka
pakovanje
0,â,û12.2671,6,67(0/(.29,=$%2/(67,0,â,û12.26712*6,67(0$
ANTIINFLAMATORNI I ANTIREUMATSKI LEKOVI
Nesteroidni antiinflamatorni i antireumatski lekovi
'HULYDWLVLUüHWQHNLVHOLQHLVURGQHVXSVWDQFH
0162440
M01AB05
diklofenak
DIKLOFEN
rastvor za injekciju
0162192
M01AB05
diklofenak
DIKLOFENAK
1162485
M01AB05
diklofenak
RAPTEN-K
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
Galenika a.d.
Republika Srbija
112,60
0,1 g
30,03
-
rastvor za injekciju
5 po 3 ml (75 mg/3 ml)
ampula, 5 po 3 ml (75
mg/3 ml)
Hemofarm a.d.
Republika Srbija
112,60
0,1 g
30,03
-
obložena tableta
blister, 10 po 50 mg
Hemofarm a.d.
Republika Srbija
57,70
0,1 g
11,54
-
blister, 30 po 75 mg
Hemofarm a.d.
Republika Srbija
263,80
0,1 g
11,72
-
1162487
M01AB05
diklofenak
RAPTEN DUO
tableta sa
modifikovanim
RVOREDÿDQMHP
1162190
M01AB05
diklofenak
DIKLOFENAK
film tableta
blister, 20 po 50 mg
Hemofarm a.d.
Republika Srbija
76,80
0,1 g
7,68
-
tableta sa
modifikovanim
oslobadjanjem
blister, 20 po 100 mg
Hemofarm a.d.
Republika Srbija
166,30
0,1 g
8,32
-
1162193
M01AB05
diklofenak
DIKLOFENAK
1162441
M01AB05
diklofenak
DIKLOFEN
film tableta
blister, 20 po 50 mg
Galenika a.d.
Republika Srbija
76,80
0,1 g
7,68
-
blister, 20 po 100 mg
Galenika a.d.
Republika Srbija
166,30
0,1 g
8,32
-
1162442
M01AB05
diklofenak
DIKLOFEN
tableta sa
produženim
oslobadjanjem
5162445
M01AB05
diklofenak
DIKLOFEN
supozitorija
10 po 50 mg
Galenika a.d.
Republika Srbija
134,50
0,1 g
26,90
-
kapsula sa
modifikovanim
RVOREDÿDQMHPWYUGD
blister, 30 po 75 mg
Galenika a.d.
Republika Srbija
263,80
0,1 g
11,72
-
1162403
M01AB05
diklofenak
DIKLOFEN DUO
5162648
M01AB05
diklofenak
DIKLOFENAK
supozitorija
10 po 50 mg
Jugoremedija a.d.
Republika Srbija
99,00
0,1 g
19,80
-
diklofenak
DICLOFENACRETARD
tableta sa
produženim
RVOREDÿDQMHP
blister, 20 po 100 mg
Alvogen d.o.o.
Republika Srbija
166,30
0,1 g
8,32
-
1162402
M01AB05
/LVWD%*UXSD0/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
1162520
0162522
ATC
INN
M01AB15 ketorolak
M01AB15
M01AB15
ketorolak
ketorolak
=DãWLüHQRLPH
leka
ZODOL
ZODOL
FO
film tableta
rastvor za injekciju
Cena leka
na veliko
za
pakovanje
DDD
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
10 po 10 mg
Hemofarm a.d. u
saradnji sa F.HoffmannLa Roche, Švajcarska
Republika Srbija
469,60
30 mg
140,88
-
Hemofarm a.d. u
saradnji sa F.Hoffmannampula, 5 po 30 mg/ml La Roche, Švajcarska
Republika Srbija
253,00
30 mg
50,60
-
0DÿDUVND
354,10
0,2 g
35,41
-
Cena leka Participacija
na veliko osiguranog
po DDD
lica
M01AB16 aceklofenak
1162555
M01AB16
aceklofenak
AFLAMIL
film tableta
blister, 20 po 100 mg
M01AC
Gedeon Richter PLC
Oksikami
M01AC06 meloksikam
rastvor za injekciju
ampula, 5 po 1,5 ml
(15 mg/1,5 ml)
Boehringer Ingelheim
Espana S.A.
Španija
222,70
15 mg
44,54
-
MELOKSIKAM
PHARMAS
tableta
blister, 20 po 7,5 mg
PharmaS d.o.o.
Republika Srbija
113,70
15 mg
11,37
-
meloksikam
MELOKSIKAM
PHARMAS
tableta
blister, 20 po 15 mg
PharmaS d.o.o.
Republika Srbija
184,10
15 mg
9,21
-
M01AC06
meloksikam
MELOXAN
tableta
blister, 30 po 15 mg
Pharmanova d.o.o.
Republika Srbija
276,10
15 mg
9,20
-
1161302
M01AC06
meloksikam
MELOXAN
tableta
blister, 20 po 15 mg
Pharmanova d.o.o.
Republika Srbija
184,10
15 mg
9,21
-
1161051
M01AC06
meloksikam
MELOGAL
tableta
blister, 10 po 15 mg
Galenika a.d.
Republika Srbija
92,00
15 mg
9,20
-
Holandija
144,80
1,2 g
14,48
-
0161022
M01AC06
meloksikam
MOVALIS
1161300
M01AC06
meloksikam
1161301
M01AC06
1161108
M01AE
M01AE01 ibuprofen
1162031
M01AE01
ibuprofen
Derivati propionske kiseline
BRUFEN
film tableta
blister, 30 po 400 mg
Abbott Logistics B.V.
/LVWD%*UXSD0/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
ATC
INN
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
1162032
M01AE01
ibuprofen
BRUFEN
film tableta
blister, 30 po 600 mg
Abbott Logistics B.V.
Holandija
209,20
1,2 g
13,95
-
1162531
M01AE01
ibuprofen
IBUPROFEN
film tableta
blister, 30 po 400 mg
Jugoremedija a.d.
Republika Srbija
144,80
1,2 g
14,48
-
1162532
1162512
1162513
M01AE01
M01AE01
M01AE01
ibuprofen
ibuprofen
ibuprofen
IBUPROFEN
RAPIDOL
RAPIDOL
film tableta
film tableta
film tableta
blister, 30 po 600 mg
blister, 30 po 400 mg
blister, 30 po 600 mg
Jugoremedija a.d.
PharmaSwiss d.o.o.
PharmaSwiss d.o.o.
Republika Srbija
Republika Srbija
Republika Srbija
209,20
144,80
209,20
1,2 g
1,2 g
1,2 g
13,95
14,48
13,95
-
1162471
M01AE02
naproksen
NAPROXEN
tableta
blister, 20 po 375 mg
Srbolek a.d.
Republika Srbija
180,30
0,5 g
12,02
-
1162470
M01AE02
naproksen
NAPROXEN
1162423
M01AE02
naproksen
NAPROKSEN
M01AE02 naproksen
tableta
blister, 50 po 375 mg
Srbolek a.d.
Republika Srbija
450,90
0,5 g
12,02
-
film tableta
blister, 20 po 375 mg
Hemofarm a.d.
Republika Srbija
180,30
0,5 g
12,02
-
rastvor za injekciju
10 ampula po 100
mg/2 ml
Lek farmacevtska družba
d.d.
Slovenija
345,80
0,15 g
51,87
-
ERþLFDVWDNOHQDSR Lek farmacevtska družba
100 mg
d.d.
Slovenija
158,30
0,15 g
11,87
-
M01AE03 ketoprofen
0162088
M01AE03
ketoprofen
KETONAL
1162089
M01AE03
ketoprofen
KETONAL FORTE
film tableta
M01AE09 flurbiprofen
1162050
M01AE09
flurbiprofen
FLUGALIN
obložena tableta
30 po 50 mg
Abbott Logistics B.V.
Holandija
116,90
200 mg
15,59
-
1162051
M01AE09
flurbiprofen
FLUGALIN
obložena tableta
30 po 100 mg
Abbott Logistics B.V.
Holandija
212,80
200 mg
14,19
-
tableta
blister, 20 po 300 mg
Jugoremedija a.d.
Republika Srbija
222,60
600 mg
22,26
-
M01AE11 tiaprofenska kiselina
1162220
M01AE11
tiaprofenska
kiselina
TURGANIL
/LVWD%*UXSD0/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0082320
=DãWLüHQRLPH
leka
ATC
INN
M03
M03A
M03AB
M03AB01 suksametonijum (sukcinilholin)
M03AB01
suksametonijum
MIDARINE
FO
rastvor za
injekciju/infuziju
NAPOMENA
STAC
M03AC
M03AC03 vekuronijum
0082280
M03AC03
vekuronijum
bromid
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Italija
4.417,60
-
-
-
N.V. Organon
Holandija
10.540,80
-
-
-
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
MIORELAKSANSI
Miorelaksansi sa perifernim delovanjem
Derivati holina
100 po 2 ml (100 mg/2
ml)
GlaxoSmithKline
Manufacturing S.P.A.
Cena leka Participacija
na veliko osiguranog
po DDD
lica
Ostala kvaternerna amonijum jedinjenja
NORCURON
ampula sa
SUDãDNLUDVWYDUDþ]D UDVWYDUDþHPXDPSXOL
rastvor za injekciju 50 po 1 ml (4 mg/1 ml)
NAPOMENA
STAC
M03AC04 atrakurijum
0082290
M03AC04
atrakurijum besilat TRACRIUM
rastvor za injekciju
5 po 25 mg/2,5 ml
GlaxoSmithKline SPA
Italija
897,30
-
-
-
0082291
M03AC04
atrakurijum besilat TRACRIUM
rastvor za injekciju
5 po 50 mg/5 ml
GlaxoSmithKline SPA
Italija
1.794,80
-
-
-
NAPOMENA
STAC
M03AC09 rokuronijum bromid
0082050
M03AC09
rokuronijum
bromid
ESMERON
rastvor za injekciju
10 po 5 ml (50 mg/5
ml)
N.V. Organon
Holandija
4.848,60
-
-
-
0082051
M03AC09
rokuronijum
bromid
ESMERON
rastvor za injekciju
10 po 10 ml (100
mg/10 ml)
N.V. Organon
Holandija
9.834,10
-
-
-
ampula, 5 po 2,5 ml (2
mg/ml)
GlaxoSmithKline
Manufacturing S.P.A.;
Aspen Bad Oldesloe
GmbH
,WDOLMD1HPDþND
1.360,40
-
-
-
NAPOMENA
STAC
M03AC11 cisatrakurijum
0082410
M03AC11
cisatrakurijum
NIMBEX
rastvor za
injekciju/infuziju
/LVWD%*UXSD0/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0082411
ATC
M03AC11
INN
cisatrakurijum
=DãWLüHQRLPH
leka
NIMBEX
FO
rastvor za
injekciju/infuziju
NAPOMENA
STAC
M03AX
M03AX01 toksin clostridium botulinum tip A ( klostridijum )
0082111
M03AX01
INDIKACIJE
toksin clostridium
botulinum tip A
DYSPORT
liofilizat za rastvor za
injekciju
M05BA06
INDIKACIJE
NAPOMENA
1D]LYSURL]YRÿDþD
leka
ampula, 5 po 5 ml (2
mg/ml)
GlaxoSmithKline
Manufacturing S.P.A.;
Aspen Bad Oldesloe
GmbH
,WDOLMD1HPDþND
Cena leka
na veliko
za
pakovanje
DDD
2.720,50
-
-
-
54.205,30
-
-
-
Cena leka Participacija
na veliko osiguranog
po DDD
lica
Ostali miorelaksansi sa perifernim delovanjem
2 po 500 i.j.
Ipsen Biopharm Limited
Velika Britanija
1. Cerebralna paraliza sa spasticitetom i/ili distonijom i urednim mentalnim stanjem (G80.0, G80.1, G80.2, G80.3, G80.8);
2. Spazmodiþna disfonija, blefarospazam, hemifacijalni spazam, tortikolis (cervikalna distonija), (G24.1, G24.2, G24.3, G24.4, G24.5, G24.8, G24.9, G24.0, G51.3);
3. Postapopleksiþna distonija šake, ruke i stopala. (G81.8, G83.1, G83.2).
NAPOMENA
STAC
M05
M05B
M05BA
M05BA06 ibandronska kiselina
0059089
3DNRYDQMHLMDþLQD
leka
Država
proizvodnje
leka
ibandronska
kiselina
BONVIVA
LEKOVI U TERAPIJI OBOLJENJA KOSTIJU
Delovi koji deluju na strukturu kosti i mineralizaciju
Bifosfonati
rastvor za injekciju
napunjen injekcioni
špric, 1 po 3 ml (3
mg/3 ml)
Roche Diagnostics
GmbH
1HPDþND
8.438,30
6 mg
16.876,60
-
1. Za leþenje teških oblika osteoporoze (DEXA T vrednosti ” -3,5 SD) kod žena kod kojih nije moguüa primena oralnih bisfosfonata zbog nemoguünosti efikasne apsorpcije.
Nemoguünost primene oralnih bisfosfonata potvrÿuje se mišljenjem gastroenterologa:
- o postojanju hroniþnog gastritisa ili erozivnog gastritisa ili ulkusne bolesti ili pogoršanja postojeüe bolesti jednjaka ili želuca ili creva verifikovano gastroskopskim nalazom ili
- o postojanju sindroma intestinalne malapsorpcije razliþitog uzroka, a na osnovu gastroenterološke dokumentacije.
67$&=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMD]GUDYVWYHQHXVWDQRYHNRMDREDYOMD]GUDYVWYHQXGHODWQRVWQDVHNXQGDUQRPLOL
tercijarnom nivou.
/LVWD%*UXSD0/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0059213
=DãWLüHQRLPH
ATC
INN
leka
M05BA08 zolendronska kiselina
M05BA08
zolendronska
kiselina
ACLASTA
FO
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
rastvor za infuziju
ERþLFDSRPO
(0,05 mg/ml)
Novartis Pharma Stein
AG
Švajcarska
Cena leka
na veliko
za
pakovanje
DDD
32.872,10
4 mg
Cena leka Participacija
na veliko osiguranog
po DDD
lica
26.297,68
-
INDIKACIJE
1. Za leþenje teških oblika osteoporoze (DEXA T vrednosti ” -3,5 SD) sa poveüanim rizikom od fraktura kao i kod bolesnika sa nedavnom frakturom kuka usled lake povrede, a kod
kojih nije moguüa primena oralnih bisfosfonata. Nemoguünost primene oralnih bisfosfonata potvrÿuje se mišljenjem gastroenterologa:
- o postojanju hroniþnog gastritisa ili erozivnog gastritisa ili ulkusne bolesti ili pogoršanja postojeüe bolesti jednjaka ili želuca ili creva verifikovano gastroskopskim nalazom ili
- o postojanju sindroma intestinalne malapsorpcije razliþitog uzroka, a na osnovu gastroenterološke dokumentacije.
2. Za leþenje teških oblika osteoporoze (DEXA T vrednosti ” -3,5 SD) povezane sa dugotrajnom terapijom sistemskim glukokortikoidima kod žena u postmenopauzi i muškaraca
sa poveüanim rizikom od fraktura.
3. Terapija Paget-ove bolesti.
NAPOMENA
67$&=DLQGLNDFLMXSRGWDþNRPLOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMD]GUDYVWYHQHXVWDQRYHNRMDREDYOMD]GUDYVWYHQXGHODWQRVWQD
sekundarnom ili tercijarnom nivou.
/LVWD%*UXSD1/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
ATC
INN
=DãWLüHQRLPH
leka
N
N01
N01A
N01AB
N01AB01 halotan
9080091
N01AB01
halotan
FO
Cena leka
Država
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
za
leka
leka
leka
pakovanje
NERVNI SISTEM - LEKOVI KOJI DELUJU NA NERVNI SISTEM
ANESTETICI
Anestetici, opšti
Halogenovani ugljovodonici
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
HALOTAN
para za inhalaciju,
WHþQRVW
ERþLFDVWDNOHQDSR
50 ml (99,99%)
Jugoremedija a.d.
Republika Srbija
4.977,80
-
-
-
FORANE
para za inhalaciju,
WHþQRVW
ERþLFDSRPO
(100%)
Aesica Queenborough
Ltd.
Velika Britanija
2.864,20
-
-
-
SEVORANE
para za inhalaciju,
WHþQRVW
ERFDSODVWLþQDSR
250 ml ( 100%)
Aesica Queenborough
Ltd.
Velika Britanija
17.106,90
-
-
-
Belgija
1.513,30
-
-
-
N01AB06 izofluran
0086161
N01AB06
izofluran
NAPOMENA
STAC
N01AB08 sevofluran
9080161
N01AB08
sevofluran
NAPOMENA
STAC
N01AH
N01AH01 fentanil
Opoidni anestetici
50 po 2 ml (0,05 mg/1 Janssen Pharmaceutica
ml)
N.V.
0087552
N01AH01
fentanil
FENTANYL
rastvor za injekciju
0087555
N01AH01
fentanil
FENTANYL
rastvor za injekciju
50 po 10 ml (0,05
mg/1 ml)
Janssen Pharmaceutica
N.V.
Belgija
7.108,50
-
-
-
0087557
N01AH01
fentanil
FENTANYL
TORREX
rastvor za injekciju
5 po 10 ml (50 mcg/ml)
Chiesi Pharmaceuticals
GmbH
Austrija
565,60
-
-
-
RAPIFEN
rastvor za injekciju
ampula, 50 po 10 ml Janssen Pharmaceutica
(0,5 mg/1 ml)
N.V.
Belgija
14.734,70
-
-
-
SUFENTA forte
rastvor za injekciju
Belgija
2.418,50
-
-
-
STAC
NAPOMENA
N01AH02 alfentanil
0087575
N01AH02
alfentanil
NAPOMENA
STAC
N01AH03 sufentanil
0087171
N01AH03
NAPOMENA
sufentanil
STAC
ampula, 5 po 5 ml
(0,25 mg/5 ml)
Janssen Pharmaceutica
N.V.
/LVWD%*UXSD1/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
ATC
INN
N01AH06 remifentanil
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
0087620
N01AH06
remifentanil
ULTIVA
prašak za koncentrat ERþLFDVWDNOHQDSR Glaxo Operations UK
za rastvor za infuziju
mg/3 ml
Limited
Velika Britanija
3.124,70
-
-
-
0087621
N01AH06
remifentanil
ULTIVA
prašak za koncentrat ERþLFDVWDNOHQDSR Glaxo Operations UK
za rastvor za infuziju
mg/5 ml
Limited
Velika Britanija
4.927,80
-
-
-
NAPOMENA
N01AX
N01AX07
0080300
N01AX07
NAPOMENA
N01AX10
STAC
Ostali opšti anestetici
etomidat
etomidat
HYPNOMIDATE
rastvor za injekciju
ampula, 5 po 10 ml (2 Janssen Pharmaceutica
mg/ml)
N.V.
Belgija
537,90
-
-
-
STAC
propofol
0080420
N01AX10
propofol
PROPOFOL 1%
Fresenius
rastvor za injekciju
5 po 20 ml (10 mg/ml)
Fresenius Kabi
Austrija
1.131,30
-
-
-
0080421
N01AX10
propofol
PROPOFOL 1%
Fresenius
rastvor za injekciju
1 po 50 ml (10 mg/ml)
Fresenius Kabi
Austrija
627,30
-
-
-
0080423
N01AX10
propofol
PROPOFOL 1%
Fresenius
rastvor za injekciju
1 po 100 ml (10 mg/ml)
Fresenius Kabi
Austrija
1.121,40
-
-
-
0080202
N01AX10
propofol
DIPRIVAN
emulzija za
injekciju/infuziju
5 po 20 ml (10 mg/ml)
AstraZeneca UK
Limited
Velika Britanija
1.254,60
-
-
-
0080432
N01AX10
propofol
PROPOFOL
LIPURO 1%
emulzija za
injekciju/infuziju
ampula, 5 po 20 ml
(10mg/1ml)
B. Braun Melsungen AG
1HPDþND
1.131,30
-
-
-
0080431
N01AX10
propofol
PROPOFOL
LIPURO 1%
emulzija za
injekciju/infuziju
ERþLFDSRPO
(10 mg/ml)
B. Braun Melsungen AG
1HPDþND
6.273,20
-
-
-
0080430
N01AX10
propofol
PROPOFOL
LIPURO 1%
emulzija za
injekciju/infuziju
ERþLFDSRPO
(10 mg/ml)
B. Braun Melsungen AG
1HPDþND
11.214,00
-
-
-
NAPOMENA
STAC
/LVWD%*UXSD1/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
ATC
INN
N01B
N01BB
N01BB01 bupivakain
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Anestetici, lokalni
Amidi
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
0081581
N01BB01
bupivakain
MARCAINE 0,5%
rastvor za injekciju
ERþLFDVWDNOHQDSR
20 ml (5 mg/ml)
Recipharm Monts
Francuska
1.213,60
-
-
-
0081582
N01BB01
bupivakain
MARCAINE
SPINAL 0,5%
rastvor za injekciju
ampula, 5 po 4 ml (5
mg/ml)
Cenexi SAS
Francuska
2.387,80
-
-
-
bupivakain
MARCAINE
SPINAL 0,5%
HEAVY
rastvor za injekciju
ampula, 5 po 4 ml (5
mg/ml)
Cenexi SAS
Francuska
2.528,00
-
-
-
0081583
N01BB01
NAPOMENA
STAC
N01BB02 lidokain
0081222
N01BB02
lidokain
LIDOKAIN-HLORID
1%
rastvor za injekciju
ampula, 10 po 3,5 ml
(35 mg)
Galenika a.d.
Republika Srbija
210,60
-
-
-
0081560
N01BB02
lidokain
LIDOKAIN-HLORID
2%
rastvor za injekciju
ampula, 50 po 2 ml (40
mg/2 ml)
Galenika a.d.
Republika Srbija
1.048,00
-
-
-
rastvor za injekciju
ampula, 5 po 10 ml (20
mg/ml)
Jugoremedija a.d.
Republika Srbija
195,20
-
-
-
rastvor za
injekciju/koncentrat ampula, 10 po 10 ml (5
za rastvor za infuziju
mg/ml)
Abbott S.R.L.
Italija
4.103,10
-
-
-
ampula, 50 po 2 ml (40
mg+0,025 mg)
Galenika a.d.
Republika Srbija
865,20
-
-
-
ampula, 5 po 10 ml (20
mg+0,006 mg)/ml
Jugoremedija a.d.
Republika Srbija
195,20
-
-
-
N01BB08 artikain ( kartikain )
0081141
N01BB08
artikain
CYSTOCAIN 2%
N01BB10 levobupivakain
0081011
N01BB10
levobupivakain
CHIROCAINE
STAC
NAPOMENA
N01BB52 lidokain, adrenalin (epinefrin)
0081540
N01BB52
lidokain, adrenalin
(epinefrin)
LIDOKAIN 2%ADRENALIN
rastvor za injekciju
N01BB58 artikain ( kartikain ), adrenalin ( epinefrin )
0081142
N01BB58
artikain (kartikain),
adrenalin (epinefrin) CYSTOCAIN 2% A
rastvor za injekciju
/LVWD%*UXSD1/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0081143
ATC
N01BB58
=DãWLüHQRLPH
leka
INN
artikain (kartikain),
adrenalin (epinefrin) CYSTOCAIN DS
FO
rastvor za injekciju
N02
N02A
N02AA
N02AA01 morfin
0087854
N02AA01
morfin
N02AB02
NAPOMENA
N02AX
N02AX02
petidin hidrohlorid
ampula, 50 po 2 ml (40
mg+0,006 mg)/ml
Jugoremedija a.d.
Cena leka
na veliko
za
pakovanje
DDD
Republika Srbija
917,60
-
-
-
Republika
Makedonija
688,70
30 mg
103,31
-
1HPDþND
551,20
400 mg
440,96
-
Cena leka Participacija
na veliko osiguranog
po DDD
lica
ANALGETICI
Opioidi
Prirodni alkaloidi opijuma
MORFIN
HIDROHLORID
ALKALOID
rastvor za injekciju
N02AB
N02AB02 petidin hidrohlorid
0087018
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Država
proizvodnje
leka
DOLANTIN
ampula,10 po 20
mg/ml
Alkaloid a.d.
Fenil piperidinski derivat
rastvor za injekciju
Sanofi-Aventis
Deutschland GmbH
5 po 2 ml/100 mg
STAC
Ostali opioidi
tramadol
0087531
N02AX02
tramadol
TRODON
rastvor za injekciju
ampula, 5 po 1 ml (50
mg/ml)
Hemofarm a.d.
Republika Srbija
157,40
0,3 g
188,88
-
0087533
N02AX02
tramadol
TRODON
rastvor za injekciju
ampula, 5 po 2 ml (100
mg/2 ml)
Hemofarm a.d.
Republika Srbija
220,00
0,3 g
132,00
-
Republika Srbija
Republika
Makedonija
1.345,40
3g
32,29
-
1.345,40
3g
32,29
-
Republika Srbija
2.296,80
3g
689,04
-
Ostali analgetici i antipiretici
Pirazoloni
N02B
N02BB
N02BB02 metamizol natrijum
0086431
N02BB02
metamizol natrijum NOVALGETOL
rastvor za injekciju
0086418
N02BB02
metamizol natrijum ANALGIN
rastvor za injekciju
0086930
N02BE
N02BE01
paracetamol
N02BE01
paracetamol
ampula, 50 po 2,5 g/5
ml
ampula 50 po 2,5 g/5
ml
Galenika a.d.
Alkaloid a.d.
Anilidi
PARACETAMOL
PHARMASWISS
rastvor za infuziju
boca, 10 po 100 ml (10
mg/ml)
PharmaSwiss d.o.o.
/LVWD%*UXSD1/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0084520
ATC
N03
N03A
N03AA
N03AA02
N03AA02
N03AE
N03AE01
0084405
N03AE01
INN
=DãWLüHQRLPH
leka
FO
N03AG01
fenobarbital
(fenobarbiton)
ERþLFDVDSUDãNRPL
ampula sa
PHENOBARBITON SUDãDNLUDVWYDUDþ]D UDVWYDUDþHPSRPO
NATRIJUM
rastvor za injekciju
(220 mg/2 ml)
N04BB01
INDIKACIJE
DDD
Republika Srbija
256,80
0,1 g
23,35
-
Švajcarska
576,40
8 mg
922,24
-
3.542,40
1,5 g
3.321,00
-
16.255,90
-
-
-
Cena leka Participacija
na veliko osiguranog
po DDD
lica
Hemofarm a.d.
Derivati benzodiazepina
klonazepam
klonazepam
RIVOTRIL
koncentrat za rastvor
za injekciju/infuziju sa
UDVWYDUDþHP]D
ampula sa
parenteralnu
UDVWYDUDþHPXDPSXOL F. Hoffmann-La Roche
upotrebu
5 po 1 ml (1 mg/ml)
Ltd.
Derivati masnih kiselina
valproinska kiselina DEPAKINE
OLRERþLFDVD
Gruppo Lepetit S.p.a.;
SUDãDNLUDVWYDUDþ]D UDVWYDUDþHPSRPO
Glaxo Wellcome
rastvor za injekciju
(400 mg/4 ml)
Production
Italija; Francuska
ANTIPARKINSONICI
'RSDPLQHUJLþNLOHNRYL
Derivati amantadina
N04
N04B
N04BB
N04BB01 amantadin sulfat
0085353
Cena leka
na veliko
za
pakovanje
fenobarbital (fenobarbiton)
N03AG
N03AG01 valproinska kiselina
0084502
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
ANTIEPILEPTICI
Antiepileptici
Barbiturati i derivati
Država
proizvodnje
leka
amantadin sulfat
PK MERZ
rastvor za infuziju
10 po 500 ml (200 mg)
Merz Pharmaceuticals
GmbH
STAC; U terapiji off-faze parkinsonizma koji ne reaguju na peroralni oblik amantadina.
1HPDþND
/LVWD%*UXSD1/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0070261
ATC
INN
N05
N05A
N05AB
N05AB02 flufenazin
N05AB02
flufenazin
=DãWLüHQRLPH
leka
MODITEN Depo
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Slovenija
1.135,70
1 mg
9,09
-
rastvor za injekciju
Krka Tovarna Zdravil
d.d. u saradnji sa
ampula, 5 po 1 ml (50 Janssen Pharmaceutica
mg/ml)
N.V, Belgija
Slovenija
1.420,90
3,3 mg
18,76
-
rastvor za injekciju
Krka Tovarna Zdravil
d.d. u saradnji sa
ampula, 10 po 1 ml (5 Janssen Pharmaceutica
mg/ml)
N.V, Belgija
Slovenija
306,00
8 mg
48,96
-
Francuska
1.397,30
40 mg
2.328,83
FO
rastvor za injekciju
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
PSIHOLEPTICI
Antipsihotici
Fenotiazini sa piperazinskom strukturom
Krka Tovarna Zdravil
ampula, 5 po 1 ml (25 d.d. u saradnji sa Bristolmg /ml)
Myers-Squibb, USA
Cena leka Participacija
na veliko osiguranog
po DDD
lica
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja psihijatra/neuropsihijatra.
N05AD
Derivati butirofenona
N05AD01 haloperidol
0070207
0070200
N05AD01
N05AD01
NAPOMENA
N05AE
N05AE04
0070654
N05AE04
INDIKACIJE
NAPOMENA
haloperidol
haloperidol
HALDOL DEPO
HALDOL
Lek se uvodi u terapiju na osnovu mišljenja psihijatra/neuropsihijatra.
Derivati indola
ziprasidon
ziprasidon
ZELDOX
SUDãDNLUDVWYDUDþ]D
rastvor za injekciju 1 po 1,2 ml (20 mg/ml)
Pfizer PGM
$JLWDFLMDNRGãL]RIUHQLMHLGUXJLKSVLKRWLþQLKSRUHPHüDMD]DSDFLMHQWHVDQH]DGRYROMDYDMXüLPRGJRYRURPQDGYDSUHWKRGQRSULPHQMHQDDQWLSVLKRWLND)
F29);
$JLWDFLMDNRGPDQLþQHLPHãRYLWHHSL]RGHSRYH]DQHVDELSRODUQLPSRUHPHüDMLPDVDLOLEH]SVLKRWLþQLKVLPSWRPD)))
Lek se uvodi u terapiju na osnovu mišljenja psihijatra/neuropsihijatra u zdravstvenoj ustanovi koja obavlja zdravstvenu delatnost na sekundarnom ili
tercijarnom nivou.
/LVWD%*UXSD1/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0070972
0070973
ATC
N05AF
N05AF05
zuklopentiksol dekanoat
N05AF05
zuklopentiksol
dekanoat
N05AF05
NAPOMENA
N05AX
N05AX08
0070925
0070926
0070927
N05AX08
N05AX08
N05AX08
INDIKACIJE
NAPOMENA
INN
=DãWLüHQRLPH
leka
zuklopentiksol
CLOPIXOL
ACUPHASE
CLOPIXOL DEPOT
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Derivati tioksantena
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
rastvor za injekciju
ampula, 5 po 1 ml (50
mg/ml)
H. Lundbeck A/S
Danska
2.872,20
30 mg
344,66
-
rastvor za injekciju
ampula, 10 po 1 ml
(200 mg/ml)
H. Lundbeck A/S
Danska
3.136,00
15 mg
23,52
-
Lek se uvodi u terapiju na osnovu mišljenja psihijatra/neuropsihijatra.
Ostali antipsihotici
risperidon
risperidon
risperidon
risperidon
RISPOLEPT
CONSTA
ERþLFDLUDVWYDUDþX
SUDãDNLUDVWYDUDþ]D
napunjenom
suspenziju za
injekcionom špricu, 1
injekciju
po 25 mg
Cilag Ltd.
Švajcarska
10.918,70
2,7 mg
1.179,22
-
RISPOLEPT
CONSTA
SUDãDNLUDVWYDUDþ]D
suspenziju za
injekciju
ERþLFDLUDVWYDUDþX
napunjenom
injekcionom špricu,1
po 37,5 mg
Cilag Ltd.
Švajcarska
14.153,90
2,7 mg
1.019,08
-
RISPOLEPT
CONSTA
SUDãDNLUDVWYDUDþ]D
suspenziju za
injekciju
ERþLFDLUDVWYDUDþX
napunjenom
injekcionom špricu,1
po 50 mg
Cilag Ltd.
Švajcarska
17.497,80
2,7 mg
944,88
-
Šizofrenija, šizotipski poremeüaji i poremeüaji sa sumanutošüu (F20-F29):
1. Nekomplijantni pacijenti i/ili pacijenti koji imaju neželjene efekte na klasiþnim depoima koji se ne mogu tolerisati.
2. Rezistentni na klasiþne depo antipsihotike (pod rezistencijom se podrazumeva neadekvatan odgovor na dva klasiþna antipsihotika u roku od 6 meseci).
Lek se uvodi u terapiju na osnovu mišljenja psihijatra/neuropsihijatra.
/LVWD%*UXSD1/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0071123
ATC
INN
N05B
N05BA
N05BA01 diazepam
N05BA01
diazepam
=DãWLüHQRLPH
leka
BENSEDIN
FO
rastvor za injekciju
N05C
N05CD
N05CD08 midazolam
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Anksiolitici
Derivati benzodiazepina
10 po 10 mg/2 ml
Galenika a.d.
Država
proizvodnje
leka
Cena leka
na veliko
za
pakovanje
DDD
Republika Srbija
281,50
10 mg
28,15
-
Cena leka Participacija
na veliko osiguranog
po DDD
lica
Hipnotici i sedativi
Derivati benzodiazepina
0071834
N05CD08
midazolam
DORMICUM
rastvor za injekciju
ampula, 10 po 5 mg/5
ml
F. Hoffmann-La Roche
Ltd.
Švajcarska
662,90
15 mg
198,87
-
0071835
N05CD08
midazolam
DORMICUM
rastvor za injekciju
5 po 15 mg/3 ml
F. Hoffmann-La Roche
Ltd.
Švajcarska
794,80
15 mg
158,96
-
0071853
N05CD08
midazolam
MIDAZOLAM
TORREX
rastvor za injekciju
10 po 15 mg/3 ml
Chiesi Pharmaceuticals
GmbH
Austrija
1.589,60
15 mg
158,96
-
354,20
0,1 g
141,68
-
1.479,60
2 mg
23,67
-
NAPOMENA
STAC
N06
N06A
N06AA
N06AA04 klomipramin
0072741
N06AA04
klomipramin
PSIHOANALEPTICI
Antidepresivi
Neselektivni inhibitori preuzimanja monoamina
ANAFRANIL
rastvor za injekciju
N07
N07A
N07AA
N07AA01 neostigmin metilsulfat
0088065
N07AA01
NAPOMENA
neostigmin
metilsulfat
STAC
NEOSTIGMINE
10 po 25 mg/2 ml
Novartis Pharma Stein
AG
Švajcarska
OSTALI LEKOVI KOJI DELUJU NA NERVNI SISTEM
Parasimpatomimetici
Antiholinesteraze
rastvor za injekciju
ampula, 50 po 1 ml
(2,5 mg/ml)
Cooper S.A.
*UþND
/LVWD%*UXSD1/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
ATC
INN
N07B
N07BC
N07BC02 metadon
3087506
N07BC02
metadon
3087507
N07BC02
metadon
=DãWLüHQRLPH
leka
METADON
ALKALOID
METADON
ALKALOID
FO
oralni rastvor
oralni rastvor
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
Lekovi koji se upotrebljavaju u bolestima zavisnosti
Lekovi koji se upotrebljavaju u opioidnoj zavisnosti
ERþLFDSRPO
(10 mg/ml)
ERþLFDSRPO
(10 mg/ml)
Alkaloid a.d.
Alkaloid a.d.
Republika
Makedonija
Republika
Makedonija
Cena leka
na veliko
za
pakovanje
DDD
1.131,20
25 mg
28,28
-
10.976,80
25 mg
27,44
-
Cena leka Participacija
na veliko osiguranog
po DDD
lica
INDIKACIJE
/HþHQMH]DYLVQRVWLRGRSLMDWD)
2. Suzbijanje snažnog bola (bola uzrokovanog karcinomom) (C00-C97).
NAPOMENA
=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLXWHUDSLMXX]GUDYVWYHQLPXVWDQRYDPDNRMHREDYOMDMX]GUDYVWYHQXGHODWQRVWQDSULPDUQRPVHNXQGDUQRPLOL
tercijarnom nivou, na osnovu mišljenja psihijatra/neuropsihijatra, a u skladu sa Smernicama za primenu supstitucione terapije.
=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLNDRVLPSWRPDWVNDWHUDSLMDERODXVOXåELNXüQRJOHþHQMDLOLX]GUDYVWYHQLPXVWDQRYDPDNRMHREDYOMDMX]GUDYVWYHQX
delatnost na sekundarnom ili tercijarnom nivou.
/LVWD%*UXSD5/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0114501
ATC
INN
R
R03
R03D
R03DA
R03DA05 aminofilin
R03DA05
aminofilin
=DãWLüHQRLPH
leka
AMINOPHYLLINUM
Cena leka
Država
na veliko
3DNRYDQMHLMDþLQD
Naziv
proizvodnje
za
FO
leka
SURL]YRÿDþDOHND
leka
pakovanje
DDD
5(63,5$7251,6,67(0/(.29,=$/(ý(1-(%2/(67,5(63,5$72512*6,67(0$
/(.29,.2-,6(35,0(1-8-88236758.7,912-3/8û12-%2/(67,
'UXJLOHNRYL]DVLVWHPVNXSULPHQXXRSVWUXNWLYQLPSOXüQLPEROHVWLPD
Ksantini
rastvor za
injekciju/infuziju
R06AC03
R07
R07A
R07AA
R07AA..
0119150
R07AA..
NAPOMENA
hloropiramin
Jugoremedija a.d.
Republika Srbija
911,80
0,6 g
43,77
-
785,20
20 mg
78,52
-
0,16 g
59.973,80
-
ANTIHISTAMINICI ZA SISTEMSKU PRIMENU
Antihistaminici za sistemsku primenu
Supstituisani etilendiamini
R06
R06A
R06AC
R06AC03 hloropiramin
0058334
ampula, 50 po 250
mg/10 ml
Cena leka Participacija
na veliko osiguranog
po DDD
lica
SYNOPEN
rastvor za injekciju
ampula,10 po 20 mg/2
ml
Pliva Hrvatska d.o.o.
Hrvatska
267$/,/(.29,=$/(ý(1-(%2/(67,5(63,5$72512*6,67(0$
2VWDOLSURL]YRGL]DOHþHQMHEROHVWLUHVSLUDWRUQRJVLVWHPD
3OXüQLVXUIDNWDQWL
poraktant alfa
poraktant alfa
CUROSURF
suspenzija za
endotraheopulmonaln ERþLFDVWDNOHQDSR
o ukapavanje
1,5 ml (120 mg/1,5 ml)
Chiesi Farmaceutici
S.P.A; Chiesi
Pharmaceuticals
GmbH
Italija; Austrija
89.960,70
/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDQHRQDWRORJDLOLSHGLMDWUDX]RYHUXQDþHOQLNDLGLUHNWRUD]GUDYVWYHQHXVWDQRYH
/LVWD%*UXSD6/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
7097030
ATC
S
S01
S01H
S01HA
S01HA03
INN
tetrakain
S01HA03
tetrakain
=DãWLüHQR
ime leka
TETRAKAIN
FO
Cena leka
Država
na veliko
Pakovanje i
Naziv
proizvodnje
za
MDþLQDOHND
SURL]YRÿDþDOHND
leka
pakovanje
SENZORNI ORGANI - LEKOVI KOJI DELUJU NA OKO I UHO
LEKOVI KOJI DELUJU NA OKO
Lokalni anestetici
Lokalni anestetici
NDSL]DRþLUDVWYRU
ERþLFDVWDNOHQD
po 10 ml (0,5%)
Hemomont d.o.o.
Republika Crna
Gora
153,10
DDD
-
Cena leka Participacija
na veliko osiguranog
po DDD
lica
-
-
/LVWD%*UXSD9/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0180030
ATC
V
V03
V03A
V03AB
V03AB14
protamin
V03AB14
protamin
NAPOMENA
V03AB25
INN
=DãWLüHQRLPH
leka
FO
Cena leka
Država
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
za
leka
leka
leka
pakovanje
OSTALO
SVI OSTALI TERAPIJSKI PROIZVODI
Svi ostali terapijski proizvodi
Antidoti
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
PROTAMIN
SULFAT
rastvor za injekciju
5 po 50 mg/5 ml
Galenika a.d.
Republika
Srbija
1.354,20
-
-
-
STAC
flumazenil
0189100
V03AB25
flumazenil
ANEXATE
rastvor za injekciju
5 po 0,5 mg/5 ml
F. Hoffmann-La Roche
Ltd.
Švajcarska
4.315,00
-
-
-
0189101
V03AB25
flumazenil
ANEXATE
rastvor za injekciju
5 po 1 mg/10 ml
F. Hoffmann-La Roche
Ltd.
Švajcarska
9.521,50
-
-
-
NAPOMENA
V03AF
V03AF03
STAC
Lekovi za detoksikaciju u terapiji antineoplasticima
kalcijum folinat
0184034
V03AF03
kalcijum folinat
CALCIUMFOLINAT
"Ebewe"
rastvor za
injekciju/infuziju
ampula, 5 po 3 ml (30
mg/3 ml)
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
1.153,00
60 mg
461,20
-
0184036
V03AF03
kalcijum folinat
CALCIUMFOLINAT
"Ebewe"
rastvor za
injekciju/infuziju
ampula, 5 po 5 ml (50
mg/5 ml)
Ebewe Pharma Ges.
M.B.H NFG. KG
Austrija
3.123,50
60 mg
749,64
-
0184027
V03AF03
kalcijum folinat
LEUCOVORIN
Kalcijum
rastvor za injekciju
ampula, 10 po 50 mg/5
ml
Pfizer (Perth) PTY.
Ltd.
Australija
6.247,00
60 mg
749,64
-
0184100
V03AF03
kalcijum folinat
FOLCASIN
rastvor za
injekciju/infuziju
ERþLFDVWDNOHQDSR S.C. Sindan-Pharma
ml (30 mg/10 ml)
S.R.L.
Rumunija
230,60
60 mg
461,20
-
kalcijum folinat
LEUCOVORINTeva
rastvor za
injekciju/infuziju
ERþLFDVWDNOHQDSR
ml (50 mg/5 ml)
Teva Pharmaceutical
Works Private Ltd.
Company
0DÿDUVND
624,70
60 mg
749,64
-
0184105
V03AF03
NAPOMENA
STAC
/LVWD%*UXSD9/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0012070
ATC
V04
V04C
V04CF
V04CF01
INN
tuberkulin
V04CF01
SUHþLãüHQL
proteinski derivat
tuberkulina za
humanu upotrebu
=DãWLüHQRLPH
leka
PPD-T
TUBERKULIN
voda za injekcije
0176042
V07AB..
voda za injekcije
VODA ZA
INJEKCIJE
0176185
V07AB..
voda za injekcije
0176183
V07AB..
0176184
V07AB..
rastvor za injekciju
Institut za virusologiju,
vakcine i serume
10 po 2,5 ml (3 i.j./0,1ml)
"Torlak"
Republika
Srbija
DDD
Participacija
osiguranog
lica
19.610,80
-
-
-
rastvor za injekciju
50 po 5 ml
Galenika a.d.
Republika
Srbija
1.500,00
-
-
-
AQUA PRO
INJECTIONE
UDVWYDUDþ]D
parenteralnu upotrebu
50 po 5 ml
Jugoremedija a.d.
Republika
Srbija
1.500,00
-
-
-
voda za injekcije
AQUA PRO
INJECTIONE
UDVWYDUDþ]D
parenteralnu upotrebu
ampula, 50 po 10 ml
Jugoremedija a.d.
Republika
Srbija
3.000,00
-
-
-
voda za injekcije
AQUA PRO
INJECTIONE
UDVWYDUDþ]D
parenteralnu upotrebu
50 po 2 ml
Jugoremedija a.d.
Republika
Srbija
600,00
-
-
-
-
-
-
KONTRASTNA SREDSTVA
Kontrastna sredstva sa jodom (X-zraci)
Nefrotropna, visokoosmolarna kontrastna sredstva, rastvorljiva u vodi
V08
V08A
V08AA
V08AA05
joksitalaminska kiselina
V08AA05
joksitalaminska
kiselina
NAPOMENA
FO
Cena leka
na veliko
po DDD
SVI OSTALI NETERAPIJSKI PROIZVODI
Svi ostali neterapijski proizvodi
5DVWYDUDþLLUD]EODåLYDþLXNOMXþXMXüLUDVWYRUH]DLVSLUDQMH
V07
V07A
V07AB
V07AB..
2194362
Cena leka
Država
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
za
leka
leka
leka
pakovanje
',-$*1267,ý.$65('679$
2VWDODGLMDJQRVWLþNDVUHGVWYD
Testovi za dijagnostiku tuberkuloze
STAC
TELEBRIX
GASTRO
rastvor za oralnu i
rektalnu primenu
1 po 100 ml (300 mg/ml)
Guerbet
Francuska
714,90
/LVWD%*UXSD9/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
=DãWLüHQRLPH
leka
DDD
Cena leka
na veliko
po DDD
14.057,90
-
-
Irska
30.417,40
-
-
-
Irska
14.403,40
-
-
-
GE Healthcare Ireland
Irska
28.806,90
-
-
10 po 200 ml (350 mg
I/ml)
GE Healthcare Ireland
Irska
55.285,90
-
-
-
ATC
V08AB
V08AB02
joheksol
0199210
V08AB02
joheksol
OMNIPAQUE
rastvor za injekciju
10 po 50 ml (300 mg
I/ml)
GE Healthcare Ireland
Irska
0199211
V08AB02
joheksol
OMNIPAQUE
rastvor za injekciju
ERFDSODVWLþQDSR
100 ml (300 mg I/ml)
GE Healthcare Ireland
0199214
V08AB02
joheksol
OMNIPAQUE
rastvor za injekciju
ERFDSODVWLþQDSR
ml (350 mg I/ml)
GE Healthcare Ireland
0199215
V08AB02
joheksol
OMNIPAQUE
rastvor za injekciju
10 po 100 ml (350 mg
I/ml)
0199217
V08AB02
joheksol
OMNIPAQUE
rastvor za injekciju
NAPOMENA
V08AB03
0194350
0194351
INN
Cena leka
Država
na veliko
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
za
FO
leka
leka
leka
pakovanje
Nefrotropna, niskoosmolarna kontrastna sredstva, rastvorljiva u vodi
Participacija
osiguranog
lica
STAC
joksaglat megluimin, joksaglat natrijum
V08AB03
joksaglat
megluimin,
joksaglat natrijum
HEXABRIX 320
rastvor za injekciju
1 po 50 ml (320 mg/ml)
Guerbet
Francuska
1.359,90
-
-
-
V08AB03
joksaglat
megluimin,
joksaglat natrijum
HEXABRIX 320
rastvor za injekciju
1 po 100 ml (320 mg/ml)
Guerbet
Francuska
2.582,40
-
-
-
NAPOMENA
V08AB05
STAC
jopromid
0194292
V08AB05
jopromid
ULTRAVIST 300
rastvor za infuziju
10 po 50 ml (300)
Bayer Schering
Pharma AG
1HPDþND
17.369,20
-
-
-
0194293
V08AB05
jopromid
ULTRAVIST 300
rastvor za infuziju
10 po 100 ml (300)
Bayer Schering
Pharma AG
1HPDþND
32.039,70
-
-
-
/LVWD%*UXSD9/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
ATC
0194255
V08AB05
INN
jopromid
=DãWLüHQRLPH
leka
ULTRAVIST 370
Cena leka
Država
na veliko
1D]LYSURL]YRÿDþD proizvodnje
za
leka
leka
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
FO
3DNRYDQMHLMDþLQD
leka
rastvor za infuziju
10 po 50 ml (370)
Bayer Schering
Pharma AG
1HPDþND
20.363,90
-
-
-
1HPDþND
39.505,60
-
-
-
0194258
V08AB05
jopromid
ULTRAVIST 370
rastvor za infuziju
10 po 100 ml (370)
Bayer Schering
Pharma AG
0194257
V08AB05
jopromid
ULTRAVIST 370
rastvor za infuziju
boca staklena, 10 po 200
ml (370 mg joda/ml)
Bayer Schering
Pharma AG
1HPDþND
78.949,10
-
-
-
0194259
V08AB05
jopromid
ULTRAVIST 370
rastvor za infuziju
boca staklena, 8 po 500
ml (768,86 mg/ml)
Bayer Schering
Pharma AG
1HPDþND
157.843,80
-
-
-
NAPOMENA
V08AB07
STAC
joversol
0199406
V08AB07
joversol
OPTIRAY 300
rastvor za injekciju
10 po 50 ml sa 300 mg
joda/ml (63.6%)
Tyco Healthcare
Kanada
16.037,20
-
-
-
0199411
V08AB07
joversol
OPTIRAY 300
rastvor za injekciju
boca, 10 po 75 ml (300
mg joda/ml)
Tyco HealthCare
Kanada
24.376,60
-
-
-
0199413
V08AB07
joversol
OPTIRAY 300
rastvor za injekciju
boca, 10 po 100 ml
(300mg joda/ml)
Tyco HealthCare
Kanada
31.272,60
-
-
-
0199412
V08AB07
joversol
OPTIRAY 300
rastvor za injekciju
boca, 10 po 150 ml (300
mg joda/ml)
Tyco HealthCare
Kanada
47.534,30
-
-
-
0199415
V08AB07
joversol
OPTIRAY 300
rastvor za injekciju
boca, 10 po 200 ml (300
mg joda/ml)
Tyco HealthCare
Kanada
60.981,60
-
-
-
0199416
V08AB07
joversol
OPTIRAY 300
rastvor za injekciju
boca, 5 po 500 ml (300
mg joda/ml)
Tyco HealthCare
Kanada
59.418,10
-
-
-
0199407
V08AB07
joversol
OPTIRAY 350
rastvor za injekciju
10 po 50 ml sa 350 mg
joda/ml (74.2%)
Tyco Healthcare
Švajcarska
16.037,20
-
-
-
0199408
V08AB07
joversol
OPTIRAY 350
rastvor za injekciju
boca, 10 po 100 ml (350
mg joda/ml)
Tyco HealthCare
Kanada
31.272,60
-
-
-
0199409
V08AB07
joversol
OPTIRAY 350
rastvor za injekciju
boca, 10 po 200 ml (350
mg joda/ml)
Tyco HealthCare
Kanada
60.981,60
-
-
-
0199410
V08AB07
joversol
OPTIRAY 350
rastvor za injekciju
boca, 5 po 500 ml (350
mg joda/ml)
Tyco HealthCare
Kanada
59.418,10
-
-
-
NAPOMENA
STAC
/LVWD%*UXSD9/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
FO
3DNRYDQMHLMDþLQD
leka
VISIPAQUE
rastvor za injekciju
10 po 50 ml (320 mg
I/ml)
GE Healthcare AS
Norveška
19.588,20
-
-
-
VISIPAQUE
rastvor za injekciju
10 po 100 ml (320 mg
I/ml)
GE Healthcare AS
Norveška
39.038,30
-
-
-
jobitridol
XENETIX 300
rastvor za injekciju
1 po 50 ml (300 mg/ml)
Guerbet
Francuska
1.566,20
-
-
-
V08AB11
jobitridol
XENETIX 300
rastvor za injekciju
1 po 100 ml (300 mg/ml)
Guerbet
Francuska
3.172,00
-
-
-
0199482
V08AB11
jobitridol
XENETIX 350
rastvor za injekciju
1 po 50 ml (350 mg/ml)
Guerbet
Francuska
1.691,40
-
-
-
0199483
V08AB11
jobitridol
XENETIX 350
rastvor za injekciju
1 po 100 ml (350 mg/ml)
Guerbet
Francuska
3.320,20
-
-
-
3.868,50
-
-
-
JKL
ATC
V08AB09
INN
jodiksanol
0199463
V08AB09
jodiksanol
0199464
V08AB09
jodiksanol
V08AB11
jobitridol
0199480
V08AB11
0199481
NAPOMENA
V08B
V08BA
V08BA02
3192101
0199430
0199015
0199021
V08BA02
=DãWLüHQRLPH
leka
Cena leka
Država
na veliko
1D]LYSURL]YRÿDþD proizvodnje
za
leka
leka
pakovanje
STAC
Kontrastna sredstva bez joda (X-zraci)
Kontrastna sredstva sa barijum sulfatom
barijum sulfat
barijum sulfat
BARIJUM SULFAT
oralna/rektalna
suspenzija
NRQWHMQHUSODVWLþQLSR
l (1 g/ml)
Hemofarm d.o.o.
Republika
Srbija
Kontrastna sredstva za magnetnu rezonancu
Paramagnetna kontrastna sredstva
V08C
V08CA
V08CA01
gadopentetat dimeglumin (gadopentetinska kiselina)
V08CA01
gadopentetat
dimeglumin
(gadopentetinska
kiselina)
V08CA01
gadopentetska
kiselina
V08CA01
gadopentetska
kiselina
MAGNEVIST
MAGNEGITA 500
MAGNEGITA 500
rastvor za injekciju
ERþLFDSRPO
(469,01 mg/ml)
Bayer Schering
Pharma AG
1HPDþND
32.036,90
-
-
-
rastvor za injekciju
ERþLFDVWDNOHQDSR
ml (500 mcmol/ml)
Biokanol Pharma
*PE+1HPDþND]D
Insight Agents GmbH
1HPDþND
1.054,30
-
-
-
rastvor za injekciju
Biokanol Pharma
ERþLFDVWDNOHQDSR *PE+1HPDþND]D
ml (500 mcmol/ml)
Insight Agents GmbH
1HPDþND
10.542,50
-
-
-
/LVWD%*UXSD9/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0199011
0199017
0199012
0199018
0199013
0199019
0199014
0199020
0199010
ATC
INN
V08CA01
gadopentetska
kiselina
V08CA01
gadopentetska
kiselina
V08CA01
gadopentetska
kiselina
V08CA01
gadopentetska
kiselina
V08CA01
gadopentetska
kiselina
V08CA01
gadopentetska
kiselina
V08CA01
gadopentetska
kiselina
V08CA01
gadopentetska
kiselina
V08CA01
gadopentetska
kiselina
=DãWLüHQRLPH
leka
MAGNEGITA 500
MAGNEGITA 500
MAGNEGITA 500
MAGNEGITA 500
MAGNEGITA 500
MAGNEGITA 500
MAGNEGITA 500
MAGNEGITA 500
MAGNEGITA 500
FO
3DNRYDQMHLMDþLQD
leka
Cena leka
Država
na veliko
1D]LYSURL]YRÿDþD proizvodnje
za
leka
leka
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
rastvor za injekciju
Biokanol Pharma
ERþLFDVWDNOHQDSR *PE+1HPDþND]D
ml (500 mcmol/ml)
Insight Agents GmbH
1HPDþND
2.108,50
-
-
-
rastvor za injekciju
Biokanol Pharma
ERþLFDVWDNOHQDSR *PE+1HPDþND]D
ml (500 mcmol/ml)
Insight Agents GmbH
1HPDþND
21.084,90
-
-
-
rastvor za injekciju
Biokanol Pharma
ERþLFDVWDNOHQDSR *PE+1HPDþND]D
ml (500 mcmol/ml)
Insight Agents GmbH
1HPDþND
3.161,90
-
-
-
rastvor za injekciju
Biokanol Pharma
ERþLFDVWDNOHQDSR *PE+1HPDþND]D
ml (500 mcmol/ml)
Insight Agents GmbH
1HPDþND
31.619,60
-
-
-
rastvor za injekciju
Biokanol Pharma
ERþLFDVWDNOHQDSR *PE+1HPDþND]D
ml (500 mcmol/ml)
Insight Agents GmbH
1HPDþND
3.203,70
-
-
-
rastvor za injekciju
Biokanol Pharma
ERþLFDVWDNOHQDSR *PE+1HPDþND]D
ml (500 mcmol/ml)
Insight Agents GmbH
1HPDþND
32.036,90
-
-
-
rastvor za injekciju
Biokanol Pharma
ERþLFDVWDNOHQDSR *PE+1HPDþND]D
ml (500 mcmol/ml)
Insight Agents GmbH
1HPDþND
4.806,70
-
-
-
rastvor za injekciju
Biokanol Pharma
ERþLFDVWDNOHQDSR *PE+1HPDþND]D
ml (500 mcmol/ml)
Insight Agents GmbH
1HPDþND
48.066,40
-
-
-
rastvor za injekciju
Biokanol Pharma
ERþLFDVWDNOHQDSR *PE+1HPDþND]D
ml (500 mcmol/ml)
Insight Agents GmbH
1HPDþND
16.018,50
-
-
-
/LVWD%*UXSD9/HNRYLNRMLVHSULPHQMXMXXWRNXDPEXODQWQRJRGQRVQREROQLþNRJOHþHQMDX]GUDYVWYHQLPXVWDQRYDPD
JKL
0199016
ATC
V08CA01
NAPOMENA
V08CA02
0199475
0199476
0199487
MAGNEGITA 500
rastvor za injekciju
ERþLFDVWDNOHQDSR
100 ml (500 mcmol/ml)
Biokanol Pharma
*PE+1HPDþND]D
Insight Agents GmbH
1HPDþND
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
160.184,90
-
-
-
STAC
JDGRWHULþQDNLVHOLQD
JDGRWHULþQD
kiselina
DOTAREM
rastvor za injekciju
15 ml po (0,5 mmol/ml)
Guerbet
Francuska
3.659,70
-
-
-
V08CA02
JDGRWHULþQD
kiselina
DOTAREM
rastvor za injekciju
20 ml po (0,5 mmol/ml)
Guerbet
Francuska
4.571,50
-
-
-
GADOVIST
rastvor za injekciju
10 po 30 ml (1,0
mmol/ml)
Bayer Schering
Pharma AG
1HPDþND
205.805,60
-
-
-
rastvor za injekciju
napunjen injekcioni špric,
5 po 7,5 ml (604,72
mg/ml, 1 mmol/ml)
Bayer Schering
Pharma AG
1HPDþND
26.724,80
-
-
-
rastvor za injekciju
napunjen injekcioni špric,
1 po 10 ml (181,43
mg/ml)
Bayer Schering
Pharma AG
1HPDþND
18.258,30
-
-
-
V08CA09
V08CA09
NAPOMENA
V08CA10
0199535
gadopentetska
kiselina
FO
3DNRYDQMHLMDþLQD
leka
V08CA02
NAPOMENA
V08CA09
0199486
INN
=DãWLüHQRLPH
leka
Cena leka
Država
na veliko
1D]LYSURL]YRÿDþD proizvodnje
za
leka
leka
pakovanje
V08CA10
NAPOMENA
STAC
gadobutrol
gadobutrol
gadobutrol
GADOVIST
STAC
gadoksetinska kiselina
gadoksetinska
kiselina
STAC
PRIMOVIST
Lista C - Grupa B. Lekovi sa posebnim režimom izdavanja
JKL
0069150
0069152
0069154
0069155
0069157
ATC
B
B03
B03X
B03XA
B03XA01
B03XA01
B03XA01
B03XA01
B03XA01
B03XA01
INDIKACIJE
B03XA01
0069165
0069166
B03XA01
B03XA01
INDIKACIJE
Država
Cena leka
3DNRYDQMHLMDþLQD
Naziv
proizvodnje na veliko za
INN
=DãWLüHQRLPHOHND
FO
leka
SURL]YRÿDþDOHND
leka
pakovanje
DDD
.59,.59279251,25*$1,/(.29,=$/(ý(1M(%2/(67,.59,,.59279251,+25*$1$
ANTIANEMICI
Ostali antianemijski preparati
Ostali antianemijski preparati
epoetin alfa (eritropoetin)
epoetin alfa
epoetin alfa
epoetin alfa
epoetin alfa
epoetin alfa
Cena leka Participacija
na veliko osiguranog
po DDD
lica
EPREX
rastvor za injekciju,
špric
napunjen injekcioni
špric, 6 po 1000 i.j./0,5
ml
Cilag AG
Švajcarska
4.387,20
1000 i.j.
731,20
-
EPREX
rastvor za injekciju,
špric
napunjen injekcioni
špric, 6 po 2000 i.j./0,5
ml
Cilag AG
Švajcarska
6.785,50
1000 i.j.
565,46
-
EPREX
rastvor za injekciju,
špric
napunjen injekcioni
špric, 6 po 3000 i.j./0,3
ml (brizgalica)
Cilag AG
Švajcarska
10.170,80
1000 i.j.
565,04
-
EPREX
rastvor za injekciju,
špric
napunjen injekcioni
špric, 6 po 4000 i.j./0,4
ml (brizgalica)
Cilag AG
Švajcarska
13.450,90
1000 i.j.
560,45
-
EPREX
rastvor za injekciju,
špric
napunjen injekcioni
špric, 6 po 10000 i.j.
(brizgalica)
Cilag AG
Švajcarska
31.366,00
1000 i.j.
522,77
-
3ULPHQMXMHVHX]GUDYVWYHQLPXVWDQRYDPDJGHVHYUãLGLMDOL]DVDPR]DOHþHQMHDQHPLMHXKURQLþQRMLQVXILFLMHQFLMLEXEUHJDVDKHPRJORELQRPQLåLPRGJOGR
postizanja i održavanja ciljnih vrednosti hemoglobina 110 g/l
]DRYXLQGLNDFLMXREDYH]QRMHSUHSULPHQHHULWURSRHWLQDREDYH]QRSRSXQLWLGHSRHJYRåÿDVDQLUDWLLQIHNFLMHL]DSDOMHQVNDVWDQMDLREH]EHGLWLGREUXL]GLMDOL]LUDQRVW
bolesnika.
epoetin beta (eritropoetin)
epoetin beta
epoetin beta
RECORMON
RECORMON
rastvor za injekciju,
špric
napunjeni injekcioni
špric, 6 brizg. po 2000
i.j./0,3 ml
Roche Diagnostics
GmbH
1HPDþND
6.785,50
1000 i.j.
565,46
-
rastvor za injekciju,
špric
napunjeni injekcioni
špric, 6 brizg. po 5000
i.j./0,3 ml
Roche Diagnostics
GmbH
1HPDþND
22.187,00
1000 i.j.
739,57
-
3ULPHQMXMHVHX]GUDYVWYHQLPXVWDQRYDPDJGHVHYUãLGLMDOL]DVDPR]DOHþHQMHDQHPLMHXKURQLþQRMLQVXILFLMHQFLMLEXEUHJDVDKHPRJORELQRPQLåLPRGJOGR
postizanja i održavanja ciljnih vrednosti hemoglobina 110 g/l
]DRYXLQGLNDFLMXREDYH]QRMHSUHSULPHQHHULWURSRHWLQDREDYH]QRSRSXQLWLGHSRHJYRåÿDVDQLUDWLLQIHNFLMHL]DSDOMHQVNDVWDQMDLREH]EHGLWLGREUXL]GLMDOL]LUDQRVW
bolesnika.
Lista C - Grupa B. Lekovi sa posebnim režimom izdavanja
JKL
0069221
0069222
0069226
0069227
0069230
0069231
0069234
ATC
B03XA01
B03XA01
B03XA01
B03XA01
B03XA01
B03XA01
B03XA01
B03XA01
INN
epoetin zeta
epoetin zeta
epoetin zeta
epoetin zeta
epoetin zeta
epoetin zeta
epoetin zeta
epoetin zeta
=DãWLüHQRLPHOHND
EQRALYS
EQRALYS
EQRALYS
EQRALYS
EQRALYS
EQRALYS
EQRALYS
FO
3DNRYDQMHLMDþLQD
Naziv
leka
SURL]YRÿDþDOHND
Država
proizvodnje
leka
Cena leka
na veliko za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
rastvor za injekciju
napunjen inj.špric 1 po
0,3 ml (1000 i.j./0,3
ml)
Hemofarm a.d.
Republika Srbija
584,40
1000 i.j.
584,40
-
rastvor za injekciju
napunjen inj.špric 6 po
0,3 ml (1000 i.j./0,3
ml)
Hemofarm a.d.
Republika Srbija
3.506,10
1000 i.j.
584,35
-
rastvor za injekciju
napunjen inj.špric 1 po
0,6 ml (2000 i.j./0,6
ml)
Hemofarm a.d.
Republika Srbija
1.168,70
1000 i.j.
584,35
-
rastvor za injekciju
napunjen inj.špric 6 po
0,6 ml (2000 i.j./0,6
ml)
Hemofarm a.d.
Republika Srbija
7.012,40
1000 i.j.
584,37
-
rastvor za injekciju
napunjen inj.špric 1 po
0,9 ml (3000 i.j./0,9
ml)
Hemofarm a.d.
Republika Srbija
1.753,10
1000 i.j.
584,37
-
rastvor za injekciju
napunjen inj.špric 6 po
0,9 ml (3000 i.j./0,9
ml)
Hemofarm a.d.
Republika Srbija
10.518,30
1000 i.j.
584,35
-
rastvor za injekciju
napunjen inj.špric 1 po
0,4 ml (4000 i.j./0.4
ml)
Hemofarm a.d.
Republika Srbija
2.337,40
1000 i.j.
584,35
-
Hemofarm a.d.
Republika Srbija
14.024,40
1000 i.j.
584,35
-
0069235
B03XA01
epoetin zeta
EQRALYS
rastvor za injekciju
napunjen inj.špric 6 po
0,4 ml (4000 i.j./0,4
ml)
0069223
B03XA01
epoetin zeta
EQRALYS
rastvor za injekciju
napunjen inj.špric 1 po
1 ml (10000 i.j./ml)
Hemofarm a.d.
Republika Srbija
5.843,50
1000 i.j.
584,35
-
0069220
B03XA01
epoetin zeta
EQRALYS
rastvor za injekciju
napunjen inj.špric 6 po
1 ml (10000 i.j./ml)
Hemofarm a.d.
Republika Srbija
35.060,70
1000 i.j.
584,35
-
rastvor za injekciju
napunjen inj.špric 1 po
0,5 ml (20000 i.j./0,5
ml)
Hemofarm a.d.
Republika Srbija
11.686,90
1000 i.j.
584,35
-
rastvor za injekciju
napunjen inj.špric 1 po
0,75 ml (30000 i.j./0,75
ml)
Hemofarm a.d.
Republika Srbija
17.530,40
1000 i.j.
584,35
-
0069224
0069228
B03XA01
B03XA01
epoetin zeta
epoetin zeta
EQRALYS
EQRALYS
Lista C - Grupa B. Lekovi sa posebnim režimom izdavanja
JKL
ATC
0069232
B03XA01
INDIKACIJE
B03XA02
0069939
0069938
B03XA02
B03XA02
INN
epoetin zeta
=DãWLüHQRLPHOHND
EQRALYS
FO
rastvor za injekciju
3DNRYDQMHLMDþLQD
Naziv
leka
SURL]YRÿDþDOHND
napunjen inj.špric 1 po
1 ml (40000 i.j./ml)
Hemofarm a.d.
Država
proizvodnje
leka
Cena leka
na veliko za
pakovanje
DDD
Republika Srbija
23.373,80
1000 i.j.
Cena leka Participacija
na veliko osiguranog
po DDD
lica
584,35
-
3ULPHQMXMHVHX]GUDYVWYHQLPXVWDQRYDPDJGHVHYUãLGLMDOL]DVDPR]DOHþHQMHDQHPLMHXKURQLþQRMLQVXILFLMHQFLMLEXEUHJDVDKHPRJORELQRPQLåLPRGJOGR
postizanja i održavanja ciljnih vrednosti hemoglobina 110 g/l
]DRYXLQGLNDFLMXREDYH]QRMHSUHSULPHQHHULWURSRHWLQDREDYH]QRSRSXQLWLGHSRHJYRåÿDVDQLUDWLLQIHNFLMHL]DSDOMHQVNDVWDQMDLREH]EHGLWLGREUXL]GLMDOL]LUDQRVW
bolesnika.
darbepoetin alfa
darbepoetin alfa
darbepoetin alfa
ARANESP
ARANESP
rastvor za injekciju
napunjen inj. špric, 1
po 0,4 ml (10 mcg/0,4
ml)
Amgen Europe B.V.
Holandija
1.481,70
4,5 mcg
666,77
-
rastvor za injekciju
napunjen inj. špric 1
po 0,375 ml (15
mcg/0,375 ml)
Amgen Europe B.V.
Holandija
2.222,50
4,5 mcg
666,75
-
Holandija
2.963,30
4,5 mcg
666,74
-
0069924
B03XA02
darbepoetin alfa
ARANESP
rastvor za injekciju
napunjen inj.špric, 1
po 0,5 ml (20 mcg/0,5
ml)
Amgen Europe B.V.
0069928
B03XA02
darbepoetin alfa
ARANESP
rastvor za injekciju
napunjen inj.špric 1 po
0,3 ml (30 mcg/0,3 ml) Amgen Europe B.V.
Holandija
4.445,00
4,5 mcg
666,75
-
rastvor za injekciju
napunjen inj.špric 1 po
0,4 ml (40 mcg/0,4
ml)
Amgen Europe B.V.
Holandija
5.926,70
4,5 mcg
666,75
-
napunjen inj.špric 1 po
0,5 ml (50 mcg/0,5
ml)
Amgen Europe B.V.
Holandija
7.408,40
4,5 mcg
666,76
-
0069929
B03XA02
darbepoetin alfa
ARANESP
0069933
B03XA02
darbepoetin alfa
ARANESP
rastvor za injekciju
0069934
B03XA02
darbepoetin alfa
ARANESP
rastvor za injekciju
0069936
B03XA02
darbepoetin alfa
ARANESP
0069920
0069922
B03XA02
B03XA02
darbepoetin alfa
darbepoetin alfa
ARANESP
ARANESP
Holandija
8.890,10
4,5 mcg
666,76
-
rastvor za injekciju
napunjen inj.špric 1 po
0,3 ml (60 mcg/0,3 ml) Amgen Europe B.V.
napunjen inj.špric 1 po
0,4 ml (80 mcg/0,4
ml)
Amgen Europe B.V.
Holandija
11.853,50
4,5 mcg
666,76
-
rastvor za injekciju
napunjen inj.špric 1 po
0,5 ml (100 mcg/0,5
ml)
Amgen Europe B.V.
Holandija
14.816,80
4,5 mcg
666,76
-
rastvor za injekciju
napunjen inj.špric 1 po
0,3 ml (150 mcg/0,3
ml)
Amgen Europe B.V.
Holandija
22.225,20
4,5 mcg
666,76
-
Lista C - Grupa B. Lekovi sa posebnim režimom izdavanja
JKL
ATC
INN
=DãWLüHQRLPHOHND
FO
3DNRYDQMHLMDþLQD
Naziv
leka
SURL]YRÿDþDOHND
Država
proizvodnje
leka
Cena leka
na veliko za
pakovanje
DDD
Holandija
44.450,40
4,5 mcg
666,76
-
Cena leka Participacija
na veliko osiguranog
po DDD
lica
0069926
B03XA02
darbepoetin alfa
ARANESP
rastvor za injekciju
napunjen inj.špric 1 po
0,6 ml (300 mcg/0,6
ml)
Amgen Europe B.V.
0069925
B03XA02
darbepoetin alfa
ARANESP
rastvor za injekciju
pen sa uloškom, 1 po
0,5 ml (20 mcg/0,5 ml) Amgen Europe B.V.
Holandija
2.963,30
4,5 mcg
666,74
-
0069930
B03XA02
darbepoetin alfa
ARANESP
rastvor za injekciju
pen sa uloškom, 1 po
0,4 ml (40 mcg/0,4 ml) Amgen Europe B.V.
Holandija
5.926,70
4,5 mcg
666,75
-
0069935
B03XA02
darbepoetin alfa
ARANESP
rastvor za injekciju
pen sa uloškom, 1 po
0,3 ml (60 mcg/0,3 ml) Amgen Europe B.V.
Holandija
8.890,10
4,5 mcg
666,76
-
0069937
B03XA02
darbepoetin alfa
ARANESP
rastvor za injekciju
pen sa uloškom, 1 po
0,4 ml (80 mcg/0,4 ml) Amgen Europe B.V.
Holandija
11.853,50
4,5 mcg
666,76
-
rastvor za injekciju
pen sa uloškom, 1 po
0,5 ml (100 mcg/0,5
ml)
Amgen Europe B.V.
Holandija
14.816,80
4,5 mcg
666,76
-
rastvor za injekciju
pen sa uloškom, 1 po
0,3 ml (150 mcg/0,3
ml)
Amgen Europe B.V.
Holandija
22.225,20
4,5 mcg
666,76
-
rastvor za injekciju
pen sa uloškom, 1 po
0,6 ml (300 mcg/0,6
ml)
Amgen Europe B.V.
Holandija
44.450,40
4,5 mcg
666,76
-
0069921
0069923
0069927
B03XA02
B03XA02
B03XA02
INDIKACIJE
B03XA03
0069206
B03XA03
0069205
B03XA03
darbepoetin alfa
darbepoetin alfa
darbepoetin alfa
ARANESP
ARANESP
ARANESP
3ULPHQMXMHVHX]GUDYVWYHQLPXVWDQRYDPDJGHVHYUãLGLMDOL]DVDPR]DOHþHQMHDQHPLMHXKURQLþQRMLQVXILFLMHQFLMLEXEUHJDVDKHPRJORELQRPQLåLPRGJOGR
postizanja i održavanja ciljnih vrednosti hemoglobina 110 g/l.
]DRYXLQGLNDFLMXREDYH]QRMHSUHSULPHQHGDUEHSRHWLQDSRSXQLWLGHSRHJYRåÿDVDQLUDWLLQIHNFLMHL]DSDOMHQVNDVWDQMDLREH]EHGLWLGREUXL]GLMDOL]LUDQRVWEROHVQLND
2. Primenjuje se u zdravstvenim ustanovama koje obavljaju zdravstvenu delatnost na sekundarnom ili tercijarnom nivou a na osnovu mišljenja lekara nefrologa: za
OHþHQMHSDFLMHQDWDVDDQHPLMRPXKURQLþQRMLQVXILFLMHQFLMLEXEUHJDNRGNRMLKVXYUHGQRVWLNOLUHQVDNUHDWLQLQD”POPLQGRSRVWL]DQMDLRGUåDYDQMDFLOMQLK
vrednosti hemoglobina 110 g/l.
]DRYXLQGLNDFLMXREDYH]QRMHSUHSULPHQHGDUEHSRHWLQDNRULJRYDWLVYHUD]ORJH]DQDVWDQDNDQHPLMHQDGRNQDGDJYRåÿDYLWDPLQDGUXJLKQXWULWLYQLKIDNWRUD
zaustaviti krvarenje).
metoksipolietilenglikol - epoetin beta
metoksipolietilenglikol
- epoetin beta
MIRCERA
metoksipolietilenglikol
- epoetin beta
MIRCERA
rastvor za injekciju
1 po 50 mcg/0,3 ml
rastvor za injekciju
1 po 75 mcg/0,3 ml
Roche Diagnostics
GmbH
Roche Diagnostics
GmbH
1HPDþND
8.468,00
4 mcg
677,44
-
1HPDþND
12.702,00
4 mcg
677,44
-
Lista C - Grupa B. Lekovi sa posebnim režimom izdavanja
JKL
0069204
0069203
0069202
ATC
B03XA03
B03XA03
B03XA03
INN
=DãWLüHQRLPHOHND
metoksipolietilenglikol
- epoetin beta
MIRCERA
metoksipolietilenglikol
- epoetin beta
MIRCERA
metoksipolietilenglikol
- epoetin beta
MIRCERA
FO
3DNRYDQMHLMDþLQD
Naziv
leka
SURL]YRÿDþDOHND
Država
proizvodnje
leka
Cena leka
na veliko za
pakovanje
DDD
1HPDþND
16.936,10
4 mcg
677,44
-
Cena leka Participacija
na veliko osiguranog
po DDD
lica
rastvor za injekciju
1 po 100 mcg/0,3 ml
Roche Diagnostics
GmbH
rastvor za injekciju
napunjen injekcioni
špric, 1 po 150
mcg/0,3 ml
Roche Diagnostics
GmbH
1HPDþND
25.404,10
4 mcg
677,44
-
rastvor za injekciju
napunjen injekcioni
špric, 1 po 200
mcg/0,3 ml
Roche Diagnostics
GmbH
1HPDþND
33.872,20
4 mcg
677,44
-
Roche Diagnostics
GmbH
1HPDþND
42.340,30
4 mcg
677,44
-
0069201
B03XA03
metoksipolietilenglikol
- epoetin beta
MIRCERA
rastvor za injekciju
napunjen injekcioni
špric, 1 po 250
mcg/0,3 ml
0069208
B03XA03
metoksipolietilenglikol
- epoetin beta
MIRCERA
rastvor za injekciju
ERþLFDSRPFJ
ml
F. Hoffmann-La
Roche Ltd.
Švajcarska
8.468,00
4 mcg
677,44
-
metoksipolietilenglikol
- epoetin beta
MIRCERA
rastvor za injekciju u
napunjenom
injekcionom špricu
napunjen injekcioni
špric, 1 po 30 mcg/0,3
ml
Roche Diagnostics
GmbH
1HPDþND
5.080,80
4 mcg
677,44
-
metoksipolietilenglikol
- epoetin beta
MIRCERA
rastvor za injekciju u
napunjenom
injekcionom špricu
napunjen injekcioni
špric, 1 po 120
mcg/0,3 ml
Roche Diagnostics
GmbH
1HPDþND
20.323,30
4 mcg
677,44
-
metoksipolietilenglikol
- epoetin beta
MIRCERA
rastvor za injekciju u
napunjenom
injekcionom špricu
napunjen injekcioni
špric, 1 po 360
mcg/0,6 ml
Roche Diagnostics
GmbH
1HPDþND
60.969,90
4 mcg
677,44
-
0069213
0069212
0069214
B03XA03
B03XA03
B03XA03
INDIKACIJE
1. Primenjuje se u zdravstvenim ustanovama koje obavljaju zdravstvenu delatnost na sekundarnom ili tercijarnom nivou a na osnovu mišljenja lekara nefrologa: za
OHþHQMHSDFLMHQDWDVDDQHPLMRPXKURQLþQRMEXEUHåQRMLQVXILFLMHQFLMLNRGNRMLKVXYUHGQRVWLNOLUHQVDNUHDWLQLQD”POPLQGRSRVWL]DQMDLRGUåDYDQMDFLOMQLK
vrednosti hemoglobina 110 g/l.
]DRYXLQGLNDFLMXREDYH]QRMHSUHSULPHQHGXJRGHOXMXüLKSUHSDUDWDHULWURSRHWLQDNRULJRYDWLVYHUD]ORJH]DQDVWDQDNDQHPLMHQDGRNQDGDJYRåÿDYLWDPLQD
drugih nutritivnih faktora, zaustaviti krvarenje).
Lista C - Grupa L. Lekovi sa posebnim režimom izdavanja
JKL
=DãWLüHQRLPHOHND
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
temozolomid
1031407
L01AX03
temozolomid
TEMODAL ¸
kapsula, tvrda
ERþLFDSRPJ
Schering Plough Labo
N.V.
Belgija
1.930,90
-
-
-
1031405
L01AX03
temozolomid
TEMODAL ¸
kapsula, tvrda
ERþLFDSRPJ
Schering Plough Labo
N.V.
Belgija
7.936,10
-
-
-
ERþLFDSRPJ
Schering Plough Labo
N.V.
Belgija
39.683,60
-
-
-
ERþLFDSRPJ
Schering Plough Labo
N.V.
Belgija
99.007,40
-
-
-
1031406
L01AX03
L01AX03
temozolomid
temozolomid
TEMODAL ¸
TEMODAL ¸
FO
Cena leka na
veliko za
pakovanje
ATC
L
L01
L01A
L01AX
L01AX03
1031408
INN
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
ANTINEOPLASTICI I IMUNOMODULATORI
ANTINEOPLASTICI
$ONLOLUDMXüLFLWRVWDWLFL
2VWDOLDONLOLUDMXüLDQWLQHRSODVWLFL
kapsula, tvrda
kapsula, tvrda
INDIKACIJE
Glioblastoma multiforme kod bolesnika sa pozitivnim metilacionim statusom MGMT gena, PS 0 ili 1 (ECOG) kao postoperativna terapija u dozi od 75 mg/m² dnevno,
LVWRYUHPHQRVD]UDþQRPWHUDSLMRP3R]DYUãHQRP]UDþHQMXOHþHQMHQDVWDYLWLWHPR]RORPLGRPXGR]LRGPJPðGQHYQRRGSUYRJGRSHWRJGDQDFLNOXVDNRML
WUDMHGDQDXNXSQRãHVWFLNOXVD=DSRþLQMDQMHKHPLRWHUDSLMHVHYUãHSRXYLGXX05,XþLQMHQQHGHOMDSRVOHRSHUDWLYQRJOHþHQMDQDNRQ]LOLMXPXUHIHUHQWQH
ustanove, pod uslovom da je PS pacijenta 0 ili 1.
NAPOMENA
L01B
L01BA
L01BA04
/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMD.RPLVLMH5)=2DQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- Institut za onkologiju Vojvodine,
- Klinika za onkologiju KC Niš,
- KC Kragujevac.
Antimetaboliti
Analozi folne kiseline
pemetreksed
0034413
L01BA04
INDIKACIJE
NAPOMENA
pemetreksed
ALIMTA ¸
prašak za
koncentrat za
rastvor za infuziju
ERþLFDSRPJ
Lilly France S.A.S.
1. Maligni pleuralni mezoteliom, uznapredovala neresektabilna bolest, PS 0 ili 1.
67$&/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- Klinika za pulmologiju KC Srbije,
- KBC Bežanijska Kosa,
,QVWLWXW]DSOXüQHEROHVWL9RMYRGLQH
.OLQLND]DSOXüQHEROHVWLÄ.QH]VHOR³.&1Lã
- KC Kragujevac.
Francuska
129.686,20
-
-
-
Lista C - Grupa L. Lekovi sa posebnim režimom izdavanja
JKL
ATC
L01BC
L01BC06
INN
=DãWLüHQRLPHOHND
FO
3DNRYDQMHLMDþLQD
leka
L01BC06
kapecitabin
XELODA ¸
film tableta
blister, 120 po 500 mg
1034340
L01BC06
kapecitabin
XELODA ¸
film tableta
blister, 60 po 150 mg
NAPOMENA
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Švajcarska;
Meksiko
28.705,60
-
-
-
Švajcarska;
Meksiko
4.646,40
-
-
-
Cena leka Participacija
na veliko osiguranog
po DDD
lica
kapecitabin
1034341
INDIKACIJE
1D]LYSURL]YRÿDþD
leka
Analozi pirimidina
F. Hoffmann-La Roche
Ltd.; Syntex S.A. DE
C.V.
F. Hoffmann-La Roche
Ltd.; Syntex S.A. DE
C.V.
1. Karcinom dojke:
a) metastatski karcinom dojke, nakon prethodne primene antraciklina i/ili taksana PS 0, 1 ili 2;
b) metastatski karcinom dojke, prva linija sistemske terapije kod pacijenata sa kontraindikacijama za primenu antraciklina i taksana PS 0, 1 ili 2.
2. Kolorektalni karcinom:
a) adjuvantna hemioterapija u kliniþkom stadijumu Dukes "C", PS 0 ili 1, ili nastavak adjuvantne terapije, pri razvoju toksiþnosti gr. 3-4 na 5FU/LV hemioterapiju;
b) metastatska bolest, kod oþekivanih neželjenih efekata na hemioterapiju koja sadrži 5FU, PS 0, 1 ili 2.
=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- KBC Bežanijska Kosa,
- Institut za onkologiju Vojvodine,
- Klinika za onkologiju KC Niš,
- KC Kragujevac;
=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- Klinika za gastroenterologiju KC Srbije,
- KBC Bežanijska Kosa,
- Institut za onkologiju Vojvodine,
- Klinika za onkologiju KC Niš,
- KC Kragujevac.
Lista C - Grupa L. Lekovi sa posebnim režimom izdavanja
JKL
0039300
ATC
L01C
L01CD
L01CD02
L01CD02
INN
=DãWLüHQRLPHOHND
FO
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
Biljni alkaloidi i drugi prirodni proizvodi
Taksani
Cena leka na
veliko za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
docetaksel
docetaksel
TAXOTERE ¸
koncentrat i
ERþLFDVDUDVWYDUDþHP
UDVWYDUDþ]D
XERþLFLSRPO
rastvor za infuziju
mg/0,5 ml)
Aventis Pharma Ltd.
Velika Britanija
4.772,80
-
-
-
ERþLFDVDUDVWYDUDþHP
XERþLFLSRPO
mg/2 ml)
Aventis Pharma Ltd.
Velika Britanija
17.820,00
-
-
-
0039301
L01CD02
docetaksel
TAXOTERE ¸
koncentrat i
UDVWYDUDþ]D
rastvor za infuziju
0039304
L01CD02
docetaksel
TAXOTERE ¸
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (20 mg/1 ml)
Aventis Pharma Ltd.
Velika Britanija
4.772,80
-
-
-
0039305
L01CD02
docetaksel
TAXOTERE ¸
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (80 mg/4 ml)
Aventis Pharma Ltd.
Velika Britanija
17.820,00
-
-
-
DOCETAXEL ¸
ERþLFDVDNRQFHQWUDWRP
koncentrat i
LERþLFDVD
UDVWYDUDþ]D
UDVWYDUDþHPPJ
rastvor za infuziju
ml
S.C. Sindan Pharma
S.R.L.
Rumunija
4.772,80
-
-
-
S.C. Sindan Pharma
S.R.L.
Rumunija
17.820,00
-
-
-
0039310
L01CD02
docetaksel
0039311
L01CD02
docetaksel
DOCETAXEL ¸
ERþLFDVDNRQFHQWUDWRP
koncentrat i
LERþLFDVD
UDVWYDUDþ]D
UDVWYDUDþHPPJ
rastvor za infuziju
ml
0039725
L01CD02
docetaksel
DOCETAXEL
SANDOZ ¸
koncentrat za
rastvor za infuziju
ERþLFDPJPO
Ebewe Pharma GmbH
NFG.KG
Austrija
4.772,80
-
-
-
0039796
L01CD02
docetaksel
DOCETAXEL
SANDOZ ¸
koncentrat za
rastvor za infuziju
ERþLFDPJPO
Ebewe Pharma GmbH
NFG.KG
Austrija
17.820,00
-
-
-
Lista C - Grupa L. Lekovi sa posebnim režimom izdavanja
JKL
0039315
0039316
ATC
L01CD02
L01CD02
INN
docetaksel
docetaksel
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
=DãWLüHQRLPHOHND
FO
3DNRYDQMHLMDþLQD
leka
DOCETAXEL-TEVA ¸
koncentrat i
UDVWYDUDþ]D
rastvor za infuziju
ERþLFDVDNRQFHQWUDWRP
LERþLFDVD
UDVWYDUDþHPSR
ml (20 mg/0,72 ml)
Teva Pharmaceutical
Works Private Ltd.
Company;
Pharmachemie B.V.
0DÿDUVND
Holandija
4.772,80
-
-
-
DOCETAXEL-TEVA ¸
koncentrat i
UDVWYDUDþ]D
rastvor za infuziju
ERþLFDVDNRQFHQWUDWRP
LERþLFDVD
UDVWYDUDþHPSR
ml (80 mg/2,88 ml)
Teva Pharmaceutical
Works Private Ltd.
Company;
Pharmachemie B.V.
0DÿDUVND
Holandija
17.820,00
-
-
-
1. Karcinom dojke:
a) metastatska bolest, prva linija posle antraciklina, PS 0 ili 1 (sem kod pacijenata sa kontraindikacijama za primenu antraciklina gde može biti prva linija za metastatsku bolest bez
obzira na vrstu prethodne adjuvantne hemioterapije);
b) metastatska bolest PS 0 ili 1 - retretman kod taksan senzitivne bolesti;
c) adjuvantna hemioterapija kod nodus pozitivne bolesti, prvenstveno kod pacijenata sa veoma visokim rizikom za relaps, kao sekvencijalni pristup, u kombinaciji sa antraciklinima;
d) lokalno uznapredovali karcinom dojke , sekvencijalna primena nakon prethodne primene antraciklina, u sluþaju izostanka terapijskog odgovora na antracikline (SD, PD), najviše do
þetiri ciklusa.
2. Nemikrocelularni karcinom pluüa, druga linija hemioterapije, kliniþki stadijum IIIb, PS 0 ili 1, posle platinskog dubleta.
3. Karcinom prostate, hormon refraktorna bolest, bez znaþajnih komorbiditeta, PS 0 ili 1 i uz kastracioni nivo serumskog testosterona (<0,5 ng/ml).
INDIKACIJE
NAPOMENA
67$&=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- KBC Bežanijska Kosa,
- Institut za onkologiju Vojvodine,
- Klinika za onkologiju KC Niš,
- KC Kragujevac;
=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- Klinika za pulmologiju KC Srbije,
,QVWLWXW]DSOXüQHEROHVWL9RMYRGLQH
.OLQLND]DSOXüQHEROHVWLÄ.QH]VHOR´.&1Lã
- KCB Bežanijska kosa;
=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- Klinika za urologiju KC Srbije,
- KBC Bežanijska Kosa,
- Institut za onkologiju Vojvodine,
- Klinika za onkologiju KC Niš.
Lista C - Grupa L. Lekovi sa posebnim režimom izdavanja
JKL
0033181
ATC
L01D
L01DB
L01DB06
INN
idarubicin
L01DB06
idarubicin
=DãWLüHQRLPHOHND
ZAVEDOS ¸
FO
liofilizat za rastvor
za injekciju
Država
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje
leka
leka
leka
&LWRWRNVLþQLDQWLELRWLFLLVURGQHVXSVWDQFH
Antraciklini i srodni preparati
1 po 10 mg
Actavis Italia S.P.A.
INDIKACIJE
Svi oblici akutnih leukemija i limfoblastni limfom.
NAPOMENA
L01X
L01XC
L01XC02
67$&/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- Klinika za hematologiju KC Srbije,
8QLYHU]LWHWVNDGHþMDNOLQLND
- Institut za onkologiju Vojvodine,
- Klinika za hematologiju KC Vojvodine,
.OLQLND]DKHPDWRORJLMXLNOLQLþNXLPXQRORJLMX.&1Lã
- KC Kragujevac,
,QVWLWXW]D]GUDYVWYHQX]DãWLWXPDMNHLGHWHWD6UELMHÄ'U9XNDQýXSLü´
- Institut za decu i omladinu Vojvodine,
.OLQLND]DGHþMHLQWHUQHEROHVWL.&1Lã
Ostali antineoplastici
Monoklonska antitela
rituksimab
0014140
L01XC02
rituksimab
MABTHERA ¸
koncentrat za
ERþLFDSRPO F. Hoffmann-La Roche
rastvor za infuziju
mg/10 ml)
Ltd.
Cena leka na
veliko za
pakovanje
DDD
Italija
11.649,90
-
-
-
Švajcarska
47.487,50
-
-
-
Cena leka Participacija
na veliko osiguranog
po DDD
lica
Lista C - Grupa L. Lekovi sa posebnim režimom izdavanja
JKL
0014141
ATC
L01XC02
INN
rituksimab
=DãWLüHQRLPHOHND
MABTHERA ¸
FO
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
koncentrat za
ERþLFDSRPO F. Hoffmann-La Roche
rastvor za infuziju
mg/50 ml)
Ltd.
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Švajcarska
117.245,50
-
Cena leka Participacija
na veliko osiguranog
po DDD
lica
-
-
INDIKACIJE
1HKRþNLQVNLOLPIRPL&'SR]LWLYDQSRGWLSGLIX]QLNUXSQRüHOLMVNLQRYRGLMDJQRVWLNRYDQLX]KHPLRWHUDSLMX&&&&&
1HKRþNLQVNLOLPIRPL&'SR]LWLYDQSRGWLSIROLNXODUQLQRYRGLMDJQRVWLNRYDQLLXUHFLGLYXEROHVWL&
3. Reumatoidni artritis (M05 i M06) - rituksimab u kombinaciji sa metotreksatom uvodi se u terapiju ukoliko su ispunjena oba kriterijuma i to:
DSRVOHãHVWPHVHFLSULPHQHOHNRYDNRMLPRGLILNXMXWRNEROHVWL/07%QLMHSRVWLJQXWRGJRYDUDMXüLNOLQLþNLRGJRYRUWMSREROMãDQMH'$6VNRUD]DQDMPDQMH
1,2 ili više ili postoje elementi nepodnošljivosti lekova koji modifikuju tok bolesti (LMTB), i
ESRVOHãHVWPHVHFLRGSRþHWNDSULPHQHSUHWKRGQRJELRORãNRJOHNDQLMHSRVWLJQXWDGHNYDWDQNOLQLþNLRGJRYRUWMSREROMãDQMHVPDQMHQMH'$6VNRUD]D
najmanje 1,2).
8NROLNRMH]DSRþHWROHþHQMHULWXNVLPDERPQHRSKRGQRMHWHUDSLMVNHFLNOXVHSRQDYOMDWLQDãHVWPHVHFLLOLQDNRQGXåHJSHULRGDX]DYLVQRVWLRGVWDQMDEROHVQLNDL
broja limfocita u perifernoj krvi.
NAPOMENA
67$&=DLQGLNDFLMXSRGWDþNRPLOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- Klinika za hematologiju KC Srbije,
- KBC Bežanijska Kosa,
8QLYHU]LWHWVNDGHþMDNOLQLND
- Klinika za hematologiju KC Vojvodine,
- Institut za onkologiju Vojvodine,
.OLQLND]DKHPDWRORJLMXLNOLQLþNXLPXQRORJLMX.&1Lã
- Klinika za onkologiju KC Niš,
- KC Kragujevac,
,QVWLWXW]D]GUDYVWYHQX]DãWLWXPDMNHLGHWHWD6UELMHÄ'U9XNDQýXSLü´
- Institut za decu i omladinu Vojvodine,
.OLQLND]DGHþMHLQWHUQHEROHVWL.&1Lã
=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMD.RPLVLMH5)=2
Lista C - Grupa L. Lekovi sa posebnim režimom izdavanja
JKL
0039345
ATC
L01XC03
L01XC03
INDIKACIJE
NAPOMENA
INN
trastuzumab
trastuzumab
=DãWLüHQRLPHOHND
HERCEPTIN ¸
FO
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
SUDãDNLUDVWYDUDþ
za kocentrat za
rastvor za infuziju
OLRERþLFDVD
UDVWYDUDþHPSR
ml (440 mg/20 ml)
F. Hoffmann-La Roche
Ltd.
Švajcarska
165.552,70
-
Cena leka Participacija
na veliko osiguranog
po DDD
lica
-
-
Karcinom dojke, HER2 prekomerna ekspresija (IHH 3+ ili CISH+):
a) adjuvantna hemioterapija - kao nastavak adjuvantne hemioterapije antraciklinima kao monoterapija ili u kombinaciji sa taksanima do ukupno 12 meseci, kod nodus pozitivnih
pacijenata i nodus negativnih pacijenata sa tumorom veüim od 10 mm (u sluþaju postojanja kontraindikacija za antracikline, trastuzumab kombinovati sa neantraciklinskim režimima);
b) metastatska bolest- PS 0 ili 1, prva linija posle antraciklinske terapije, u kombinaciji sa taksanima, 6 do 8 ciklusa, a potom u odsustvu progresije bolesti, nastaviti samo Herceptin do
progresije bolesti;
c) lokalno uznapredovali karcinom dojke: primena Herceptina u kombinaciji sa taksanskom hemioterapijom, a nakon prethodne sekvencijalne primene antraciklina. Kod ove grupe
nastavak primene Herceptina u adjuvantnom tretmanu, nakon operacije, do ukupno godinu dana, raþunajuüi i primenu Herceptina u neoadjuvantnom pristupu.
67$&/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- KBC Bežanijska Kosa,
- Institut za onkologiju Vojvodine,
- Klinika za onkologiju KC Niš,
- KC Kragujevac.
Lista C - Grupa L. Lekovi sa posebnim režimom izdavanja
JKL
0039153
ATC
L01XC06
INN
cetuksimab
=DãWLüHQRLPHOHND
L01XC06
cetuksimab
ERBITUX ¸
INDIKACIJE
NAPOMENA
L01XC07
0039401
L01XC07
FO
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (5 mg/ml)
Merck KGaA
1HPDþND
19.034,20
-
Cena leka Participacija
na veliko osiguranog
po DDD
lica
-
-
.DUFLQRPNRORUHNWXPDPHWDVWDWVNDEROHVWSRVOHKHPLRWHUDSLMHQDED]LRNVDOLSODWLQHLLULQRWHNDQDLVNOMXþLYR]DSDFLMHQWHVDWXPRULPDNRML
sadrže nemutirani K/Ras gen, PS 0 ili 1, kao monoterapija ili u kombinaciji sa irinotekanom;
2. Planocelularni karcinom glave i vrata:
a) istovremeno sa radioterapijom kod pacijenata sa PS 0 ili 1 u lokalno uznapredovalom, inoperabilnom planocelularnom karcinomu usne duplje i
RURIDULQNVDNRGNRMLKMHOHþHQMH]DSRþHWRLQGXNFLRQRPKHPLRWHUDSLMRP
b) lokalno uznapredovala, inoperabilna bolest, u kombinaciji sa radioterapijom, PS 0 ili 1, u pacijenata kod kojih je kontraindikovana primena lekova na bazi
platine;
c) u kombinaciji sa standardnom hemioterapijom (5FU-cisplatin ili 5FU-karboplatin) prva linija za rekurentni planocelularni karcinom glave i vrata koji nije
podoban za lokoregionalni tretman, bez egzulceracije, PS 0-1.
67$&=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- Klinika za gastroenterologiju KC Srbije,
- KBC Bežanijska Kosa,
- Institut za onkologiju Vojvodine,
- KC Niš,
- KC Kragujevac;
=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- Institut za onkologiju Vojvodine,
- Klinika za onkologiju KC Niš,
- KC Kragujevac.
bevacizumab
bevacizumab
AVASTIN ¸
koncentrat za
rastvor za infuziju
ERþLFDSRPO
mg/4 ml)
F. Hoffmann-La Roche
Ltd.
Švajcarska
29.245,10
-
-
-
Lista C - Grupa L. Lekovi sa posebnim režimom izdavanja
JKL
0039400
ATC
L01XC07
INN
bevacizumab
=DãWLüHQRLPHOHND
AVASTIN ¸
FO
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
koncentrat za
ERþLFDSRPO F. Hoffmann-La Roche
rastvor za infuziju
mg/16 ml)
Ltd.
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Švajcarska
117.126,30
-
Cena leka Participacija
na veliko osiguranog
po DDD
lica
-
-
INDIKACIJE
.DUFLQRPNRORUHNWXPDSRWHQFLMDOQRUHVHNWDELOQDPHWDVWDWVNDEROHVWGRPLQDQWQRXMHWULNOLQLþNLVWDGLMXP,9ELOL,9FSUYDOLQLMDVLVWHPVNHWHUDSLMHXNRPELQDFLMLVD
KHPLRWHUDSLMRPGRSRVWL]DQMDUHVHNWDELOQRVWLPHWDVWD]DLRGJRYDUDMXüHRSHUDFLMHLVWLKPDNVLPDOQRFLNOXVD
NAPOMENA
L01XE
L01XE01
67$&/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- Klinika za gastroenterologiju KC Srbije,
- KBC Bežanijska Kosa,
- Institut za onkologiju Vojvodine,
- Klinika za onkologiju KC Niš,
- KC Kragujevac.
Inhibitori protein kinaze
imatinib
1039381
L01XE01
imatinib
GLIVEC ¸
kapsula, tvrda
blister, 120 po 100 mg
Novartis Pharma Stein
AG
Švajcarska
177.382,20
-
-
-
1039383
L01XE01
imatinib
GLIVEC ¸
film tableta
blister, 30 po 400 mg
Novartis Pharma Stein
AG
Švajcarska
181.992,70
-
-
-
1039384
L01XE01
imatinib
ANZOVIP ¸
film tableta
blister 120 po 100 mg
Zdravlje a.d.
Republika Srbija
173.008,40
-
-
-
Lista C - Grupa L. Lekovi sa posebnim režimom izdavanja
JKL
1039385
ATC
L01XE01
INN
imatinib
=DãWLüHQRLPHOHND
ANZOVIP ¸
FO
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
film tableta
blister 30 po 400 mg
Zdravlje a.d.
Republika Srbija
177.265,80
-
Cena leka Participacija
na veliko osiguranog
po DDD
lica
-
INDIKACIJE
3UYDWHUDSLMVNDOLQLMDNRGQRYRGLMDJQRVWLNRYDQLKEROHVQLNDVDKURQLþQRPPLMHORLGQRPOHXNHPLMRPXKURQLþQRMID]LEROHVWL3KLODGHOSKLD
hromozom ili bcr-abl rearanžman pozitivni, bez dodatnih aberacija, uz dozvoljenu prethodnu leukoredukciju hidroksiureom do šest meseci.
2. GIST (Gastro intestinalni stromalni tumori) - lokalno uznapredovali inoperabilni ili metastatski oblik bolesti, PS 0 ili 1.
NAPOMENA
=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMD.RPLVLMH5)=2DQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Klinika za hematologiju KC Srbije,
- KBC Bežanijska Kosa,
8QLYHU]LWHWVNDGHþMDNOLQLND
- Klinika za hematologiju KC Vojvodine,
.OLQLND]DKHPDWRORJLMXLNOLQLþNXLPXQRORJLMX.&1Lã
- KC Kragujevac,
- Institut za decu i omladinu Vojvodine,
.OLQLND]DGHþMHLQWHUQHEROHVWL.&1Lã
,QVWLWXW]D]GUDYVWYHQX]DãWLWXPDMNHLGHWHWD6UELMHÄ'U9XNDQýXSLü´
=DLQGLNDFLMXSRGWDþNRPOHNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMD.RPLVLMH5)=2DQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- Klinika za gastroenterologiju KC Srbije,
- KBC Bežanijska Kosa,
- Institut za onkologiju Vojvodine,
- Klinika za onkologiju KC Niš,
- KC Kragujevac.
-
Lista C - Grupa L. Lekovi sa posebnim režimom izdavanja
JKL
1039398
ATC
L01XE02
INN
gefitinib
=DãWLüHQRLPHOHND
L01XE02
gefitinib
IRESSA ¸
FO
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
film tableta
30 po 250 mg
AstraZeneca UK Limited
Velika Britanija
206.330,10
-
Cena leka Participacija
na veliko osiguranog
po DDD
lica
-
-
INDIKACIJE
1HVLWQRüHOLMVNLNDUFLQRPSOXüDXVWDGLMXPX,,,EL,9XSUYRMOLQLMLOHþHQMDNRGSDFLMHQDWDVDSR]LWLYQLPWHVWRPQDPXWDFLMXWLUR]LQNLQD]HUHFHSWRUD]DHSLGHUPDOQL
faktor rasta (EGFR-TK), PS 0 ili 1.
NAPOMENA
L01XE03
/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMD.RPLVLMH5)=2DQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- Klinika za pulmologiju KC Srbije,
,QVWLWXW]DSOXüQHEROHVWL9RMYRGLQH
.OLQLND]DSOXüQHEROHVWLÄ.QH]VHOR´.&1Lã
- KBC Bežanijska Kosa.
erlotinib
1039402
1039403
1039404
L01XE03
L01XE03
L01XE03
erlotinib
erlotinib
erlotinib
TARCEVA ¸
TARCEVA ¸
TARCEVA ¸
film tableta
film tableta
film tableta
blister, 30 po 25 mg
F. Hoffmann-La Roche
Ltd.
Švajcarska
43.823,30
-
-
-
blister, 30 po 100 mg
F. Hoffmann-La Roche
Ltd.
Švajcarska
151.214,00
-
-
-
blister, 30 po 150 mg
F. Hoffmann-La Roche
Ltd.
Švajcarska
182.328,50
-
-
-
INDIKACIJE
$GHQRNDUFLQRPSOXüDXVWDGLMXPX,,,EL,9XGUXJRMOLQLMLVLVWHPVNRJOHþHQMDNRGEROHVQLNDVD36LOLNRGNRMLKMHXSUHWKRGQRPOHþHQMXUHJLVWURYDQD]QDþDMQD
WRNVLþQRVW
NAPOMENA
L01XE04
/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMD.RPLVLMH5)=2DQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- Klinika za pulmologiju KC Srbije,
,QVWLWXW]DSOXüQHEROHVWL9RMYRGLQH
.OLQLND]DSOXüQHEROHVWLÄ.QH]VHOR´.&1Lã
- KBC Bežanijska Kosa.
sunitinib
1039703
L01XE04
sunitinib
SUTENT ¸
kapsula, tvrda
blister, 28 po 12,5 mg
Pfizer Italia S.R.L.
Italija
110.714,60
-
-
-
1039704
L01XE04
sunitinib
SUTENT ¸
kapsula, tvrda
blister, 28 po 25 mg
Pfizer Italia S.R.L.
Italija
220.365,20
-
-
-
Lista C - Grupa L. Lekovi sa posebnim režimom izdavanja
JKL
1039706
ATC
L01XE04
INN
sunitinib
=DãWLüHQRLPHOHND
SUTENT ¸
FO
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
kapsula, tvrda
blister, 28 po 50 mg
Pfizer Italia S.R.L.
Italija
440.376,50
-
Cena leka Participacija
na veliko osiguranog
po DDD
lica
-
INDIKACIJE
/RNDOQRRGPDNOLLLOLPHWDVWDWVNLNDUFLQRPEXEUHåQLKüHOLMDVYHWORüHOLMVNLSRGWLSNRGEROHVQLNDGREUHLOLLQWHUPHGLMDUQHSURJQR]HVD36LOLXSUYRMOLQLML
VLVWHPVNRJOHþHQMD
NAPOMENA
L01XE07
/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMD.RPLVLMH5)=2DQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- Klinika za urologiju KCS,
- Institut za onkologiju Vojvodine,
- Klinika za onkologiju KC Niš.
lapatinib
1039715
L01XE07
lapatinib
TYVERB ¸
film tableta
blister, 70 po 250 mg
Glaxo Wellcome
Operations; Glaxo
Wellcome S.A.
Velika Britanija;
Španija
116.591,90
-
-
-
-
INDIKACIJE
Karcinom dojke - druga linija metastatskog HER2 pozitivnog karcinoma dojke, u kombinaciji sa lekom kapecitabin, kod pacijenata sa progresijom osnovne bolesti i
36SUHWKRGQROHþHQLKDQWUDFLNOLQLPDLLOLWDNVDQLPDLOHNRPWUDVWX]XPDENRMLMHSULPHQMHQXSUYRMOLQLMLOHþHQMDPHWDVWDWVNHEROHVWL
NAPOMENA
L01XE08
/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije,
- KBC Bežanijska Kosa,
- Klinika za onkologiju KC Niš,
- Institut za onkologiju Vojvodine,
- KC Kragujevac.
nilotinib
1039710
L01XE08
nilotinib
TASIGNA ¸
kapsula, tvrda
blister, 112 po 200 mg
Novartis Pharma Stein
AG
Švajcarska
353.773,20
-
-
-
Lista C - Grupa L. Lekovi sa posebnim režimom izdavanja
JKL
1039711
ATC
L01XE08
INN
nilotinib
=DãWLüHQRLPHOHND
TASIGNA ¸
FO
kapsula, tvrda
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
blister, 112 po 150 mg
Novartis Pharma Stein
AG
Švajcarska
262.966,06
-
Cena leka Participacija
na veliko osiguranog
po DDD
lica
-
-
INDIKACIJE
'UXJDWHUDSLMVNDOLQLMDNRGRGUDVOLKEROHVQLNDVDKURQLþQRPPLMHORLGQRPOHXNHPLMRPRWSRUQLKLOLQHWROHUDQWQLKQDEDUMHGQXSUHWKRGQXWHUDSLMXXNOMXþXMXüLLPDWLQLE
mesilat.
NAPOMENA
L01XX
L01XX14
/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMD.RPLVLMH5)=2DQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Klinika za hematologiju KC Srbije,
- KBC Bežanijska Kosa,
- Klinika za hematologiju KC Vojvodine,
.OLQLND]DKHPDWRORJLMXLNOLQLþNXLPXQRORJLMX.&1Lã
- KC Kragujevac.
Ostali antineoplastici
tretinoin
1069140
L01XX14
tretinoin
VESANOID ¸
kapsula
100 po 10 mg
F. Hoffmann-La Roche
Ltd.
INDIKACIJE
Akutna mijeolidna leukemija, podtip akutna promijelocitna leukemija.
NAPOMENA
/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Klinika za hematologiju KC Srbije,
8QLYHU]LWHWVNDGHþMDNOLQLND
- Klinika za hematologiju KC Vojvodine,
.OLQLND]DKHPDWRORJLMXLNOLQLþNXLPXQRORJLMX.&1Lã
- KC Kragujevac,
,QVWLWXW]D]GUDYVWYHQX]DãWLWXPDMNHLGHWHWD6UELMHÄ'U9XNDQýXSLü´
- Institut za decu i omladinu Vojvodine,
.OLQLND]DGHþMHLQWHUQHEROHVWL.&1Lã
- KBC Bežanijska Kosa.
Švajcarska
16.226,20
-
-
-
Lista C - Grupa L. Lekovi sa posebnim režimom izdavanja
JKL
0039100
ATC
L01XX32
INN
bortezomib
=DãWLüHQRLPHOHND
L01XX32
bortezomib
VELCADE ¸
FO
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
prašak za rastvor
za injekciju
1 po 3,5 mg
Janssen Pharmaceutica
N.V.
Belgija
115.350,80
-
INDIKACIJE
Multipli mijelom:
DXSUYRMWHUDSLMVNRMOLQLMLNRGYLVRNRUL]LþQLKEROHVQLNDVDUHQDOQRPLQVXILFLMHQFLMRPNOLUHQVNUHDWLQLQDPDQMLRGPOPLQLLOL
citogenetskim abnormalnostima visokog rizika /del 13, t(4; 14), t(14; 16)/ i/ ili sa rizikom od tromboembolijskih komplikacija;
EXUHFLGLYXEROHVWLX]RGVXVWYR]QDþDMQHSHULIHUQHSROLQHXURSDWLMH:+2JUDGXV
NAPOMENA
L03
L03A
L03AB
L03AB07
67$&/HNVHXYRGLXWHUDSLMXQDRVQRYXPLãOMHQMD.RPLVLMH5)=2DQDRVQRYXPLãOMHQMDWULOHNDUDVOHGHüLK]GUDYVWYHQLKXVWDQRYD
- Institut za onkologiju i radiologiju Srbije, Klinika za hematologiju KC Srbije,
- KBC Bežanijska Kosa,
- Institut za onkologiju Vojvodine,
- Klinika za hematologiju KC Vojvodine,
.OLQLND]DKHPDWRORJLMXLNOLQLþNXLPXQRORJLMX.&1Lã
- Klinika za onkologiju KC Niš,
- KC Kragujevac.
IMUNOSTIMULANSI
Citokini i imunomodulatori
Interferoni
interferon beta 1a
0328388
0328387
0328647
L03AB07
L03AB07
L03AB07
INDIKACIJE
NAPOMENA
interferon beta 1a
interferon beta-1a
interferon beta 1a
Cena leka Participacija
na veliko osiguranog
po DDD
lica
-
-
REBIF
rastvor za injekciju
napunjen injekcioni
u napunjenom
špric sa iglom, 12 po
injekcionom špricu 0,5 ml (44 mcg/0.5 ml)
Merck Serono S.P.A.
Italija
83.112,10
-
-
-
REBIF
rastvor za injekciju
napunjen injekcioni
u napunjenom
špric sa iglom, 12 po
injekcionom špricu 0,5 ml (22 mcg/0.5 ml)
Merck Serono S.P.A.
Italija
74.683,50
-
-
-
AVONEX
rastvor za injekciju
u napunjenom
injekcionom špricu
Biogen Idec Denmark
Manufacturing ApS
Danska
67.142,90
-
-
-
napunjen injekcioni
špric, 4 po 0.5 ml (30
mcg/0.5ml)
1. Multipla skleroza
Lek se uvodi u terapiju na osnovu mišljenja Komisije RFZO.
Lista C - Grupa L. Lekovi sa posebnim režimom izdavanja
JKL
0015150
ATC
L03AB08
L03AB08
INN
=DãWLüHQRLPHOHND
interferon beta 1b
interferon beta 1b
BETAFERON
FO
3DNRYDQMHLMDþLQD
leka
ERþLFDLUDVWYDUDþX
SUDãDNLUDVWYDUDþ
napunjenom
za rastvor za
injekcionom špricu, 15 Bayer Schering Pharma
injekciju
po 1,2 ml (250 mcg/ml)
AG
INDIKACIJE
1. Multipla skleroza
NAPOMENA
L03AB10
Lek se uvodi u terapiju na osnovu mišljenja Komisije RFZO.
peginterferon alfa 2b
0328630
0328631
0328900
0328632
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
1HPDþND
77.752,00
4 Mi.j.
2.159,78
-
Cena leka Participacija
na veliko osiguranog
po DDD
lica
L03AB10
peginterferon alfa 2b
PEGINTRON
SUDãDNLUDVWYDUDþ
za rastvor za
pen sa uloškom, 1 po
injekciju
0,5 ml (50 mcg/0,5 ml)
Schering Plough
Company
Irska
7.797,30
7,5 mcg
1.169,60
-
L03AB10
peginterferon alfa 2b
PEGINTRON
SUDãDNLUDVWYDUDþ
za rastvor za
pen sa uloškom, 1 po
injekciju
0,5 ml (80 mcg/0,5 ml)
Schering Plough
Company
Irska
12.436,50
7,5 mcg
1.165,92
-
L03AB10
peginterferon alfa 2b
PEGINTRON
SUDãDNLUDVWYDUDþ
za rastvor za
pen sa uloškom, 1 po
injekciju
0,5 ml (100 mcg/0,5 ml)
Schering Plough
Company
Irska
15.757,60
7,5 mcg
1.181,82
-
L03AB10
peginterferon alfa 2b
PEGINTRON
SUDãDNLUDVWYDUDþ
za rastvor za
pen sa uloškom, 1 po
injekciju
0,5 ml (120 mcg/0,5 ml)
Schering Plough
Company
Irska
18.426,30
7,5 mcg
1.151,64
-
Lista C - Grupa L. Lekovi sa posebnim režimom izdavanja
JKL
0328633
ATC
L03AB10
INN
=DãWLüHQRLPHOHND
peginterferon alfa 2b
PEGINTRON
FO
3DNRYDQMHLMDþLQD
leka
SUDãDNLUDVWYDUDþ
za rastvor za
pen sa uloškom, 1 po
injekciju
0,5 ml (150 mcg/0,5 ml)
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
Schering Plough
Company
Irska
23.824,60
7,5 mcg
Cena leka Participacija
na veliko osiguranog
po DDD
lica
1.191,23
-
+URQLþQL+(3$7,7,6&VDLOLEH]NRPSHQ]RYDQHFLUR]HMHWUHX]URNRYDQHYLUXVRPKHSDWLWLVD&NRMLWUHEDGD]DGRYROMDYDMXVOHGHüHNULWHULMXPH
a. virusološki profil:
DQWL+&9DQWLWHODSR]LWLYQDXVHUXPXQDMNUDüHPHVHFL
SR]LWLYDQ+&951.LRGUHÿHQJHQRWLSYLUXVD
b. biohemijski nalaz:
- bez fibroze: povišena aktivnost transaminaza ili
- sa fibrozom: bez povišene aktivnosti transaminaza;
FKLVWRORãNLGRND]DQRKURQLþQR]DSDOMHQMHMHWUHQHNURLQIODPDWRUQDDNWLYQRVWVDLOLEH]ILEUR]D
GEROHVQLFLNRMLPDQLMHUDÿHQDELRSVLMDMHWUH]ERJNRQWUDLQGLNDFLMHDLVSXQMDYDMXVYHRVWDOHXVORYH
e. bolesnici koji apstiniraju od i.v. droga i alkohola, najmanje 12 meseci uz potvrdu neuropsihijatra/psihijatra;
ILVNOMXþLWLEROHVQLNHVDSULVXWQLPNRQWUDLQGLNDFLMDPDQDWHUDSLMXSHJLORYDQLPLQWHUIHURQRPLULEDYLULQRP
INDIKACIJE
7HUDSLMVNLSURWRNROSUHPDNULWHULMXPLPD]DOɟþHQMHKURQLþQLKREROMHQMDMHWUHKURQLþQRJKHSDWLWLVDLNRPSHQ]RYDQHFLUR]HMHWUHX]URNRYDQLKYLUXVRPKHSDWLWLVD&
(HCV) kombinovanom terapijom (pegilovani interferon alfa + ribavirin). Trajanje terapije zavisi od genotipa virusa kao i od terapijskog odgovora koji se proverava u
LQHGHOMLOHþHQMD9LUHPLMDVHSURYHUDYDLQHGHOMHRG]DYUãWHNDOHþHQMD
NAPOMENA
L03AB11
Lek se uvodi u terapiju na osnovu mišljenja Komisije RFZO.
peginterferon alfa 2a
0328607
L03AB11
peginterferon alfa2a
PEGASYS
rastvor za injekciju
napunjen injekcioni
u napunjenom
špric sa iglom, 1 po 0,5
injekcionom špricu ml (135 mcg/0,5 ml)
F. Hoffmann-La Roche
Ltd.
Švajcarska
12.371,00
26 mcg
2.382,56
-
Lista C - Grupa L. Lekovi sa posebnim režimom izdavanja
JKL
0328608
ATC
L03AB11
INN
=DãWLüHQRLPHOHND
peginterferon alfa2a
PEGASYS
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
rastvor za injekciju
napunjen injekcioni
u napunjenom
špric sa iglom, 1 po 0,5
injekcionom špricu ml (180 mcg/0,5 ml)
F. Hoffmann-La Roche
Ltd.
Švajcarska
16.494,70
26 mcg
FO
Cena leka Participacija
na veliko osiguranog
po DDD
lica
2.382,57
-
+URQLþQL+(3$7,7,6&VDLOLEH]NRPSHQ]RYDQHFLUR]HMHWUHX]URNRYDQHYLUXVRPKHSDWLWLVD&NRMLWUHEDGD]DGRYROMDYDMXVOHGHüHNULWHULMXPH
a. virusološki profil:
DQWL+&9DQWLWHODSR]LWLYQDXVHUXPXQDMNUDüHPHVHFL
SR]LWLYDQ+&951.LRGUHÿHQJHQRWLSYLUXVD
b. biohemijski nalaz:
- bez fibroze: povišena aktivnost transaminaza ili
- sa fibrozom: bez povišene aktivnosti transaminaza;
FKLVWRORãNLGRND]DQRKURQLþQR]DSDOMHQMHMHWUHQHNURLQIODPDWRUQDDNWLYQRVWVDLOLEH]ILEUR]D
GEROHVQLFLNRMLPDQLMHUDÿHQDELRSVLMDMHWUH]ERJNRQWUDLQGLNDFLMHDLVSXQMDYDMXVYHRVWDOHXVORYH
e. bolesnici koji apstiniraju od i.v. droga i alkohola, najmanje 12 meseci uz potvrdu neuropsihijatra/psihijatra;
ILVNOMXþLWLEROHVQLNHVDSULVXWQLPNRQWUDLQGLNDFLMDPDQDWHUDSLMXSHJLORYDQLPLQWHUIHURQRPLULEDYLULQRP
INDIKACIJE
NAPOMENA
L03AX
L03AX13
0015120
L03AX13
INDIKACIJE
NAPOMENA
7HUDSLMVNLSURWRNROSUHPDNULWHULMXPLPD]DOɟþHQMHKURQLþQLKREROMHQMDMHWUHKURQLþQRJKHSDWLWLVDLNRPSHQ]RYDQHFLUR]HMHWUHX]URNRYDQLKYLUXVRPKHSDWLWLVD&
(HCV) kombinovanom terapijom (pegilovani interferon alfa + ribavirin). Trajanje terapije zavisi od genotipa virusa kao i od terapijskog odgovora koji se proverava u
LQHGHOMLOHþHQMD9LUHPLMDVHSURYHUDYDLQHGHOMHRG]DYUãWHNDOHþHQMD
+URQLþQLKHSDWLWLV%]DSDFLMHQWHNRGNRMLKMH
a. HBsAg pozitivnost duža od 6 meseci,
b. povišena aktivnost alaninaminotransferaze (ALT povišena >2,5 odnosno >100 IU/ml)
FKURQLþQLKHSDWLWLVVDLOLEH]ILEUR]H
d. viremija (HBV DNK) ”΃ kopija /ml krvi.
Lek se uvodi u terapiju na osnovu mišljenja Komisije RFZO.
Ostali imunostimulansi
glatiramer acetat
glatiramer acetat
COPAXONE
rastvor za injekciju
napunjen injekcioni
špric, 28 po 1 ml (20
mg/ml)
1. Multipla skleroza
Lek se uvodi u terapiju na osnovu mišljenja Komisije RFZO.
Teva Pharmaceutical
Industries Ltd.
Izrael
70.748,50
20 mg
2.526,73
-
Lista C - Grupa L. Lekovi sa posebnim režimom izdavanja
JKL
0014310
0014312
ATC
L04
L04A
L04AB
L04AB01
L04AB01
L04AB01
INDIKACIJE
NAPOMENA
INN
=DãWLüHQRLPHOHND
FO
Država
1D]LYSURL]YRÿDþD proizvodnje
leka
leka
IMUNOSUPRESIVI
Imunosupresivi
Inhibitori tumor necrosis faktora TNF-alfa
3DNRYDQMHLMDþLQD
leka
Cena leka na
veliko za
pakovanje
DDD
Cena leka Participacija
na veliko osiguranog
po DDD
lica
etanercept
etanercept
etanercept
ENBREL
SUDãDNLUDVWYDUDþ
ERþLFDLQDSXQMHQ
za rastvor za
injekcioni špric, 4 po 1
injekciju
ml (25 mg/1 ml)
Wyeth Pharmaceuticals
Velika Britanija
46.859,40
7 mg
3.280,16
-
ENBREL
napunjen injekcioni
špric sa iglom, 4 po 1
ml (50 mg/ml)
Wyeth Pharmaceuticals
Velika Britanija
92.833,00
7 mg
3.249,16
-
rastvor za injekciju
3ROLDUWLNXODUQLMXYHQLOQLKURQLþQLDUWULWLV0]DSDFLMHQWHþLMDMHEROHVWSRþHODXGRELRGGRJRGLQDåLYRWDVDQHDGHNYDWQLPRGJRYRURPLOL
QHSRGQRãOMLYRãüXQDPHWRWUHNVDWLOLGUXJHLPXQRVXSUHVLYQHOHNRYHQDMPDQMHWRNRPãHVWPHVHFLWHUDSLMH
5HXPDWRLGQLDUWULWLV0L0XNROLNRMHLVSXQMHQNULWHULMXPGDSRVOHPHVHFLSULPHQHOHNRYDNRMLPRGLILNXMXWRNEROHVWL/07%QLMHSRVWLJQXWRGJRYDUDMXüL
NOLQLþNLRGJRYRUWMSREROMãDQMH'$6VNRUD]DQDMPDQMHLOLYLãHLOLREROHOLLGDOMHLPMXYLVRNXDNWLYQRVWERHOVWL'$6YHüLRGLOLSRVWRMHHOHPHQWL
nepodnošljivosti LMTB;
$QNLOR]LUDMXüLVSRQGLOLWLV0XNROLNRMHLVSXQMHQMHGDQRGNULWHULMXPD
DLQWROHUDQFLMDLOLQHHILNDVQRVWSRMHGLQDþQHSULPHQHQDMPDQMHGYDQHVWHURLGQDDQWLLQIODPDWRUQDOHND16$,/XPDNVLPDOQRMSUHSRUXþHQRMGR]LXWRNXRG
SRWULPHVHFDDXNXSQRWUDMDQMHOHþHQMDRGQDMPDQMHãHVWPHVHFLLOL
b) prisustvo perifernog artritisa i intolerancije ili neefikasnosti nakon primene najmanje dva nesteroidna antiinflamatorna leka (NSAIL), u maksimalnoj
SUHSRUXþHQRMGR]LXWRNXRGSRWULPHVHFDX]VXOIDVDOD]LQDXXNXSQRPWUDMDQMXOHþHQMDRGQDMPDQMHãHVWPHVHFL
3VRULMD]QLDUWULWLV0XNROLNRMHLVSXQMHQNULWHULMXPGDSRVWRMLSULVXVWYRDNWLYQH]JOREQHEROHVWLWULLOLYLãHEROQLKRWHþHQLK]JORERYDSULOLNRPGYDSUHJOHGDX
LQWHUYDOXRGPHVHFGDQDXSUNRVSULPHQLSUHWKRGQRJOHþHQMDVDQDMPDQMHMHGQLPLOLNRPELQDFLMRPYLãHOHNRYDNRMLPRGLILNXMXWRNEROHVWL/07%XWRNXãHVWPHVHFL
terapije.
Lek se uvodi u terapiju na osnovu mišljenja Komisije RFZO.
Lista C - Grupa L. Lekovi sa posebnim režimom izdavanja
JKL
0014220
ATC
L04AB02
L04AB02
INDIKACIJE
NAPOMENA
INN
infliksimab
infliksimab
=DãWLüHQRLPHOHND
REMICADE
FO
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
prašak za
koncentrat za
rastvor za infuziju
ERþLFDSRPJ
Centocor B.V.
Holandija
54.111,80
3,75 mg
Cena leka Participacija
na veliko osiguranog
po DDD
lica
2.029,19
-
1. Teška, aktivna forma Crohnove bolesti - inflamatorni tip sa/bez fistule kod pacijenata koji nisu reagovali na konvencionalnu terapiju kortikosteroidima,
imunomodulatorima i primarnu nutritivnu terapiju kao i kod onih pacijenta koji pomenute lekove ne podnose ili kod kojih je takva vrsta terapije kontraindikovana;
7HãNLLYUORWHãNLREOLNDNWLYQRJXOFHUR]QRJNROLWLVDNRGSDFLMHQDWDNRMLVXLPDOLQHDGHNYDWDQRGJRYRUQDNRQYHQFLRQDOQXWHUDSLMXXNOMXþXMXüLNRUWLNRVWHURLGHL
imunomodulatore (6-merkaptopurin ili azatioprin), odnosno koji ne podnose ili imaju medicinske kontraindikacije za takvu terapiju;
3VRULMD]QLDUWULWLV0XNROLNRMHLVSXQMHQNULWHULMXPGDSRVWRMLSULVXVWYRDNWLYQH]JOREQHEROHVWLWULLOLYLãHEROQLKRWHþHQLK]JORERYDSULOLNRPGYDSUHJOHGDX
LQWHUYDOXRGPHVHFGDQDXSUNRVSULPHQLSUHWKRGQRJOHþHQMDVDQDMPDQMHMHGQLPLOLNRPELQDFLMRPYLãHOHNRYDNRMLPRGLILNXMXWRNEROHVWL/07%XWRNXãHVWPHVHFL
terapije;
5HXPDWRLGQLDUWULWLV0L0XNROLNRMHLVSXQMHQNULWHULMXPGDSRVOHPHVHFLSULPHQHOHNRYDNRMLPRGLILNXMXWRNEROHVWL/07%QLMHSRVWLJQXWRGJRYDUDMXüL
NOLQLþNLRGJRYRUWMSREROMãDQMH'$6VNRUD]DQDMPDQMHLOLYLãHLOLREROHOLLGDOMHLPDMXYLVRNXDNWLYQRVWERHOVWL'$6YHüLRGLOLSRVWRMHHOHPHQWL
nepodnošljivosti LMTB;
$QNLOR]LUDMXüLVSRQGLOLWLV0XNROLNRMHLVSXQMHQMHGDQRGNULWHULMXPD
DLQWROHUDQFLMDLOLQHHILNDVQRVWSRMHGLQDþQHSULPHQHQDMPDQMHGYDQHVWHURLGQDDQWLLQIODPDWRUQDOHND16$,/XPDNVLPDOQRMSUHSRUXþHQRMGR]LXWRNXRG
SRWULPHVHFDDXNXSQRWUDMDQMHOHþHQMDRGQDMPDQMHãHVWPHVHFLLOL
b) prisustvo perifernog artritisa i intolerancije ili neefikasnosti nakon primene najmanje dva nesteroidna antiinflamatorna leka (NSAIL), u maksimalnoj
SUHSRUXþHQRMGR]LXWRNXRGSRWULPHVHFDX]VXOIDVDOD]LQDXXNXSQRPWUDMDQMXOHþHQMDRGQDMPDQMHãHVWPHVHFL
STAC;
Lek se uvodi u terapiju na osnovu mišljenja Komisije RFZO.
Lista C - Grupa L. Lekovi sa posebnim režimom izdavanja
JKL
0014202
ATC
L04AB04
L04AB04
INN
adalimumab
adalimumab
=DãWLüHQRLPHOHND
HUMIRA
FO
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
rastvor za injekciju
u napunjenom
injekcionom špricu
napunjen injekcioni
špric, 2 po 0,8 ml (40
mg/0,8 ml)
Abbott Biotechnology
Deutchland GmbH
1HPDþND
94.497,30
2,9 mg
Cena leka Participacija
na veliko osiguranog
po DDD
lica
3.425,53
-
$NWLYQLSROLDUWLNXODUQLMXYHQLOQLKURQLþQLDUWULWLV0]DSDFLMHQWHX]UDVWDRGJRGLQHLVWDULMHVDQHDGHNYDWQLPRGJRYRURPLOLQHSRGQRãOMLYRãüXQDPHWRWUHNVDWLOL
druge imunosupresivne lekove najmanje tokom šest meseci terapije.
5HXPDWRLGQLDUWULWLV0L0XNROLNRMHLVSXQMHQNULWHULMXPGDSRVOHPHVHFLSULPHQHOHNRYDNRMLPRGLILNXMXWRNEROHVWL/07%QLMHSRVWLJQXWRGJRYDUDMXüL
NOLQLþNLRGJRYRUWMSREROMãDQMH'$6VNRUD]DQDMPDQMHLOLYLãHLOLREROHOLLGDOMHLPMXYLVRNXDNWLYQRVWEROHVWL'$6YHüLRGLOLSRVWRMHHOHPHQWL
nepodnošljivosti LMTB;
$QNLOR]LUDMXüLVSRQGLOLWLV0XNROLNRMHLVSXQMHQMHGDQRGNULWHULMXPD
DLQWROHUDQFLMDLOLQHHILNDVQRVWSRMHGLQDþQHSULPHQHQDMPDQMHGYDQHVWHURLGQDDQWLLQIODPDWRUQDOHND16$,/XPDNVLPDOQRMSUHSRUXþHQRMGR]LXWRNXRG
SRWULPHVHFDDXNXSQRWUDMDQMHOHþHQMDRGQDMPDQMHãHVWPHVHFLLOL
INDIKACIJE
b) prisustvo perifernog artritisa i intolerancije ili neefikasnosti nakon primene najmanje dva nesteroidna antiinflamatorna leka (NSAIL), u maksimalnoj
SUHSRUXþHQRMGR]LXWRNXRGSRWULPHVHFDX]VXOIDVDOD]LQDXXNXSQRPWUDMDQMXOHþHQMDRGQDMPDQMHãHVWPHVHFL
3VRULMD]QLDUWULWLV0XNROLNRMHLVSXQMHQNULWHULMXPGDSRVWRMLSULVXVWYRDNWLYQH]JOREQHEROHVWLWULLOLYLãHEROQLKRWHþHQLK]JORERYDSULOLNRPGYDSUHJOHGDX
LQWHUYDOXRGPHVHFGDQDXSUNRVSULPHQLSUHWKRGQRJOHþHQMDVDQDMPDQMHMHGQLPLOLNRPELQDFLMRPYLãHOHNRYDNRMLPRGLILNXMXWRNEROHVWL/07%XWRNXãHVWPHVHFL
terapije;
=DOHþHQMHWHãNRJREOLNDDNWLYQH&URKQRYHEROHVWL.NRGEROHVQLNDNRGNRMLKSUHWKRGQROHþHQMHNRUWLNRVWHURLGLPDLLPXQRVXSUHVLYLPDQLMHGDOR
]DGRYROMDYDMXüLRGJRYRULOLSRVWRMLNRQWUDLQGLNDFLMD]DSRPHQXWXNRQYHQFLRQDOQXWHUDSLMX
NAPOMENA
Lek se uvodi u terapiju na osnovu mišljenja Komisije RFZO.
Lista C - Grupa L. Lekovi sa posebnim režimom izdavanja
JKL
0014205
ATC
L04AB06
L04AB06
INDIKACIJE
NAPOMENA
L04AC
L04AC07
INN
golimumab
golimumab
=DãWLüHQRLPHOHND
SIMPONI
3DNRYDQMHLMDþLQD
leka
1D]LYSURL]YRÿDþD
leka
Država
proizvodnje
leka
Cena leka na
veliko za
pakovanje
DDD
rastvor za injekciju
napunjen injekcioni
u napunjenom
šprica, 1 po 0,5 ml (50
injekcionom špricu
mg/0,5 ml)
Janssen Biologics B.V.
Holandija
106.784,32
1,66 mg
FO
Cena leka Participacija
na veliko osiguranog
po DDD
lica
3.545,24
3VRULMD]QLDUWULWLV0XNROLNRMHLVSXQMHQNULWHULMXPGDSRVWRMLSULVXVWYRDNWLYQH]JOREQHEROHVWLWULLOLYLãHEROQLKRWHþHQLK]JORERYDSULOLNRPGYDSUHJOHGDX
LQWHUYDOXRGPHVHFGDQDXSUNRVSULPHQLSUHWKRGQRJOHþHQMDVDQDMPDQMHMHGQLPLOLNRPELQDFLMRPYLãHOHNRYDNRMLPRGLILNXMXWRNEROHVWL/07%XWRNXãHVWPHVHFL
terapije;
5HXPDWRLGQLDUWULWLV0L0XNROLNRMHLVSXQMHQNULWHULMXPGDSRVOHPHVHFLSULPHQHOHNRYDNRMLPRGLILNXMXWRNEROHVWL/07%QLMHSRVWLJQXWRGJRYDUDMXüL
NOLQLþNLRGJRYRUWMSREROMãDQMH'$6VNRUD]DQDMPDQMHLOLYLãHLOLREROHOLLGDOMHLPDMXYLVRNXDNWLYQRVWERHOVWL'$6YHüLRGLOLSRVWRMHHOHPHQWL
nepodnošljivosti LMTB;
$QNLOR]LUDMXüLVSRQGLOLWLV0XNROLNRMHLVSXQMHQMHGDQRGNULWHULMXPD
DLQWROHUDQFLMDLOLQHHILNDVQRVWSRMHGLQDþQHSULPHQHQDMPDQMHGYDQHVWHURLGQDDQWLLQIODPDWRUQDOHND16$,/XPDNVLPDOQRMSUHSRUXþHQRMGR]LXWRNXRG
SRWULPHVHFDDXNXSQRWUDMDQMHOHþHQMDRGQDMPDQMHãHVWPHVHFLLOL
b) prisustvo perifernog artritisa i intolerancije ili neefikasnosti nakon primene najmanje dva nesteroidna antiinflamatorna leka (NSAIL), u maksimalnoj
SUHSRUXþHQRMGR]LXWRNXRGSRWULPHVHFDX]VXOIDVDOD]LQDXXNXSQRPWUDMDQMXOHþHQMDRGQDMPDQMHãHVWPHVHFL
Lek se uvodi u terapiju na osnovu mišljenja Komisije RFZO.
Inhibitori interleukina
tocilizumab
0014400
L04AC07
tocilizumab
ACTEMRA
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
ml (80 mg/4 ml)
Roche Pharma AG
1HPDþND
13.660,40
-
-
-
0014401
L04AC07
tocilizumab
ACTEMRA
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
10 ml (200 mg/10 ml)
Roche Pharma AG
1HPDþND
34.144,50
-
-
-
0014402
L04AC07
tocilizumab
ACTEMRA
koncentrat za
rastvor za infuziju
ERþLFDVWDNOHQDSR
20 ml (400 mg/20 ml)
Roche Pharma AG
1HPDþND
69.068,20
-
-
-
INDIKACIJE
NAPOMENA
$NWLYQDVLVWHPVNDIRUPDMXYHQLOQRJKURQLþQRJDUWULWLVD00NRGSDFLMHQDWDX]UDVWDRGJRGLQHLVWDULMLKNRMLQLVXLPDOL]DGRYROMDYDMXüLWHUDSLMVNL
odgovor na primenu nesteroidnih antiinflamatornih lekova (NSAIL) i kortikosteroida.
5HXPDWRLGQLDUWULWLV0L0XNROLNRMHLVSXQMHQNULWHULMXPGDSRVOHPHVHFLSULPHQHOHNRYDNRMLPRGLILNXMXWRNEROHVWL/07%QLMHSRVWLJQXWRGJRYDUDMXüL
NOLQLþNLRGJRYRUWMSREROMãDQMH'$6VNRUD]DQDMPDQMHLOLYLãHLOLREROHOLLGDOMHLPDMXYLVRNXDNWLYQRVWEROHVWL'$6YHüLRGLOLSRVWRMHHOHPHQWL
nepodnošljivosti LMTB.
STAC; Lek se uvodi u terapiju na osnovu mišljenja Komisije RFZO.
Lista C - Grupa M. Lekovi sa posebnim režimom izdavanja
JKL
0059062
ATC
INN
M
M05
M05B
M05BA
M05BA02 klodronska kiselina
M05BA02
INDIKACIJE
klodronska kiselina
=DãWLüHQRLPH
leka
BONEFOS
Država
Cena leka
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD proizvodnje na veliko za
FO
leka
leka
leka
pakovanje
0,â,û12.2671,6,67(0/(.29,=$%2/(67,0,â,û12.26712*6,67(0$
LEKOVI U TERAPIJI OBOLJENJA KOSTIJU
Lekovi koji deluju na strukturu kosti i mineralizaciju
Bisfosfonati
koncentrat za rastvor ampula, 5 po 5 ml (60
za infuziju
mg/1 ml)
Bayer OY
Finska
6.689,50
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
1,5 g
6.689,50
-
1. Humoralna hiperkalcemija u malignitetu (HHM) preko 3,0 mmol/l, primena i održavanje normokalcemije tokom narednih šest meseci;
2. Hiperkalcemije preko 3.0 mmol/l;
3. Hiperkalcemijska koma.
STAC; Lek se uvodi u terapiju na osnovu mišljenja tri lekara zdravstvene ustanove koja obavlja zdravstvenu delatnost na sekundarnom ili teracijarnom nivou
zdravstvene zaštite.
NAPOMENA
M05BA03 pamidronska kiselina
0059102
0059300
0059301
0059302
0059105
M05BA03
pamidronska
kiselina
M05BA03
pamidronska
kiselina
M05BA03
pamidronska
kiselina
M05BA03
pamidronska
kiselina
M05BA03
INDIKACIJE
NAPOMENA
pamidronska
kiselina
AREDIA
OLRERþLFDVD
SUDãDNLUDVWYDUDþ]D UDVWYDUDþHPSR
rastvor za infuziju
ml (30 mg)
Novartis Pharma AG
Švajcarska
5.024,90
60 mg
5.024,90
-
PAMITOR
koncentrat za rastvor ampula, 1 po 2 ml (15
za infuziju
mg/ml)
Chiesi
Pharmaceuticals
GmbH
Austrija
2.512,40
60 mg
5.024,80
-
PAMITOR
koncentrat za rastvor ampula, 1 po 4 ml (15
za infuziju
mg/ml)
Chiesi
Pharmaceuticals
GmbH
Austrija
5.024,90
60 mg
5.024,90
-
PAMITOR
koncentrat za rastvor ampula, 1 po 6 ml (15
za infuziju
mg/ml)
Chiesi
Pharmaceuticals
GmbH
Austrija
7.537,40
60 mg
5.024,93
-
HIDENSIL
OLRERþLFDVD
UDVWYDUDþHPXDPSXOL
SUDãDNLUDVWYDUDþ]D 2 po 10 ml (30 mg/10
rastvor za infuziju
ml)
Vipharm S.A.
Poljska
5.024,90
60 mg
5.024,90
-
1. Humoralna hiperkalcemija u malignitetu ( HHM ) preko 3,0 mmol/l, primena i održavanje normokalcemije tokom narednih šest meseci;
2. Hiperkalcemije preko 3.0 mmol/l;
3. Hiperkalcemijska koma.
STAC; Lek se uvodi u terapiju na osnovu mišljenja tri lekara zdravstvene ustanove koja obavlja zdravstvenu delatnost na sekundarnom ili teracijarnom nivou
zdravstvene zaštite.
Lista C - Grupa M. Lekovi sa posebnim režimom izdavanja
JKL
0059083
ATC
INN
M05BA06 ibandronat
M05BA06
ibandronat
=DãWLüHQRLPH
leka
FO
3DNRYDQMHLMDþLQD 1D]LYSURL]YRÿDþD
leka
leka
Cena leka
na veliko za
pakovanje
DDD
Cena leka
na veliko
po DDD
Participacija
osiguranog
lica
BONDRONAT
koncentrat za rastvor ERþLFDVWDNOHQDSR
za infuziju
mg/2 ml
Roche Diagnostics
GmbH
1HPDþND
10.236,40
6 mg
30.709,20
-
Roche Diagnostics
GmbH
1HPDþND
23.101,60
6 mg
23.101,60
-
Roche Diagnostics
GmbH
1HPDþND
115.507,70
6 mg
23.101,54
-
0059086
M05BA06
ibandronat
BONDRONAT
koncentrat za rastvor ERþLFDVWDNOHQDSR
za infuziju
mg/6 ml
0059087
M05BA06
ibandronat
BONDRONAT
koncentrat za rastvor ERþLFDVWDNOHQDSR
za infuziju
mg/6 ml
INDIKACIJE
Država
proizvodnje
leka
1. Humoralna hiperkalcemija u malignitetu ( HHM ) preko 3,0 mmol/l, primena i održavanje normokalcemije tokom narednih šest meseci;
2. Hiperkalcemije preko 3.0 mmol/l;
3. Hiperkalcemijska koma.
STAC; Lek se uvodi u terapiju na osnovu mišljenja tri lekara zdravstvene ustanove koja obavlja zdravstvenu delatnost na sekundarnom ili teracijarnom nivou
NAPOMENA
zdravstvene zaštite.
M05BA08 zoledronska kiselina
0059211
M05BA08
zoledronska kiselina ZOMETA
prašak za rastvor za
infuziju
0059222
M05BA08
ZOLEDRONATE
zoledronska kiselina PHARMASWISS
koncentrat za rastvor ERþLFDVWDNOHQDSR
za infuziju
ml (4 mg/5 ml)
PharmaSwiss d.o.o.
INDIKACIJE
NAPOMENA
1 po 4 mg+ 5 ml
UDVWYDUDþD
Novartis Pharma Stein
AG
Švajcarska
19.415,50
4 mg
19.415,50
-
Republika Srbija
19.415,50
4 mg
19.415,50
-
1. Humoralna hiperkalcemija u malignitetu ( HHM ) preko 3,0 mmol/l, primena i održavanje normokalcemije tokom narednih šest meseci;
2. Hiperkalcemije preko 3.0 mmol/l;
3. Hiperkalcemijska koma.
STAC; Lek se uvodi u terapiju na osnovu mišljenja tri lekara zdravstvene ustanove koja obavlja zdravstvenu delatnost na sekundarnom ili teracijarnom nivou
zdravstvene zaštite.
Lista C - Grupa N. Lekovi sa posebnim režimom izdavanja
JKL
1079070
ATC
N
N07
N07X
N07XX
N07XX02
riluzol
N07XX02
riluzol
INDIKACIJE
NAPOMENA
INN
=DãWLüHQRLPHOHND
RILUTEK
FO
Cena leka na
Pakovanje i
1D]LYSURL]YRÿDþD
Država
veliko za
MDþLQDOHND
leka
proizvodnje leka pakovanje
NERVNI SISTEM (LEKOVI KOJI DELUJU NA NERVNI SISTEM)
OSTALI LEKOVI KOJI DELUJU NA NERVNI SISTEM
Ostali lekovi koji deluju na nervni sistem
Ostali lekovi koji deluju na nervni sistem
film tableta
blister, 56 po 50 mg
Sanofi Winthrope
Industrie
Francuska
20.501,20
DDD
0,1 g
Cena leka na Participacija
veliko po
osiguranog
DDD
lica
732,19
-
$PLRWURILþQDODWHUDOQDVNOHUR]D$0/*
Lek se uvodi u terapiju na osnovu mišljenja tri lekara neurologa ili neuropsihijatra Klinike za neurologiju KCS kod pacijenata koji nisu respiratorno ugroženi.
Lista D- Lekovi koji nemaju dozvolu za stavljanje u promet u Republici Srbiji, a neophodni su u dijagnostici i terapiji - neregistrovani lekovi
ŠIFRA LEKA
ATC
A
INN
N002410
N002451
N002709
N001016
N001024
A02AB01
A03BA01
A12AA02
A12CB01
A12CC02
B
aluminium hydroxide
atropine sulfate
calcium gluconate
zinc sulfate
magnesium sulfate
N003616
B01AB01
heparin ͼ
N003541
N001032
N001040
N002469
B01AA07
B02AA02
B02AA02
B02BX01
acenokumarol ͼ
traneksaminska kiselina
traneksaminska kiselina ͼ
etamsylate
N002113
N002105
B03AC07
B05BA03
sodium ferric gluconate complex
glucose
N003624
N003632
kalijum hlorid ͼ
natrijum hidrogenkarbonat ͼ
N001065
N001073
N002477
N001081
N001099
N001107
N003914
N002683
N003004
N003038
B05XA01
B05XA02
C
C01BA01
C01BA02
C01BC03
C01CA02
C01CA03
C01CA06
C01CA24
C01DA02
C01DA02
C01DA02
quinidine sulfat
procainamide hydrochloride
propafenon
isoprenaline
noradrenalin
phenilephrin
adrenalin hidrohlorid (epinefrin) ͼ
glyceryl trinitrate
glyceryl trinitrate ͼ
glyceryl trinitrate
N003012
N003491
N003509
C01DA02
C01DX12
C01DX12
glyceryl trinitrate ͼ
molsidomin ͼ
molsidomin
FO
-$ý,1$/(.$
tableta
injekcija
injekcija
tableta
infuzija
500 mg
1 mg/1 ml
10% a 10 ml
20 mg
20% a 100 ml
rastvor za injekciju
5000 I.J./0,25 ml
tableta
tableta
injekcija
injekcija
4 mg
500 mg
100 mg/ml
250 mg/2 ml
injekcija
rastvor za infuziju
koncentrat za rastvor
za infuziju
rastvor za infuziju
62,5 mg/5 ml
50%
tableta
injekcija
injekcija
injekcija
injekcija
injekcija
rastvor za injekciju
sublingvalna tableta
rastvor za injekciju
rastvor za infuziju
koncentrat za rastvor
za infuziju
tableta
tableta
200 mg
100 mg/ml
35 mg/10 ml
10 mg/5 ml
1 mg/ml
10 mg/ml
1 mg/ml
500 mcg
1 mg
1 mg
1mmol/ml
8,4%
5 mg
2 mg
4 mg
INDIKACIJE
Terapija hiperfosfatemije u
OHþHQMXUHQDOQHRVWHRSDWLMHNRG
EROHVQLNDVDKURQLþQRP
insuficijencijom bubrega.
Willson-ova bolest
Lista D- Lekovi koji nemaju dozvolu za stavljanje u promet u Republici Srbiji, a neophodni su u dijagnostici i terapiji - neregistrovani lekovi
ŠIFRA LEKA
ATC
INN
N003517
N002311
N001115
N001123
N001131
C01DX12
C01EA01
C02DA01
C02DA01
C02DD01
molsidomin ͼ
alprostadil
diazoksid
diazoksid
natrijum nitroprusid
N003178
C03CA01
furosemid ͼ
N003186
N001149
N001156
N001164
N002626
C03CA01
C03DB01
C04AX02
C04AX02
C10AC01
D
D05BA02
G
furosemid ͼ
amilorid
phenoxybenzamin
phenoxybenzamin
colestyramine
N002485
methoxsalen
FO
-$ý,1$/(.$
tableta sa produženim
RVOREDÿDQMHP
injekcija
kapsula
injekcija
injekcija
8 mg
500 mcg
25 mg
15 mg/ml
50 mg
tableta
40 mg
-
rastvor za injekciju
tableta
kapsula
injekcija
prasak
20 mg/2ml
5 mg
10 mg
50 mg/ml
4g
-
tableta
10 mg
N002949
G02CB03
cabergolin
tableta
0,5 mg
N003210
G03GB02
klomifen
tableta
50 mg
N003277
G04BE03
H
H01AA01
H01AA02
sildenafil
tableta
20 mg
injekcija
injekcija
25 IU
1 mg/ml
N001206
N001214
corticotrophin-releasing factor-CRF
tetrakosartid
INDIKACIJE
Tumori hipofize - za osobe koje
imju izražene neželjne efekte na
prethodnu terapiju
bromokriptinom.lek se uvodi u
terapiju na osnvu konzilijarnog
mišljenja tri lekara endokrinologa
zdravstvene ustanove koja
obavlja zdravstvenu delatnost na
tercijarnom nivou zdravstvene
zaštite.
Za indukciju ovulacije kod
anovulatorne i oligoovulatorne
neplodnosti kod žena ( N97 ).
3OXüQDKLSHUWHQ]LMDQDRVQRYX
mišljenja tri lekara zdravstvene
ustanove tercijarnog nivoa
zdravstvene zaštite.
Lista D- Lekovi koji nemaju dozvolu za stavljanje u promet u Republici Srbiji, a neophodni su u dijagnostici i terapiji - neregistrovani lekovi
dezmopresin
dezmopresin
gonadorelin
fludrocortizon
hidrokortizon
hidrokortizon ͼ
hidrokortizon ͼ
FO
injekcija
injekcija
injekcija
tableta
tablete
prašak za injekciju
prašak za injekciju
-$ý,1$/(.$
4 mcg/1ml
20 mcg/1ml
100 mcg
0,1 mg
10 mg
100 mg
500 mg
J01CE08
J01CE08
J01CF02
J01EC02
J01FA01
J01GA01
J01GB04
J02AA01
J02AA01
J04AA01
J04AA01
J04AB01
hloramfenikol
benzilpenicilin
benzilpenicilin
benzatinbenzilpenicilin
benzatinbenzilpenicilin
cloxacillin
sulfadiazin
eritromicin
streptomycin sulfat
kanamycin
amfotericin B
amfotericin B (sa liposomima)
p - aminosalicylici acid
p - aminosalicylici acid
cycloserine
injekcija
prašak za injekciju
prašak za injekciju
injekcija
injekcija
injekcija
tableta
injekcija
prašak za injekciju
injekcija
rastvor za infuziju
injekcija
tableta
granula
kapsula ili tableta
1000 mg
1 MIU
5 MIU
1,2 MIU
2,4 MIU
500 mg
500 mg
1000 mg
1g
1000 mg
50 mg
50 mg
500 mg
4g
250 mg
N002329
J04AB02
rifampicin
kapsula ili tableta
150 mg
N002170
N002337
N002519
N002188
N002196
N001347
N001354
N002675
J04AB30
J04AC01
J04AC01
J04AD03
J04AD03
J04AK01
J04AK02
J04BA02
capreomycin
izoniazid
izoniazid
ethionamide
ethionamide
pyrazinamide
etambutol
dapsone
injekcija
tableta
tableta
tableta
tableta
tableta
tableta
tablete
1000 mg
100 mg
300 mg
125 mg
250 mg
400 mg
400 mg
50 mg
ŠIFRA LEKA
N002493
N002501
N001222
N001263
N002634
N002923
N002931
N002121
N002907
N002915
N001289
N001297
N001305
N001313
N001321
N002865
N002139
N002733
N001339
N002147
N002154
N002162
ATC
H01BA02
H01BA02
H01CA01
H02AA02
H02AB09
H02AB09
H02AB09
J
J01BA01
J01CA01
J01CA01
INN
INDIKACIJE
Tuberkuloza (A15)
Lista D- Lekovi koji nemaju dozvolu za stavljanje u promet u Republici Srbiji, a neophodni su u dijagnostici i terapiji - neregistrovani lekovi
ŠIFRA LEKA
N002741
N002758
N002766
N002774
ATC
J05AE03
J05AE07
J05AE09
J05AE..
INN
ritonavir
fosamprenavir
tipranavir
lopinavir, ritonavir
FO
oralni rastvor
oralna suspenzija
oralni rastvor
oralni rastvor
-$ý,1$/(.$
INDIKACIJE
80 mg/ml
HIV infekcija ( B20; B21; B22; B23;
B24 ). Lek se uvodi u terapiju na
osnovu mišljenja: Klinike za
infektivne i tropske bolesti KCS,
Klinike za infektivne bolesti KC Niš,
Klinike za infektivne bolesti KC
Vojvodine, Klinike za infektivne
bolesti KC Kragujevac.
50 mg/ml
HIV infekcija ( B20; B21; B22; B23;
B24 ). Lek se uvodi u terapiju na
osnovu mišljenja: Klinike za
infektivne i tropske bolesti KCS,
Klinike za infektivne bolesti KC Niš,
Klinike za infektivne bolesti KC
Vojvodine, Klinike za infektivne
bolesti KC Kragujevac.
100 mg/ml
HIV infekcija ( B20; B21; B22; B23;
B24 ). Lek se uvodi u terapiju na
osnovu mišljenja: Klinike za
infektivne i tropske bolesti KCS,
Klinike za infektivne bolesti KC Niš,
Klinike za infektivne bolesti KC
Vojvodine, Klinike za infektivne
bolesti KC Kragujevac.
HIV infekcija ( B20; B21; B22; B23;
B24 ). Lek se uvodi u terapiju na
osnovu mišljenja: Klinike za
infektivne i tropske bolesti KCS,
Klinike za infektivne bolesti KC Niš,
Klinike za infektivne bolesti KC
Vojvodine, Klinike za infektivne
80 mg/ml + 20 mg/ml bolesti KC Kragujevac.
Lista D- Lekovi koji nemaju dozvolu za stavljanje u promet u Republici Srbiji, a neophodni su u dijagnostici i terapiji - neregistrovani lekovi
ŠIFRA LEKA
N003020
N002782
N002808
N002816
N001362
N002204
ATC
J05AF01
J05AF04
J05AF05
J05AF06
J06AA01
J06AA01
INN
zidovudin
stavudin
lamivudin
abakavir
diphtheria antitoxin
diphtheria antitoxin
FO
oralni rastvor
prašak za oralnu
suspenziju
oralni rastvor
oralni rastvor
injekcija
injekcija
-$ý,1$/(.$
INDIKACIJE
50 mg/5 ml
HIV infekcija ( B20; B21; B22; B23;
B24 ). Lek se uvodi u terapiju na
osnovu mišljenja: Klinike za
infektivne i tropske bolesti KCS,
Klinike za infektivne bolesti KC Niš,
Klinike za infektivne bolesti KC
Vojvodine, Klinike za infektivne
bolesti KC Kragujevac.
1 mg/ml
HIV infekcija ( B20; B21; B22; B23;
B24 ). Lek se uvodi u terapiju na
osnovu mišljenja: Klinike za
infektivne i tropske bolesti KCS,
Klinike za infektivne bolesti KC Niš,
Klinike za infektivne bolesti KC
Vojvodine, Klinike za infektivne
bolesti KC Kragujevac.
10 mg/ml
HIV infekcija ( B20; B21; B22; B23;
B24 ). Lek se uvodi u terapiju na
osnovu mišljenja: Klinike za
infektivne i tropske bolesti KCS,
Klinike za infektivne bolesti KC Niš,
Klinike za infektivne bolesti KC
Vojvodine, Klinike za infektivne
bolesti KC Kragujevac.
20 mg/ml
10000 IU
20000 IU
HIV infekcija ( B20; B21; B22; B23;
B24 ). Lek se uvodi u terapiju na
osnovu mišljenja: Klinike za
infektivne i tropske bolesti KCS,
Klinike za infektivne bolesti KC Niš,
Klinike za infektivne bolesti KC
Vojvodine, Klinike za infektivne
bolesti KC Kragujevac.
Lista D- Lekovi koji nemaju dozvolu za stavljanje u promet u Republici Srbiji, a neophodni su u dijagnostici i terapiji - neregistrovani lekovi
N001396
N002212
N001404
N002220
N001412
N002238
N001438
N001446
N001453
ATC
L
L01AA01
L01AA02
L01AA03
L01AA03
L01AA05
L01AB01
L01AC01
L01AD01
L01AD02
cyclophosphamide
hlorambucil
melphalan
melphalan
chlormethine(cariolyzin)
busulfan
thiotepa
karmustin
lomustin
N002964
L01AX04
dakarbazin
N002972
N002246
L01AX04
L01BB02
dakarbazin
merkaptopurin
ŠIFRA LEKA
INN
N003525
L01BB03
tioguanin
N003111
L01BC02
N003129
FO
-$ý,1$/(.$
tableta
tableta
injekcija
tableta
injekcija
tableta
injekcija
injekcija
tableta
prašak za rastvor za
injekciju/infuziju
prašak za rastvor za
injekciju/infuziju
tableta
50 mg
2 mg
50 mg
2 mg
10 mg
2 mg
15 mg
100 mg
40 mg
100 mg
200 mg
50 mg
tableta
40 mg
fluorouracil ͼ
rastvor za injekciju
50 mg/ml
L01BC02
fluorouracil ͼ
koncentrat za rastvor
za injekciju/infuziju
250 mg/5 ml
N003137
L01BC02
fluorouracil ͼ
koncentrat za rastvor
za injekciju/infuziju
500 mg/10 ml
N003152
L01BC02
fluorouracil
rastvor za
injekciju/infuziju
1000 mg/20 ml
N003202
L01BC02
fluorouracil
rastvor za
injekciju/infuziju
5000 mg/100 ml
N001479
L01DA01
daktinomicin
N003467
L01DB07
mitoksantron ͼ
injekcija
koncentrat za rastvor
za infuziju
INDIKACIJE
0,5 mg
10 mg/5 ml
Akutna leukemija, limfoblastni
limfom kod dece i odraslih
(C91.0; C92.0; C83.5)
Lista D- Lekovi koji nemaju dozvolu za stavljanje u promet u Republici Srbiji, a neophodni su u dijagnostici i terapiji - neregistrovani lekovi
ŠIFRA LEKA
ATC
INN
FO
-$ý,1$/(.$
koncentrat za rastvor
za infuziju
20 mg/10 ml
N003475
L01DB07
mitoksantron ͼ
N002428
L01DC03
mitomicin
prašak za injekciju
1 po 5 mg
N002527
L01DC03
mitomicin
prašak za injekciju
1 po 10 mg
N002436
N001487
N001495
N001503
N002253
L01DC03
L01XB01
L01XX02
L01XX23
L02AB02
mitomicin
procarbazine hydrochloride
l-asparaginase
mitotane
medroksiprogesteron
prašak za injekciju
kapsula
injekcija
tableta
tableta
1 po 20 mg
50 mg
10000 IU
500 mg
100 mg
N003608
N002360
L03AX03
L04AX02
M
M01CC01
M03AC01
prašak za
intravezikalni rastvor
tableta
1x12,5mg/2-8x108
CFU
100 mg
kapsula
rastvor za injekciju
250 mg
4 mg/2 ml
N001511
N003145
N003285
N003293
M03BX01
M03BX01
atenuirani bacili Mycobacterium bovis, soj
BCG ͼ
thalidomide
penicillamine
pankuronijum ͼ
baclofen
baclofen
tableta
tableta
INDIKACIJE
Karcinom nadbubrežne žlezde
Multipli mijelom
Willson-ova bolest
5 mg
6SD]PLNRGGUXJLKR]QDþHQLK
degenerativnih bolesti nervnog
sistema (G31.8) udruženih sa
SURJUHVLYQRPPLRNORQLþQRP
epilepsijom (G40). Lek se uvodi u
terapiju na osnovu mišljenja tri
lekara zdravstvene ustanove koja
obavlja zdravstvenu delatnost na
tercijarnom nivou zdravstvene
zaštite.
10 mg
6SD]PLNRGGUXJLKR]QDþHQLK
degenerativnih bolesti nervnog
sistema (G31.8) udruženih sa
SURJUHVLYQRPPLRNORQLþQRP
epilepsijom (G40). Lek se uvodi u
terapiju na osnovu mišljenja tri
lekara zdravstvene ustanove koja
obavlja zdravstvenu delatnost na
tercijarnom nivou zdravstvene
zaštite.
Lista D- Lekovi koji nemaju dozvolu za stavljanje u promet u Republici Srbiji, a neophodni su u dijagnostici i terapiji - neregistrovani lekovi
ŠIFRA LEKA
N003301
N003319
N003327
N001529
N001537
N001545
N001552
N001560
N001610
ATC
M03BX01
M03BX01
M03BX01
M09AA01
N
N01AF03
N01AX03
N01BB02
N01BB52
N03AB02
INN
baclofen
baclofen
FO
tableta
injekcija
-$ý,1$/(.$
INDIKACIJE
25 mg
6SD]PLNRGGUXJLKR]QDþHQLK
degenerativnih bolesti nervnog
sistema (G31.8) udruženih sa
SURJUHVLYQRPPLRNORQLþQRP
epilepsijom (G40). Lek se uvodi u
terapiju na osnovu mišljenja tri
lekara zdravstvene ustanove koja
obavlja zdravstvenu delatnost na
tercijarnom nivou zdravstvene
zaštite.
0,05 mg
6SD]PLNRGGUXJLKR]QDþHQLK
degenerativnih bolesti nervnog
sistema (G31.8) udruženih sa
SURJUHVLYQRPPLRNORQLþQRP
epilepsijom (G40). Lek se uvodi u
terapiju na osnovu mišljenja tri
lekara zdravstvene ustanove koja
obavlja zdravstvenu delatnost na
tercijarnom nivou zdravstvene
zaštite.
baclofen
quinine dihydrochloride
infuzija
injekcija
0,05 mg/2 ml
600 mg/2 ml
thiopenthal
ketamin
lidocain
lidocain, epinephrin
phenytoin
injekcija
injekcija
sprej
krema
injekcija
0,5 g
50 mg/1 ml
10%
2,50%
250 mg
6SD]PLNRGGUXJLKR]QDþHQLK
degenerativnih bolesti nervnog
sistema (G31.8) udruženih sa
SURJUHVLYQRPPLRNORQLþQRP
epilepsijom (G40). Lek se uvodi u
terapiju na osnovu mišljenja tri
lekara zdravstvene ustanove koja
obavlja zdravstvenu delatnost na
tercijarnom nivou zdravstvene
zaštite.
Lista D- Lekovi koji nemaju dozvolu za stavljanje u promet u Republici Srbiji, a neophodni su u dijagnostici i terapiji - neregistrovani lekovi
ŠIFRA LEKA
N001628
N001636
N001644
N002543
N003335
N003343
ATC
N03AB02
N03AB02
N03AB02
N03AG04
N03AX03
N03AX03
INN
phenytoin
phenytoin
phenytoin
vigabatrin
sultiame
sultiame
FO
kapsula ili tableta
kapsula ili tableta
kapsula ili tableta
kapsula
tableta
tableta
-$ý,1$/(.$
25 mg
50 mg
100 mg
INDIKACIJE
500 mg
Epilepsija na osnovu mišljenja tri
lekara zdravstvene ustanove
tercijarnog nivoa zdravstvene
zaštite
50 mg
3URJUHVLYQDPLRNORQLþQD
epilepsija (G40) udružena sa
GUXJLPR]QDþHQLP
degenerativnim bolestima
nervnog sistema (G31.8). Lek se
uvodi u terapiju na osnovu
mišljenja tri lekara zdravstvene
ustanove koja obavlja
zdravstvenu delatnost na
tercijarnom nivou zdravstvene
zaštite.
200 mg
3URJUHVLYQDPLRNORQLþQD
epilepsija (G40) udružena sa
GUXJLPR]QDþHQLP
degenerativnim bolestima
nervnog sistema (G31.8). Lek se
uvodi u terapiju na osnovu
mišljenja tri lekara zdravstvene
ustanove koja obavlja
zdravstvenu delatnost na
tercijarnom nivou zdravstvene
zaštite.
Lista D- Lekovi koji nemaju dozvolu za stavljanje u promet u Republici Srbiji, a neophodni su u dijagnostici i terapiji - neregistrovani lekovi
ŠIFRA LEKA
ATC
INN
FO
-$ý,1$/(.$
N003350
N03AX15
zonisamid
orodisperzibilna
tableta
25 mg
N003368
N03AX15
zonisamid
orodisperzibilna
tableta
50 mg
N003376
N03AX15
zonisamid
orodisperzibilna
tableta
100mg
INDIKACIJE
3URJUHVLYQDPLRNORQLþQD
epilepsija (G40) udružena sa
GUXJLPR]QDþHQLP
degenerativnim bolestima
nervnog sistema (G31.8). Lek se
uvodi u terapiju na osnovu
mišljenja tri lekara zdravstvene
ustanove koja obavlja
zdravstvenu delatnost na
tercijarnom nivou zdravstvene
zaštite.
3URJUHVLYQDPLRNORQLþQD
epilepsija (G40) udružena sa
GUXJLPR]QDþHQLP
degenerativnim bolestima
nervnog sistema (G31.8). Lek se
uvodi u terapiju na osnovu
mišljenja tri lekara zdravstvene
ustanove koja obavlja
zdravstvenu delatnost na
tercijarnom nivou zdravstvene
zaštite.
3URJUHVLYQDPLRNORQLþQD
epilepsija (G40) udružena sa
GUXJLPR]QDþHQLP
degenerativnim bolestima
nervnog sistema (G31.8). Lek se
uvodi u terapiju na osnovu
mišljenja tri lekara zdravstvene
ustanove koja obavlja
zdravstvenu delatnost na
tercijarnom nivou zdravstvene
zaštite.
Lista D- Lekovi koji nemaju dozvolu za stavljanje u promet u Republici Srbiji, a neophodni su u dijagnostici i terapiji - neregistrovani lekovi
ŠIFRA LEKA
ATC
INN
N003384
N001677
N003079
N03AX15
N05AA02
N05AN01
zonisamid
levomepromazin
litijum karbonat ͼ
N002956
N05BA09
clobazam
N003392
N05BA09
clobazam
FO
-$ý,1$/(.$
orodisperzibilna
tableta
tableta
kapsula
300 mg
100 mg
300 mg
tableta
10 mg
Epilepsija (G40)
20 mg
3URJUHVLYQDPLRNORQLþQD
epilepsija (G40) udružena sa
GUXJLPR]QDþHQLP
degenerativnim bolestima
nervnog sistema (G31.8). Lek se
uvodi u terapiju na osnovu
mišljenja tri lekara zdravstvene
ustanove koja obavlja
zdravstvenu delatnost na
tercijarnom nivou zdravstvene
zaštite.
tableta
INDIKACIJE
3URJUHVLYQDPLRNORQLþQD
epilepsija (G40) udružena sa
GUXJLPR]QDþHQLP
degenerativnim bolestima
nervnog sistema (G31.8). Lek se
uvodi u terapiju na osnovu
mišljenja tri lekara zdravstvene
ustanove koja obavlja
zdravstvenu delatnost na
tercijarnom nivou zdravstvene
zaštite.
Lista D- Lekovi koji nemaju dozvolu za stavljanje u promet u Republici Srbiji, a neophodni su u dijagnostici i terapiji - neregistrovani lekovi
ŠIFRA LEKA
N003400
N003418
N003426
ATC
N05CC01
N05CC01
N05CC01
INN
chloralhydrate
chloralhydrate
chloralhydrate
FO
oralni rastvor
kapsula
kapsula
-$ý,1$/(.$
INDIKACIJE
100 mg/ml
3URJUHVLYQDPLRNORQLþQD
epilepsija (G40) udružena sa
GUXJLPR]QDþHQLP
degenerativnim bolestima
nervnog sistema (G31.8). Lek se
uvodi u terapiju na osnovu
mišljenja tri lekara zdravstvene
ustanove koja obavlja
zdravstvenu delatnost na
tercijarnom nivou zdravstvene
zaštite.
250 mg
3URJUHVLYQDPLRNORQLþQD
epilepsija (G40) udružena sa
GUXJLPR]QDþHQLP
degenerativnim bolestima
nervnog sistema (G31.8). Lek se
uvodi u terapiju na osnovu
mišljenja tri lekara zdravstvene
ustanove koja obavlja
zdravstvenu delatnost na
tercijarnom nivou zdravstvene
zaštite.
500 mg
3URJUHVLYQDPLRNORQLþQD
epilepsija (G40) udružena sa
GUXJLPR]QDþHQLP
degenerativnim bolestima
nervnog sistema (G31.8). Lek se
uvodi u terapiju na osnovu
mišljenja tri lekara zdravstvene
ustanove koja obavlja
zdravstvenu delatnost na
tercijarnom nivou zdravstvene
zaštite.
Lista D- Lekovi koji nemaju dozvolu za stavljanje u promet u Republici Srbiji, a neophodni su u dijagnostici i terapiji - neregistrovani lekovi
ŠIFRA LEKA
N003434
ATC
N06BX03
INN
piracetam
N003442
N06BX03
piracetam
N002691
N001669
N07AA01
N07AA01
P
P01BA01
P01BA01
P01BA01
P01BA02
P01BA03
P01BB01
P01BC01
P01BC02
P01BD01
P01BE02
P01BE02
P01BE03
neostigmin
neostigmin ͼ
N001685
N001693
N001701
N001719
N001727
N001735
N001743
N001750
N001768
N001776
N001784
N001792
chloroquine phosphate ili sulphate
chloroquine phosphate ili sulphate
chloroquine phosphate ili sulphate
hidroxychloroquine
primaquin diphosphate
proguanil hydrochloride
quinine bisulfat ili sulfat
mefloquine hydrochloride
pyrimethamin sulfat
artemether
artemether
artesunat
-$ý,1$/(.$
INDIKACIJE
333mg/ml
3URJUHVLYQDPLRNORQLþQD
epilepsija (G40) udružena sa
GUXJLPR]QDþHQLP
degenerativnim bolestima
nervnog sistema (G31.8). Lek se
uvodi u terapiju na osnovu
mišljenja tri lekara zdravstvene
ustanove koja obavlja
zdravstvenu delatnost na
tercijarnom nivou zdravstvene
zaštite.
granule
2,4 g
3URJUHVLYQDPLRNORQLþQD
epilepsija (G40) udružena sa
GUXJLPR]QDþHQLP
degenerativnim bolestima
nervnog sistema (G31.8). Lek se
uvodi u terapiju na osnovu
mišljenja tri lekara zdravstvene
ustanove koja obavlja
zdravstvenu delatnost na
tercijarnom nivou zdravstvene
zaštite.
rastvor za injekciju
injekcija
0,5 mg/ml
2,5 mg/ml
tableta
tableta
tableta
tableta
tableta
tableta
tableta
tableta
tableta
injekcija
tableta
tableta
100 mg
150 mg
250 mg
200 mg
15 mg
100 mg
300 mg
250 mg
25 mg
80 mg/ml
20 mg
50 mg
FO
oralni rastvor
Lista D- Lekovi koji nemaju dozvolu za stavljanje u promet u Republici Srbiji, a neophodni su u dijagnostici i terapiji - neregistrovani lekovi
praziquantel
praziquantel
mebendazol
FO
tableta
tableta
tableta
-$ý,1$/(.$
150 mg
600 mg
100 mg
albendazol
diethylcarbamazine dihydrogen citrate
diethylcarbamazine dihydrogen citrate
ivermectin
ivermectin
niclosamid
benzyl benzoate
tableta
tableta
tableta
tableta
tableta
tableta
losion
200 mg
50 mg
100 mg
3 mg
6 mg
500 mg
25%
N001867
P02CA03
P02CB02
P02CB02
P02CF01
P02CF01
P02DA01
P03AX01
R
R03BB01
ampula za inhalaciju
0,25 mg/1 ml
N001875
R03CC02
salbutamol
1 mg/ml
N003160
R03DA05
aminofilin ͼ
N003483
R03DA05
aminofilin
injekcija
rastvor za
injekciju/infuziju
rastvor za
injekciju/infuziju
N003087
N001891
N001909
R03DA05
S
S01EB01
S01EC01
S01EC01
aminofilin ͼ
pilokarpin ͼ
acetazolamide
acetazolamide
N003095
S01FA01
N003103
S01FA01
V
V03AB
V03AB14
V03AB15
V03AC01
V03AF01
ŠIFRA LEKA
N001800
N001818
N002642
ATC
P02BA01
P02BA01
P02CA01
N002659
N001826
N002279
N001834
N001842
N001859
N002873
N003533
N002535
N003640
N001917
N001925
N001933
INN
ipatropium bromid
INDIKACIJE
1. Ehinokokoza,
2. Cisticerkoza
250 mg/10 ml
240 mg/10 ml
tableta sa produženim
RVOREDÿDQMHP
350 mg
NDSL]DRþL
tableta
injekcija
2%
250 mg
500 mg
atropin ͼ
NDSL]DRþLUDVWYRU
0,50%
atropin ͼ
NDSL]DRþLUDVWYRU
1%
trientine trietilen tetramin-dihidrohlorid
protamin ͼ
naloxon hydrochloride
deferoxamine mesilat
mesna ( uromiteksan )
kapsula
rastvor za injekciju
injekcija
injekcija
injekcija
300 mg
50 mg/5 ml
0,4 mg/ml
500 mg
400 mg
Willson-ova bolest
Lista D- Lekovi koji nemaju dozvolu za stavljanje u promet u Republici Srbiji, a neophodni su u dijagnostici i terapiji - neregistrovani lekovi
ŠIFRA LEKA
N002584
N001941
N001958
ATC
V04CD01
V04CJ02
V04CJ02
INN
metyrapone
protirelin
protirelin
FO
-$ý,1$/(.$
kapsula
injekcija
injekcija
250 mg
0,2 mg
0,4 mg
INDIKACIJE
Cushingov sindrom na osnovu
mišljenja tri lekara Instituta za
endokrinologiju, dijabetes i
bolesti metabolizma KCS Beograd.
ͼ/HNVHQDEDYOMDVDPRXL]X]HWQLPVOXþDMHYLPDNDGDVQDEGHYDQMHOHNRPLVWRJ,11LVWRJLOLVURGQRJIDUPDFHXWVNRJREOLNDLLVWHMDþLQHVD/LVWH$$%LOL&QH
]DGRYROMDYDSRWUHEHXOHþHQMXRVLJXUDQLKOLFD5)=2D
/(*(1'$,6.5$û(1,&(
**
5H]HUYQLDQWLELRWLNSURSLVXMHVHQDRVQRYXPLãOMHQMDWULOHNDUDVSHFLMDOLVWHRGJRYDUDMXüHJUDQHPHGLFLQHNRMHLPHQXMHGLUHNWRU
]GUDYVWYHQHXVWDQRYHX]REDYH]DQSRWSLVQDþHOQLNDRGHOMHQMDLGLUHNWRUD]GUDYVWYHQHXVWDQRYH(YDOXDFLMXSULPHQMHQHWHUDSLMHX
SLVDQRMIRUPLSRWUHEQRMHXUDGLWLQDNRQWULGDQDRGVWUDQHLVWLKOHNDUDX]REDYH]DQSRWSLVQDþHOQLNDRGHOMHQMDLGLUHNWRUD
zdravstvene ustanove nakon uvida u antibiogram.
,]X]HWQRXKLWQLPVOXþDMHYLPDGHåXUQLLOLRGHOMHQVNLOHNDUPRåHXYHVWLUH]HUYQLDQWLELRWLNXWHUDSLMXQDNRQþHJDMHXREDYH]LGD
pribavi predhodno navedeni uslov za primenu rezervnog antibiotika.
STAC
/HNRYLVDRYRPR]QDNRPSUL]QDMXVHQDWHUHWVUHGVWDYDREDYH]QRJ]GUDYVWYHQRJRVLJXUDQMD]DOHþHQMHRVLJXUDQLKOLFDX
]GUDYVWYHQLPXVWDQRYDPDNRMHREDYOMDMXVWDFLRQDUQXRGQRVQREROQLþNX]GUDYVWYHQXGHODWQRVW
STAC**
/HNRYLVDRYRPR]QDNRPREHOHåDYDMXDQWLELRWLNHNRMLVHSUL]QDMXQDWHUHWREDYH]QRJ]GUDYVWYHQRJRVLJXUDQMD]DOHþHQMH
RVLJXUDQLKOLFDX]GUDYVWYHQLPXVWDQRYDPDNRMHREDYOMDMXVWDFLRQDUQXRGQRVQREROQLþNX]GUDYVWYHQXGHODWQRVWNDRLXWRNX
DPEXODWQRJOHþHQMDSRGXVORYRPGDMHQDRSXVQRMOLVWLXWYUÿHQDGDOMDWHUDSLMDRYLPOHNRP
¸
/HNSULPHQMXMXRVLJXUDQDOLFDILOLMDODXVOHGHüLP]GUDYVWYHQLPXVWDQRYDPD
1. Institut za onkologiju i radiologiju Srbije, Klinika za hematologiju KC Srbije, Klinika za urologiju KC Srbije, Klinika za
pulmologiju KC Srbije, Klinika za gastroenterologiju KC Srbije
0DþYDQVNLRNUXJVDVHGLãWHPXâDSFX.ROXEDUVNLRNUXJVDVHGLãWHPX9DOMHYX3RGXQDYVNLRNUXJVDVHGLãWHPX6PHGHUHYX
%UDQLþHYVNLRNUXJVDVHGLãWHPX3RåDUHYFX%RUVNLRNUXJVDVHGLãWHPX%RUX=ODWLERUVNLRNUXJVDVHGLãWHPX8åLFX5DãNLRNUXJ
VDVHGLãWHPX.UDOMHYX0RUDYLþNLRNUXJVDVHGLãWHPXýDþNX-XåQREDQDWVNLRNUXJVDVHGLãWHPX3DQþHYX*UDG%HRJUDG
2. KBC Bežanijska Kosa
- Grad Beograd
.OLQLND]DRQNRORJLMX.&1Lã.OLQLND]DKHPDWRORJLMXLNOLQLþNXLPXQRORJLMX.&1Lã.OLQLND]DSOXüQHEROHVWLÄ.QH]
Selo” KC Niš
=DMHþDUVNLRNUXJVDVHGLãWHPX=DMHþDUX5DVLQVNLRNUXJVDVHGLãWHPX.UXãHYFX1LãDYVNLRNUXJVDVHGLãWHPX1LãX7RSOLþNL
RNUXJVDVHGLãWHPX3URNXSOMX3LURWVNLRNUXJVDVHGLãWHPX3LURWX-DEODQLþNLRNUXJVDVHGLãWHPX/HVNRYFX3þLQMVNLRNUXJVD
VHGLãWHPX9UDQMX.RVRYVNLRNUXJVDVHGLãWHPX*UDþDQLFL.RVRYVNRPLWURYDþNLRNUXJVDVHGLãWHPX=YHþDQX.RVRYVNR
pomoravski okrug sa sedištem u Ranilugu,
,QVWLWXW]DRQNRORJLMX9RMYRGLQH.OLQLND]DKHPDWRORJLMX.&9RMYRGLQH,QVWLWXWX]DSOXüQHEROHVWL9RMYRGLQH.OLQLND
za urologiju KC Vojvodine
6UHGQMHEDQDWVNLRNUXJVDVHGLãWHPX=UHQMDQLQX6HYHUQREDþNLRNUXJVDVHGLãWHPX6XERWLFL6HYHUQREDQDWVNLRNUXJVD
VHGLãWHPX.LNLQGL-XåQREDþNLRNUXJVDVHGLãWHPX1RYRP6DGX=DSDGQREDþNLRNUXJVDVHGLãWHPX6RPERUX6UHPVNLRNUXJ
VDVHGLãWHPX6UHPVNRM0LWURYLFL-XåQREDQDWVNLRNUXJVDVHGLãWHPX3DQþHYX
5. KC Kragujevac
- Šumadijski okrug sa sedištem u Kragujevcu, Pomoravski okrug sa sedištem u Jagodini,
,QVWLWXW]D]GUDYVWYHQX]DãWLWXPDMNHLGHWHWD6UELMHÄ'U9XNDQýXSLü³8QLYHU]LWHWVNDGHþMDNOLQLND,QVWLWXW]D
]GUDYVWYHQX]DãWLWXGHFHLRPODGLQH9RMYRGLQH.OLQLND]DGHþMHLQWHUQHEROHVWL.&1Lã
- osigurana lica do 18 godina starosti.
7. Vojnomedicinska akademija
0DþYDQVNLRNUXJVDVHGLãWHPXâDSFX.ROXEDUVNLRNUXJVDVHGLãWHPX9DOMHYX3RGXQDYVNLRNUXJVDVHGLãWHPX6PHGHUHYX
%UDQLþHYVNLRNUXJVDVHGLãWHPX3RåDUHYFX%RUVNLRNUXJVDVHGLãWHPX%RUX=ODWLERUVNLRNUXJVDVHGLãWHPX8åLFX5DãNLRNUXJ
VDVHGLãWHPX.UDOMHYX0RUDYLþNLRNUXJVDVHGLãWHPXýDþNX-XåQREDQDWVNLRNUXJVDVHGLãWHPX3DQþHYX*UDG%HRJUDG
/(*(1'$,6.5$û(1,&(
**
5H]HUYQLDQWLELRWLNSURSLVXMHVHQDRVQRYXPLãOMHQMDWULOHNDUDVSHFLMDOLVWHRGJRYDUDMXüHJUDQHPHGLFLQHNRMHLPHQXMHGLUHNWRU
]GUDYVWYHQHXVWDQRYHX]REDYH]DQSRWSLVQDþHOQLNDRGHOMHQMDLGLUHNWRUD]GUDYVWYHQHXVWDQRYH(YDOXDFLMXSULPHQMHQHWHUDSLMHX
SLVDQRMIRUPLSRWUHEQRMHXUDGLWLQDNRQWULGDQDRGVWUDQHLVWLKOHNDUDX]REDYH]DQSRWSLVQDþHOQLNDRGHOMHQMDLGLUHNWRUD
zdravstvene ustanove nakon uvida u antibiogram.
,]X]HWQRXKLWQLPVOXþDMHYLPDGHåXUQLLOLRGHOMHQVNLOHNDUPRåHXYHVWLUH]HUYQLDQWLELRWLNXWHUDSLMXQDNRQþHJDMHXREDYH]LGD
pribavi predhodno navedeni uslov za primenu rezervnog antibiotika.
STAC
/HNRYLVDRYRPR]QDNRPSUL]QDMXVHQDWHUHWVUHGVWDYDREDYH]QRJ]GUDYVWYHQRJRVLJXUDQMD]DOHþHQMHRVLJXUDQLKOLFDX
]GUDYVWYHQLPXVWDQRYDPDNRMHREDYOMDMXVWDFLRQDUQXRGQRVQREROQLþNX]GUDYVWYHQXGHODWQRVW
STAC**
/HNRYLVDRYRPR]QDNRPREHOHåDYDMXDQWLELRWLNHNRMLVHSUL]QDMXQDWHUHWREDYH]QRJ]GUDYVWYHQRJRVLJXUDQMD]DOHþHQMH
RVLJXUDQLKOLFDX]GUDYVWYHQLPXVWDQRYDPDNRMHREDYOMDMXVWDFLRQDUQXRGQRVQREROQLþNX]GUDYVWYHQXGHODWQRVWNDRLXWRNX
DPEXODWQRJOHþHQMDSRGXVORYRPGDMHQDRSXVQRMOLVWLXWYUÿHQDGDOMDWHUDSLMDRYLPOHNRP
¸
/HNSULPHQMXMXRVLJXUDQDOLFDILOLMDODXVOHGHüLP]GUDYVWYHQLPXVWDQRYDPD
1. Institut za onkologiju i radiologiju Srbije, Klinika za hematologiju KC Srbije, Klinika za urologiju KC Srbije, Klinika za
pulmologiju KC Srbije, Klinika za gastroenterologiju KC Srbije
0DþYDQVNLRNUXJVDVHGLãWHPXâDSFX.ROXEDUVNLRNUXJVDVHGLãWHPX9DOMHYX3RGXQDYVNLRNUXJVDVHGLãWHPX6PHGHUHYX
%UDQLþHYVNLRNUXJVDVHGLãWHPX3RåDUHYFX%RUVNLRNUXJVDVHGLãWHPX%RUX=ODWLERUVNLRNUXJVDVHGLãWHPX8åLFX5DãNLRNUXJ
VDVHGLãWHPX.UDOMHYX0RUDYLþNLRNUXJVDVHGLãWHPXýDþNX-XåQREDQDWVNLRNUXJVDVHGLãWHPX3DQþHYX*UDG%HRJUDG
2. KBC Bežanijska Kosa
- Grad Beograd
.OLQLND]DRQNRORJLMX.&1Lã.OLQLND]DKHPDWRORJLMXLNOLQLþNXLPXQRORJLMX.&1Lã.OLQLND]DSOXüQHEROHVWLÄ.QH]
Selo” KC Niš
=DMHþDUVNLRNUXJVDVHGLãWHPX=DMHþDUX5DVLQVNLRNUXJVDVHGLãWHPX.UXãHYFX1LãDYVNLRNUXJVDVHGLãWHPX1LãX7RSOLþNL
RNUXJVDVHGLãWHPX3URNXSOMX3LURWVNLRNUXJVDVHGLãWHPX3LURWX-DEODQLþNLRNUXJVDVHGLãWHPX/HVNRYFX3þLQMVNLRNUXJVD
VHGLãWHPX9UDQMX.RVRYVNLRNUXJVDVHGLãWHPX*UDþDQLFL.RVRYVNRPLWURYDþNLRNUXJVDVHGLãWHPX=YHþDQX.RVRYVNR
pomoravski okrug sa sedištem u Ranilugu,
,QVWLWXW]DRQNRORJLMX9RMYRGLQH.OLQLND]DKHPDWRORJLMX.&9RMYRGLQH,QVWLWXWX]DSOXüQHEROHVWL9RMYRGLQH.OLQLND
za urologiju KC Vojvodine
6UHGQMHEDQDWVNLRNUXJVDVHGLãWHPX=UHQMDQLQX6HYHUQREDþNLRNUXJVDVHGLãWHPX6XERWLFL6HYHUQREDQDWVNLRNUXJVD
VHGLãWHPX.LNLQGL-XåQREDþNLRNUXJVDVHGLãWHPX1RYRP6DGX=DSDGQREDþNLRNUXJVDVHGLãWHPX6RPERUX6UHPVNLRNUXJ
VDVHGLãWHPX6UHPVNRM0LWURYLFL-XåQREDQDWVNLRNUXJVDVHGLãWHPX3DQþHYX
5. KC Kragujevac
- Šumadijski okrug sa sedištem u Kragujevcu, Pomoravski okrug sa sedištem u Jagodini,
,QVWLWXW]D]GUDYVWYHQX]DãWLWXPDMNHLGHWHWD6UELMHÄ'U9XNDQýXSLü³8QLYHU]LWHWVNDGHþMDNOLQLND,QVWLWXW]D
]GUDYVWYHQX]DãWLWXGHFHLRPODGLQH9RMYRGLQH.OLQLND]DGHþMHLQWHUQHEROHVWL.&1Lã
- osigurana lica do 18 godina starosti.
Download

Lista lekova Sl glasnik 76_13