#!$% ""$ %"$
#%$%%#$!
17 yıl önce Burdur Esnaf ve Sanatkarlar Odası
Başkanlığı'nda çaycı olarak işe başlayan Sönmez, yönetimi
ele geçirdi. Sönmez, "Sorunları bilmem ve sıkıntıların
çözümünü kendime en büyük hedef olarak seçmemden
dolayı başkan seçildim. Sorunları tek tek çözeceğim” dedi
($$(0&*((/,*'-/0JUEVLULSPPTQSRNT
LTQESNT;V?UJAONU;VTAEURTNT;VMOQLUFSJTNT
?OQUMPOMVJU>[email protected]
8TLSQTRV.:RKTE;V3-UJAOVGPUQUMV=TK
8TQ?TMV=TKVNTVKTAUESVURPUKNUVTFRU6
[email protected]+UMORTR
LUMS>?SFSVGPNICIKVS?SRVTFRU6OKOEOR
FGQIRPUQOROVDSPSJGQIKBV9IVFGQIRPUQO
DSPKTKV<TVFOMORLOPUQORV?:EHKHRHVMTRNSKT
TRVDHJHMV=TNT6VGPUQUMVFT?KTKNTRVNGPUJO
[email protected][email protected]
1.()/0'/0<TV.URULMUQPUQVNUFO
[email protected] RNUVDUEOVN:RTKPTQNTVJ:RTLSK
<TVNTRTLSKVMIQIPIVHJTPSCSRNT
DIPIRNICIRIVF:JPTJTRV4T=KTLVRAHVNT
[email protected](Q7
=UR;V=S?DSQVEUKURVJHEHKHEHVMUQU
[email protected]
=SEKTLVTLLS;[email protected]=
[email protected]
@TMSPNTV=SEKTLVTNTQ;[email protected]
NTNSBV-1)/+*0#-/
Kent içinde bisiklet kullanımını özendirmek ve bisikletin ulaşımda kullanılmasının önünü açmak
isteyen Karşıyaka Belediye Başkanı Hüseyin
Mutlu Akpınar, evinden belediyeye kadar bisikletle gitti. Başkan Akpınar “Bisiklet kullanımını
özendirmek için çalışıyoruz” dedi. devamı 8’de
www.sondakikagazetesi.com
8 Mayıs 2014 Perşembe
%%#$
%#%#
1'."(.0 %&%$1.,0 1(1-.&1 [email protected]
!GPUR;VBV#PIFPUQUQUFOVV2KUL:QV0SJULQGV,TFLS<UP7
S RTVMULOPURV8QI>[email protected]
KUMUKORNUVMUDIPVTLLSBVV,TFLS<UPSRVLSJULQGVFURULORU
MULMOFORORVJUROVFOQUVMHPLHQPTQVUQUFOVNSJUPGCIVNU
[email protected]!GPUR;V3V,TFLS<UP7
SKSEVSRFURPUQVUQUFORNUMSVNSJUPGCIVFUCPOJGQBV*SPPTQ;
NSRPTQV<[email protected]?PTRNSQSJGQB
5HPLHQV<TVFURULVS?SRV=SEKTLV<TQKTJTV=TQVEUKUR
<[email protected])/+*0#-/
Elinde 3
önemli
dosya
var!
İzmir Büyükşehir Belediyesi’nin yeni dönemde görev yapacak kadrolarını
belirleyen Kocaoğlu, soluğu Ankara’da aldı. Kocaoğlu, “Körfez, metro ve
tramvay projeleri için daha fazla bekletilmek istemiyoruz” şeklinde konuştu
"+.,0 %&%$1.,[email protected]
5GAUGCPI;V-T<QTV<TVT=SQASPSMV9UMURPOCOV0UDS7
ULV$UQPOMPUQOV5GQIKUV1TRTPV4HNHQHV'JSKUJU;
[email protected]+U>OV+ULOQOKPUQOV1TRTP
4HNHQHV0U=UR;V4SPPSV(KPUMV1TRTPV4HNHQH
5UJUV<[email protected]
GPKUMVHETQTV?GMFUJONUVHFLVNHETJVDHQGMQULVSPT
8:[email protected]?OMPUNOBV5GAUGCPI;V&'EKSQV5:Q7
6TES/RSVJHEHPTDSPSQV=UPTV8TLSQTDSPKTMVUKUAOJPU
[email protected]:PHKH
S?SRVIEIRAUVDSQVFHQTNSQV-(*VGRUJOVDTMPSJGQIEB
.UJORV1TRTPV4HNHQ/NTRVDIVFHQTASR
=OEPURNOQOPKUFOROVLUPT>VTNTATCSK)VNTNS
ESHOT
şoförüne
bisikletli
uyarısı!8’de
8’de
Bornova Belediyesi
Belediyesi çalışanlarına
çalışanlarına gügüBornova
lümseme
lümseme eğitimi
eğitimi verileceğini
verileceğini açıklaaçıklayan Başkan
Başkan Atila,
Atila, “Güler
“Güler yüzle
yüzle karşılakarşılayan
mak, sorunlarını
sorunlarını çözmek
çözmek kadar
kadar önemönemmak,
li” dedi.
dedi. devamı
devamı 14'te
14'te
li”
%#$#$ %%"
İstanbul Toplantı ve Düğün Salonları
İşletmecileri Esnaf Odası (İSTDO) Başkanı
Ümit Yaşar Demir, gelin damat adaylarına
düğün günü uyarısında bulundu. Demir,
Cumhurbaşkanlığı seçimi turlarının
yapılacağı 10 ve 24 Ağustos tarihlerinde
gündüz düğün yapmanın yasak
1-."0'.)1,.!1.#'.' VPUDGQULI<UQPUVDSPSKT
JU>LOCOVDHJHMVJULOQOK;VFOROQPUQORV:LTFSRNTVNTVJURMOVDI7
PIJGQBV9SQV=U6LUVS?SRNTVNTV:RATV,SPS>SRPTQV9HJHMTP?SFS
4UQSUVGTRUV4TRNGEUV.URA=TE;VUQNORNURV9TPUQIF
9HJHMTP?SFSV2RNQTSV.U<SRJM=VMGRIMVGPNIBV4TRNGEU;
HPMTFSRNTRVDSQV:CQTRASRSRVNTVTCSLSKV8:QNHCHV1TNSE/PT
,SPS>SRPTQVUQUFORNUVUMUNTKSMVM:>QHVMIQKUMVSFLTNSCSRS
S6UNTVTLLS;V&[email protected]?SRV=TQ
LHQPHVNTFLTCTV=UEOQOK)VNTNSBV-1)/+*0-/
% %"#"$% !
"+., /&,/$(*#-/ F>GQVJU>LOCO
FOQUNUVQU=ULFOEPURUQUMV=UJULORO
MUJDTNTRV8TRASRVUAOPOVDUDUFOVULS6
-UK;VGCPIRIRVMUFVJU>KUMVS?SRV=U>
MIPPURNOCORO;VDIRPUQOVRTQTNTRVLTKSR
TLLSCSRSVNTVDSPKTNSCSRSVF:JPTNSB-UK;
[email protected]>GQVJU>OJGQB
+UCPUQOVTQSLS>VMUFVJU>UAUCOKVNTQMTR
MUP>VMQSESV8T?SQSJGQBV$SLUKSR
=U>PUQORNURVMIPPUROJGQ;VRTQTNTR
LTKSRVTNSJGQVDSPKSJGQIKBV5SKJUFUP
S?TQSMPSVKUNNTPTQV<[email protected]?PTQV:QRTMVGPKUFOR
NSJTVDSQVSRATPTKTVJU>LOQUAUCOEBVV7VUJNOQVMIPPUROJGQNI
F>[email protected])VNTNSBV-1)/+*0!1
%"$ !
%$!!! #
8’de
8’de
,/+)/&0+1!,0)10SFMTPTV>QG%TPTQSRSR
IEIRVDSQVFHQTNSQVDTMPTLSPNSCSRSVF:JPTJTR
[email protected];V&9UMURPOCORV9SEVJU>UQOE/
NTNSCSV9IAUVLQUK<[email protected]>QG7
%TPTQSKSEVGRUJVDTMPSJGQBV,B2PLUJ/NURV"UQPONTQT
<TV"UQPONTQT/NTRV#QPUV+HMFTMV0TMRGPG%SV(R7
FLSLHFH/RTVIEURUAUMVVMSPGKTLQTPSMVKTLQG
=ULLORORVNIQIKIRIVFGQUAUCOEBV2JQOAUV?JGP7
9IAUV0ORUELT>TV5UK>HFHVKTLQGV=ULLOVNUV<UQB
9SQVNTVVSFMTPTVS?SRVNTVVJOPNOQVGRUJVDTMPSJGQIE
9IRPUQORVAT<UDOROVDSQURV:RATVUPKUMVSFLSJGQIE)
[email protected])/+*0#-1
Otel
Otel gibi
gibi
belediye
belediye
olduğunu, oy verme işleminin biteceği
saatten sonra akşam düğünlerin
yapılabileceğini bildirdi. Bu konuda
YSK'nın karar aldığını açıklayan Demir,
"Seçim yasakları bittikten sonra akşam
düğünü yapılabilir. Gündüz düğünleri ertelenmesi gerekiyor" dedi. devamı 16’da
/"*,0.&.+0%,%'(1,.'-1$.
[email protected]:<SEVMIQIV<T
SL=UPULUV8TLSQSPTRVMGQIKUV<TQ8S7
PTQSVSPTVMGRLQGPVUPLORUVUPORNOCORO
F:JPTJTRV0HQMSJTV1SJSK
.[email protected]
TKV"T8QSF;V3'L=UPVHQHRPTQSR
[email protected]@O
KUQMUPUQVEUKVJU>KUNURVUJUM7
[email protected]
[email protected]<TV2$4
MSQUPUQORORVNUVDIRUV>UQUPTPVG7
PUQUMVJHMFTPKTFSVMU?OROPKUEVG7
[email protected]:QVEULTR
DSQVFHQTNSQVNSPTV8TLSQSJGQNIBV2RAUMVDIRIRVNT<UK
TNTATCSRSVEURRTLKSJGQIKBV-HRMHVJTRSVN:<SEVMIQIJPU
JTRSV<TQ8SPTQPTVDSQVNTR8TVMIQIPNIBV9IVNTR8TJSVDGEUAUM
DSQVTLMTRVI6IMLUV8:QHRKHJGQ3VNTNSBV!1
SAYFA 02
MAVI
KIRMIZI SARI
8 Mayıs 2014 Perşembe
Van Gölü’nde Hüznün Bin Yıllık Öyküsü
Akdamar Adası
İnsan kuş gibi sevgili dostlarım. Gezmeyi çok seven bir
insan olmam ve tıbbi hipnoz
konferans ve seminerlerine
çağrılmam nedeniyle hem
dünyayı, hem de yurdumuzu
sık sık dolaşma şansı buluyorum. Gazetecilik sevgim ise
her zaman ağır basar. Yine
çağrıldığım bir seminer için
gittiğimde Van Gölü yakınlarını keşfetme şansını elime
geçirdim. Van Gölü
dendiğinde ilk aklıma gelen,
Akdamar Adası’nı ve 2010
yılında restore edilerek
yeniden ayinlere açılan Kutsal Haç Kilisesi’ni gezip
görmek ve sizler için fotoğraflamak en büyük isteğimdi. Hüznün bin yıldır
dillerde dolaşan acılı aşk
hikayesini, Akdamar Adası’ında, bir film gibi yaşadım.
Kadir Demirel
A
kdamar Adası ve Akdamar Kilisesi
(Kutsal Haç Kilisesi) Akdamar
Adası Van’a 47 km, Gevaş İlçesine 7 km mesafede, sahilden 4 km uzaklıkta olan Ada deniz motorlarıyla 20
dakikalık zevkli bir yolculuktan sonra Akdamar Adası üzerindeki aynı adlı Ermeni
Kilisesi M.S 915 ile 921 yılları arasında
mimar Keşiş Manuel tarafından Kral
I.Gagik’ın denetiminde inşa edilmiştir.
Kutsal Hac’a ithaf eden kilise merkezi
kubbelidir ve dört yapraklı yonca biçimli
hac plana sahiptir. Kubbenin yerden yüksekliği 20.40 metredir. Kilisenin etrafını
çeşitli bantlar halinde taş kabartmalarda
İncil ve Tevrat’tan alınan dini konular günlük olaylar ve av sahneleri işlenmiştir.
Yapılar 1113 tarihinde manastıra
çevrilmiş ve 1895 yılına kadar yöredeki
Ermeni Patrikliğinin merkezi durumunda
olmuştur. XIII.yy. sonlarında kilisenin
doğusundaki Şapel 1296’da kilisenin güney batısındaki Şapel yapılmıştır.Kilisenin giriş bölümü ile
Çan Kulesi XIX.yy
başlarında Jamatun ise
1763’te yapılıştır.
Çok eski yıllarda Akdamar’da yaşayan keşişler
badem ağaçlarıyla dolu adaya kimsenin çıkmasına
izin vermezlermiş. Ama ada da keşişlerden birinin
Tamara isminde dillere
destan güzellikte bir kızı
varmış. Tamara karşı kıyıda yaşayan bir çobana aşık
olmuş. Sevgililer haftanın
belirli günlerinde gizlice
buluşup konuşurlarmış.
Bu buluşma her defasında
Tamara'nın çobana ışık
göstererek ona yol göstermesi ile olurmuş. Işığı gören çoban onu
takip ederek adaya çıkarmış. Bir gün nasıl
oluyorsa bu ilişkiden Tamara’nın
babasının haberi olmuş. Daha sonra kızına
baskı yapıp işin aslını öğrenen babası
Tamara'yı bir odaya hapsetmiş.
Çobanın geleceği günü öğrenen
babası beklenen günde
çobanı gözetler ve onun
geliş saatini ayarlamış.
Işıkla işaretini alan
çoban göle girip ışığa
doğru yüzmeye
başlar, ancak ışık
hep yer
değiştirmektedir.
Sonunda ışık
sahilde bir yerde
durur ve çoban da oraya doğru yönelir
çok yorulmuştur ve de
onu taşlı sopalı bir de
sürpriz beklemektedir.
Bunu farkeden çoban
geriye yüzmek istemişse de
buna gücü kalmamış. Yorgunluk, taş
ve sopaların etkisi ile çoban sulara batıp
çıkmaya başlamış. Son nefesinde, batmadan önce de ‘Ah… Tamara’ diye inleyerek gölün mavi sularına gömülmüştür.
Bu öykü o zamandan beri anlatılmaktadır. Önce adanın adı Ahtamara iken zamanla dil evrimi nedeniyle günümüze Akdamar olarak gelmiş ve halen ada bu adla
anılmaktadır.
Bu efsanenin tarihi gerçek olup olmadığı
bilinmiyor. Bazı yazarlara göre IX yüzyıldan itibaren kaydedilmiş olan Ağtamar
adının Arapça ĞMR kökünden "kabartı,
tümsek" anlamına gelen bir türev olması
daha kuvvetli bir olasılık olarak değerlendirilebilir.
Adın Türkçeleştirilmiş biçimi olarak Akdamar kullanılmaktadır.
Akdamar Adası, Türkiye'nin
Van ve Bitlis illeri arasında bulunan Van Gölü'nün içinde yer
alan ikinci büyük adadır.
Van'ın Gevaş ilçesi sınırları içerisinde yer alan
adada Ermeniler´den
kalma bir kilise bu-
lunur. Yüzölçümü 70.000 metrekare olan
adanın toplam kıyı uzunluğu 3 kilometreyi
bulmaktadır. En yüksek noktası deniz seviyesinden 1912 metre yüksekte bulunan
adanın batı uçlarında yüksekliği 80
metreye ulaşan dik kayalıklar vardır.
En eski kaynaklarda adanın
adı, Gevaş bölgesinde
hüküm süren Ermeni
Rştuni sülalesine atfen Rştunik Adası
olarak geçmektedir. 705 yılında
Vard Rştuni'nin
adada
öldürülerek Rştuni beyliğine
son verilmesinden sonra ada
ve yöresi, daha
önce Başkale'de
(Ağbak) hüküm süren
Ardzruni sülalesinin eline geçmiştir. 908'de I.
Gagik Ardzruni bazı Ermeni
ve Müslüman beyleriyle anlaşarak Gevaş'ta (Vostan) kendini
Vaspuragan Kralı ilan etmiş ve ardından
başkentini adaya taşımaya karar vermiştir.
I. Gagik adada bulunan kiliseden başka bir
kasaba, saray, çarşı ve liman inşa ettirmiştir. Ada üzerindeki sivil yerleşimin 16.
yüzyıl başlarına kadar canlı olarak varlığını sürdürdüğü ve 1535 Osmanlı-İran
savaşında zarar gördüğü anlaşılmaktadır.
16. yüzyıldan sonra sivil yerleşimin
bulunmadığı adada Kutsal Haç'a (Surp
Khaç) adanmış bir Ermeni manastırı hayatiyetini sürdürmüştür. 19. yüzyıl sonlarında 300 civarında keşişin ikamet ettiği
manastır, 1895 ve 1915 olaylarından sonra
terkedilmiştir.
Ermeni Kilisesinin ruhani
başkanlığı olan Gatoğigosluk
makamı 10. yüzyıl ortalarından 1101 yılına
kadar Ahtamar
Adasında bulunmuştur. Makamın
12. yüzyılda
Kilikya'ya taşınmasından
sonra da Ahtamar Kilisesi
19. yüzyıla dek önderlik
iddiasını devam ettirmiştir..
Akdamar Adasındaki
Surp Haç kilisesi,
Kudüs'ten İran'a kaçırıldıktan sonra 7. yüzyılda Van
yöresine getirildiği rivayet
edilen Hakiki Haç'ın bir
parçasını barındırmak
maksadıyla Kral I.
Gagik'in emriyle 915-921
yıllarında Mimar Manuel
tarafından inşa edilmiştir.
Adanın güney doğusuna
kurulmuş olan kilise, mimari açıdan Ortaçağ Ermeni sanatının en parlak eserleri arasında sayılır.
Kızıl andezit taşından inşa
edilmiş olan kilisenin dış
cephesi, alçak rölyef şeklinde işlenmiş zengin bitki ve hayvan motifleriyle ve Kutsal Kitap'tan alınma sahnelerle bezenmiştir. Kilise bu özelliğiyle
de Ermeni mimari tarihi içinde eşsiz bir
konuma sahiptir.
Van Gölü'ndeki Akdamar Adası'nda
bulunan Ermeni Kilisesi'nde 2013 yılında
dördüncüsü yapılan ayin başladı. Kültür
ve Turizm Bakanlığı'nın özel izniyle
95 yıl aradan sonra ilk defa 2010
yılında ibadete açılan Akdamar Kilisesi, 2013 yılında dördüncü
ayine ev
sahipliği yaptı.
Sabahın
erken saatlerinden
itibaren
Gevaş
ilçesindeki iskeleden teknelerle adaya
geçen ziyaretçiler, Türkiye Ermenileri Patrikhanesi Patrikvekili Başpiskopos Aram
Ateşyan'ın yönetiminde ayine
başladı. Kilisenin güney
bölümündeki şapelde hazırlıklarını yapan Ateşyan ve din
adamları, çan sesleri ve ilahiler eşliğinde kiliseye girdi. Adada toplanan çok sayıda katılımcı da mum yakıp dua etti. Türkiye'de yaşayan
Ermeniler ile dünyanın bir
çok ülkesinden ve Ermenistan'dan çok sayıda
ailenin ilgi gösterdiği ayine,
BDP Van Milletvekili Nazmi
Gür, Gevaş Belediye
Başkanı Nazmi Sezer,
Amerika Birleşik Devletleri
(ABD) Adana Konsolosu
John L. Espinoza ile
İsviçre Büyükelçisi
Müsteşarı Didier
Chassat da
katıldı.
Yıl: 3
. Sayı: 910 . 8 Mayıs 2014 Perşembe
Sahibi
Saykar Basın Yayın Gaz. Mat. Kır. San. ve Tic. A.Ş. adına
Eflatun SAYGILI
Yazı İşleri MüdürüYayın Sahibi Temsilcisi
Azime MOLLA
Haber Müdürü
Gülseren KUMRU
Sayfa Editörü
Nur Gülmez BEL
Salih ASLAN
Denizli Temsilcisi
Sedat KAYA
05326601776
[email protected]
Sorumlu Yazı İşleri Müdürü
Fikret DAĞTEKİN
İdari Merkez
Şehit Fethi Bey Cad. Kızılkanat
İş Merkezi 45/803
Gümrük - Konak / İZMİR
Tel: 0232 425 26 10 (Pbx)
0232 425 26 10
Mail:
[email protected]
Dağıtım: Hakkı SARIÖZ
Yayın türü:
Yerel
Basıldığı Yer
Star Medya Yayıncılık A.Ş Gaziemir Tren İstasyonu Karşısı
Eski Beton Taş Tesisleri İçi No: 29 Gaziemir / İZMİR
Tel: 0232 251 76 32
SON DAKİKA Basın Meslek İlkelerine Uymaya Söz Vermiştir
SAYFA 3
SONDAKiKA GAZETESİ >>
3 ASAYiŞ
817
Mayıs
2014
Perşembe
Şubat
2013
Perşembe
Polisin takibi 20
hayat KURTARDI
İzmir Emniyeti Kaçakçılık Suçlarla Mücadele
Şube Müdürlüğü ekipleri, yaptıkları çalışmalar
sonucu, Ege Denizi'ndeki Sisam Adası açıklarında kaçakları taşıyan teknenin alabora olması
sonucu 22 kişinin hayatını kaybettiği önceki gün
Basmane semtinde de bazı mültecilerin yasa dışı
yollardan Yunanistan'a gideceklerini belirledi.
Bunun üzerine takibe başlayan ekipler, Basmane'de bulunan Oteller Sokağı'na gelen minibüse 20
mültecinin bindiğini tespit etti. Takibe başlayan
ekipler, mültecileri taşıyan minibüsün İzmir'de
uğradığı değişik adreslerde de 3 organizatörü
aldığını belirledi.
TAKİPTEN KURTULMAK
İÇİN İZMİR DOLAŞTILAR
Menderes ilçesi Gümüdür Mahallesi'nde 10 kişilik
zodyak botla 20 kişiyi Yunanistan'a yasa dışı yollardan götürmek isteyen 3 organizatör ve minibüs
şoförü, kendilerine takip eden polis ekibin olup olmadığını belirlemek üzere Basmane'den çıkıp önce
Karşıyaka ilçesine gitti. Burada içinde 20 mültecinin
bulunduğu minibüsle dolaşan 3 organizatör, daha sonra Bornova ilçesine döndü. Ekiplerin uzaktan ve
mobese kameralarında takip ettiği minibüs daha sonra
tekrar Konak'a döndü. Polisin kendilerini takip
etmediği kanısına varan organizatörler ve minibüs
şoförü Gümüldür'e doğru yolla çıktı. Gümüldür'ün
girişinde Kaçakçılık Suçlarla Mücadele Şube Müdürlüğü ekipleri tarafından durdurulmak istenilen
minibüs kaçmaya başladı. Ekiplerin kovalamaya
başladığı minibüs mandalina bahçesine girdi. Minibüs
SİYAH MAVİ KIRMIZI SARI
nun dışı
İzmir'de 20 kaçağı ka k botla
dya
yollarla 10 kişilik zo
ek isteyen
Yunanistan'a götürm yaptığı
3 organizatör, polisin dı. Basn
takip sonrası yakala
mane'de başlayan ve n takip
ula
Gümüldür'de son b 10'u
sonrası 10'u Eritre ve üzere
Suriye uyruklu olmak arıldı
rt
toplam 20 mülteci ku
seyir halindeyken şoför atlayıp kaçarken, ağaçlara
çarpan minibüs güçlükle durabildi. Şans eseri kimsenin yaralanmadığı kazada, 3 organizatörle 20 mülteci
yakalandı. Gözaltına alınan organizatörler işlemleri
bittikten sonra adliyeye gönderilecekleri bildirilirken,
mültecilerin ise sınır dışı edilecekleri belirtildi.
URLA'DA DA MİNİBÜSTE
23 MÜLTECİ YAKALANDI
Bu arada aynı şekilde Basmane'de bir
minibüse doldurdukları 23 mülteciyi yasa dışı yollardan Yunanistan'a götürmek isteyen 4 organizatör de Urla'da yakalandı. Kişi başı bin dolara
anlaştıkları mültecileri Yunanistan'a balıkçı teknesi ile götürmek isteyen organizatörlerden 2'si ifadesi alındıktan sonra 2'sinin ise çıkarıldığı
mahkemede tutuksuz yargılamak üzere serbest
bırakıldığı bildirildi. Gözaltına alınan 22 suriye 1
Eritre uyruklu 23 mültecinin ise işlemleri bittikten sonra sınır dışı edileceği belirtildi.
DENETİMLER ARTTI
Havaların ısınmaya başlamasıyla birlikte Ege
kıyılarından Yunanistan' geçiş yapamak isteyen
mülteci sayısının artması üzerine polisin özellikle
Basmane'de bulunan Oteller Sokağı'nda denetimlerini artırdığı ortaya çıktı. Gece gündüz kontrol
edilen sokağa giriş çıkış yapanların incelendiği
belirlendi. Bunun yanı sıra İzmir'de bulunan ve
kayıt altındaki tüm mültecilerin neredeyse her
gün kontrol edildiği bildirildi.
(CİHAN)
TEM'de alev alev yanan minibüs trafiği kilitledi
TEM Otoyolu'da işyerine servis taşıyan minibüs alev alev yandı. İSTOÇ mevkiinde
meydana gelen yangın sebebiyle, Edirne istikametinde trafik durma noktasına geldi.
Güçlükle olay yerine gelen itfaiyenin söndürdüğü minibüs, kullanılamaz hale geldi
Olay, TEM Otoyolu Edirne istikameti İSTOÇ mevkiinde saat
07.30 sıralarında meydana geldi.
Dursun Önder’in kullandığı 34 TJ
838 plakalı servis minibüsünün motor bölümünde
yanma oldu. Araçtan koku geldiğini
fark eden Önder,
minibüsü hemen
emniyet şeridine
çekti. Araçta bulunan 6 yolcunun indirilmesinin ardın-
dan minibüs alev alev yanmaya
başladı. Vatandaşlar vakit kaybetmeden durumu itfaiyeye bildirdi.
İtfaiye ekipleri, yangın sebebiyle
oluşan yoğunluk sebebiyle olay yerine ulaşmakta güçlük çekti.
Yaklaşık yarım saat sonra olay
yerine gelen itfaiye yangına
müdahale etti. Çalışmaların
ardından geri hurdaya dönen
minibüs kaldı. Olayı anlatan
minibüs sürücüsü Dursun
Önder, Haramidere’deki işyerine çalışanları götürdüğü
sırada araçta yangın çıktığını söyledi.
Araçta 6 kişi bulunduğunu belirten
Önder, motordan koku gelince
minibüsü sağa çekip yolcuları indirdiğini aktardı. Aracın bir anda alev
alev yandığını ifade eden Dursun Önder, olayda yaralanan kimsenin olmadığını belirtti.
Servis minibüsündeki yangın
TEM Otoyolu’ndaki trafiği de etkiledi. Yangın ve söndürme çalışmaları
sebebiyle özellikle Edirne istikametinde trafik durma noktasına
geldi. (CİHAN)
TELEFON SANTRALİ MALZEMELERİ SATIN ALINACAKTIR
İZMİR SU VE KANALİZASYON İDARESİ GENEL MÜDÜRLÜĞÜ (İZSU)
TELEFON SANTRALİ MALZEMELERİ alımı 4734 sayılı Kamu İhale Kanununun 19 uncu maddesine göre açık ihale usulü
ile ihale edilecektir. İhaleye ilişkin ayrıntılı bilgiler aşağıda yer almaktadır:
İhale Kayıt Numarası
: 2014/47980
1-İdarenin
a) Adresi
: Cumhuriyet Bulvarı No: 16 35250 KONAK/İZMİR
b) Telefon ve faks numarası
: 2322932000-2322932831
c) Elektronik Posta Adresi
: [email protected]
ç) İhale dokümanının görülebileceği : https://ekap.kik.gov.tr/EKAP/
internet adresi (varsa)
2-İhale konusu malın
a) Niteliği, türü ve miktarı
: 11 KALEM TELEFON SANTRALİ MALZEMELERİ ALIMI
Ayrıntılı bilgiye EKAP'ta yer alan ihale dokümanı içinde bulunan idari
şartnameden ulaşılabilir.
b) Teslim yeri
: Gaziler Caddesi No:373 Halkapınar-İZMİR adresindeki İZSU Halkapınar Sular
İşletmesi
c) Teslim tarihi
: Sözleşmenin imzalanmasına müteakip 30 takvim günü.
3- İhalenin
a) Yapılacağı yer
: Cumhuriyet Bulvarı No:16 K:1 35250 KONAK İZMİR
b) Tarihi ve saati
: 30.05.2014 - 10:30
4.
İhaleye katılabilme şartları ve istenilen belgeler ile yeterlik değerlendirmesinde uygulanacak kriterler:
4.1.
İhaleye katılma şartları ve istenilen belgeler:
4.1.1. Mevzuatı gereği kayıtlı olduğu Ticaret ve/veya Sanayi Odası ya da ilgili Esnaf ve Sanatkarlar Odası belgesi;
4.1.1.1.Gerçek kişi olması halinde, ilk ilan veya ihale tarihinin içinde bulunduğu yılda alınmış, ilgisine göre Ticaret ve/veya
Sanayi Odasına ya da ilgili Esnaf ve Sanatkarlar Odasına kayıtlı olduğunu gösterir belge,
4.1.1.2. Tüzel kişi olması halinde, ilgili mevzuatı gereği kayıtlı bulunduğu Ticaret ve/veya Sanayi Odasından, ilk ilan veya
ihale tarihinin içinde bulunduğu yılda alınmış, tüzel kişiliğin odaya kayıtlı olduğunu gösterir belge,
4.1.2. Teklif vermeye yetkili olduğunu gösteren imza beyannamesi veya imza sirküleri;
4.1.2.1. Gerçek kişi olması halinde, noter tasdikli imza beyannamesi,
4.1.2.2. Tüzel kişi olması halinde, ilgisine göre tüzel kişiliğin ortakları, üyeleri veya kurucuları ile tüzel kişiliğin yönetimindeki
görevlileri belirten son durumu gösterir Ticaret Sicil Gazetesi, bu bilgilerin tamamının bir Ticaret Sicil Gazetesinde
bulunmaması halinde, bu bilgilerin tümünü göstermek üzere ilgili Ticaret Sicil Gazeteleri veya bu hususları gösteren
belgeler ile tüzel kişiliğin noter tasdikli imza sirküleri,
4.1.3. Şekli ve içeriği İdari Şartnamede belirlenen teklif mektubu.
4.1.4. Şekli ve içeriği İdari Şartnamede belirlenen geçici teminat.
4.1.5 İhale konusu alımın tamamı veya bir kısmı alt yüklenicilere yaptırılamaz.
4.2.
Ekonomik ve mali yeterliğe ilişkin belgeler ve bu belgelerin taşıması gereken kriterler:
İdare tarafından ekonomik ve mali yeterliğe ilişkin kriter belirtilmemiştir.
4.3.
Mesleki ve Teknik yeterliğe ilişkin belgeler ve bu belgelerin taşıması gereken kriterler:
4.3.1. Yetkili satıcılığı veya imalatçılığı gösteren belgeler:
a) İmalatçı ise imalatçı olduğunu gösteren belge veya belgeler,
b) Yetkili satıcı veya yetkili temsilci ise yetkili satıcı ya da yetkili temsilci olduğunu gösteren belge veya belgeler,
c) Türkiye'de serbest bölgelerde faaliyet gösteriyor ise yukarıdaki belgelerden biriyle birlikte sunduğu serbest bölge
faaliyet belgesi.
İsteklilerin yukarıda sayılan belgelerden, kendi durumuna uygun belge veya belgeleri sunması yeterli kabul edilir.
İsteklinin imalatçı olduğu aşağıdaki belgeler ile tevsik edilir.
-Aday veya istekli adına düzenlenen Sanayi Sicil Belgesi, Aday veya isteklinin üyesi olduğu meslek odası
tarafından aday veya istekli adına düzenlenen Kapasite Raporu,Aday veya isteklinin kayıtlı olduğu meslek
odası tarafından aday veya istekli adına düzenlenen İmalat Yeterlik Belgesi,Aday veya isteklinin kayıtlı
olduğu meslek odası tarafından aday veya istekli adına düzenlenmiş ve teklif ettiği mala ilişkin Yerli Malı
Belgesi,Aday veya isteklinin alım konusu malı ürettiğine ilişkin olarak ilgili mevzuat uyarınca yetkili kurum
veya kuruluşlarca düzenlenen ve aday veya isteklinin üretici veya imalatçı olduğunu gösteren belgeler,
4.3.2. Satış sonrası servis, bakım ve onarıma ilişkin belgeler:
Telefon santral malzemelerinin İzmir’de yetkili tamir, bakım, onarım servisi bulunduğunu gösteren belge
5.
Ekonomik açıdan en avantajlı teklif sadece fiyat esasına göre belirlenecektir.
6.
İhaleye sadece yerli istekliler katılabilecektir.
7.
İhale dokümanının görülmesi ve satın alınması:
7.1.
İhale dokümanı, idarenin adresinde görülebilir ve 20 TRY (Türk Lirası) karşılığı Cumhuriyet Bulvarı No: 16 K:1
35250 KONAK İZMİR adresinden satın alınabilir.
7.2.
İhaleye teklif verecek olanların ihale dokümanını satın almaları veya EKAP üzerinden e-imza kullanarak indirmeleri
zorunludur.
8.
Teklifler, ihale tarih ve saatine kadar Genel Evrak Şefliği Cumhuriyet Bulvarı No: 16 35250 K:Z KONAK İZMİR
adresine elden teslim edilebileceği gibi, aynı adrese iadeli taahhütlü posta vasıtasıyla da gönderilebilir.
9.
İstekliler tekliflerini, mal kalem-kalemleri için teklif birim fiyatlar üzerinden vereceklerdir. İhale sonucu, üzerine ihale
yapılan istekliyle her bir mal kalemi miktarı ile bu mal kalemleri için teklif edilen birim fiyatların çarpımı sonucu
bulunan toplam bedel üzerinden birim fiyat sözleşme imzalanacaktır.
Bu ihalede, işin tamamı için teklif verilecektir.
10.
İstekliler teklif ettikleri bedelin %3'ünden az olmamak üzere kendi belirleyecekleri tutarda geçici teminat vereceklerdir.
11.
Verilen tekliflerin geçerlilik süresi, ihale tarihinden itibaren 90 (doksan) takvim günüdür.
12.
Konsorsiyum olarak ihaleye teklif verilemez.
Resmi İlanlar: www.ilan.gov.tr’de
Sondakika 8/5
Basın: 5451
‘Oğlum kas yapmak
için hap kullanıyordu’
İzmir'in Bayraklı ilçesinde, spor yaptığı sırada rahatsızlanarak hayatını kaybeden
gencin acılı babası, oğlunun
kas yapmak için hap kullandığını, bunları nereden
temin ettiğini de bilmediğini
söyledi. Olay, dün akşam saat
22.00 sıralarında, İbrahim
Ethem Caddesi numara 57'de
bulunan, bir derneğe ait spor
salonunda meydana geldi.
Koşu bandında spor yapan
Çağlar Çam, iddiaya göre rahatsızlanarak birden yere
düştü. Çam'ın kalp krizi
geçirdiğini belirleyen sağlık
ekipleri müdahalenin ardından, Ege Üniversitesi Hastanesi'ne kaldırdı. Çam, hastanede yapılan müdahalelere
rağmen kurtarılamadı. Bodrum'da animatörlük yaptığı
sırada tanıştığı İngiliz nişanlısıyla önümüzdeki eylül ayında evlenmeye hazırlandığı
öğrenilen Çam'ın düğün tarihine kadar haftanın 6 günü spor salonuna devam ettiği ortaya çıktı. Adli Tıp Kurumu'nda yapılan otopsinin ardından
Çam'ın kesin ölüm sebebinin
belirlenebilmesi için vücudundan parça alındı. Çam'ın,
istediği kiloya ulaşmak için
aşırı efor sarf ettiği, hatta koşu
bandında spor yaptığı sırada
ayaklarına, birer kilogramlık
kum torbalarıyla ağırlıklar
bağladığı da öğrenildi. Çağlar
Çam'ın cenazesi, ikindi vakti
Bornova Merkez Camii'ne getirildi. Oğlunun ilaç kullandığını dile getiren baba
Latif Çam, "Koşu bandındayken spor yapıyor. Yağları
eritip kas yapacağım derken
kalp krizi geçiriyor. Vitamin
haplarından kullanıyor, nereden temin ediyor bilmiyorum.
Kimyasal içerikli maddeler
varsa başka gençler örnek olmasın diye bir inceleme yaptıracağız. 4 -5 aydır kullanıyordu spora başladığından beri.”
dedi.
Kardeş Görkem Çam ise
“Kamera kayıtlarında görünenlere göre ilaçların da etkisiyle kalp krizi geçirip koşu
bandından düşüp ölüyor. İlaç
kullanıyordu, protein doping
tarzı ilaçlardı. Ağustosta
düğünü vardı, onun için çabalıyordu, güzel görünmek
için.” diye konuştu.
(CİHAN)
Aynı adı taşıyan iki müşteriyi karıştıran banka, kötü
niyet tazminatı ödeyecek
Aynı adı taşıyan kredi kartı müşterisinin adını karıştırarak, harcama yapmayan vatandaşa icra takibi başlatan
banka, kötü niyet tazminatı ödeyecek.
Yerel mahkemenin "Hata yapılmıştır,
bankanın kötü niyetli olarak icra takibi başlatmıştır." şeklindeki kararı
Yargıtay 19. Hukuk Dairesi’nce
bozuldu. Yerel mahkeme kararında
direnince konu Yargıtay Hukuk Genel
Kurulu’na taşındı.
Genel kurul, yerel mahkemenin
kararında isabetsizlik bulmayınca
Yargıtay 19. Hukuk Dairesi, bankanın
kötü niyet tazminatına ilişkin temyizini reddetti. Konya’da meydana gelen
olayda, bir banka, borcu bulunduğu
iddiasıyla kredi kartı müşterisine icra
takibi başlattı. Bankaya borcu olmadığını belirten vatandaş, icraya itiraz etti. Bunun üzerine banka, Konya
1. Sulh Hukuk Mahkemesi’ne ‘İtirazın iptali’ davası açtı. İcra takibine
maruz kalan vatandaş, bankaya borcunun bulunmadığını, bankanın müş-
teri isimlerini karıştırdığını öne sürdü.
Konya 1. Sulh Hukuk Mahkemesi,
davacı banka tarafından aynı adı
taşıyan iki müşterinin bilgilerinin birleştirilmesi nedeni ile hata yapıldığını,
davacı bankanın kötü niyetli olarak
takipte bulunduğu gerekçesiyle davanın reddine ve yüzde 40 kötü niyet
tazminatının davacıdan alınarak
davalıya verilmesine hükmetti.
Mahkemenin bu kararı, banka avukatı
tarafından temyiz edildi. Dosyayı
yeniden inceleyen Yargıtay 19.
Hukuk Dairesi, kararını 24 Nisan
2012’de açıkladı. Daire, davacı banka
tarafından başlatılan icra takibine
konu alacağın davalı harcamalarından
kaynaklanıp kaynaklanmadığı, alacağın varlığı ve miktarının tespiti
yönünden bankanın defter ve kayıtları
ile dayanağı belgeler üzerinde
konusunda uzman bilirkişi marifetiyle
inceleme yaptırılmadan eksik inceleme yapıldığı iddiasıyla yerel
mahkemenin kararını bozdu.
Yargıtay’ın bozma kararının ardından dava dosyasını ikinci kez değerlendiren Konya 1. Sulh Hukuk
Mahkeme, ilk kararında direndi. Banka avukatı bu kez direnme kararını da
temyiz etti. Müracaatı değerlendiren
Yargıtay Hukuk Genel Kurulu, 18
Eylül 2013’te mahkemenin direnme
kararını uygun bularak, davacı-alacaklı vekilinin kötü niyet tazminatına
ilişkin temyiz itirazlarının incelenmesi
için dosyayı Yargıtay 19. Hukuk
Dairesi’ne gönderdi. Davada son sözü
söyleyen Yargıtay 19. Hukuk Dairesi,
yerel mahkemenin kararını onadı.
Kararda: "Dosyadaki yazılara, kararın
dayandığı delillerle, gerektirici sebeplere ve özellikle davacı bankanın
davalı ile ilgisi bulunmayan kredi
kartı hesap özetine dayanarak icra takibine girişmesinde kötü niyetli
olduğunun kabulü ile yazılı şekilde
hüküm kurulmasında bir isabetsizlik
bulunmamıştır.’’ denildi.
(CİHAN)
8 Mayıs 2014 Perşembe
Otomotiv Distribütörleri Derneği (ODD) Genel Koordinatörü Dr. Hayri
Erce, yılın ilk 4 ayında otomobil sektörünün yüzde 23, hafif ticari vasıta
sektörünün ise yüzde 34 daraldığını açıkladı. Hükümetin aldığı tedbirlerin
çok sert olduğunu belirten Erce, sektörün ‘sarı alarm’ verdiğini ifade etti
1XH] \QXZ],XD[F][T\L[S]0OXORO]I[]WOU\E]+YZI[X=
PZS[PZ]+]ZJLZXWZEZ]ZW[]+]3N>[YUZPWZT]3ZR\XWVT
!\TNWS[PZ]-SMRMSZI]3N>[YUZPWZEZ]<GWNRN:YU[]UNK[YW[=
Y[Y]%?;H][T\L[S] OTOTO]I[]6TSZP\UVYU\]4NYD[W
4[WZJR[W[X]8[RAMKQORO%Y\]T\SVWUVH]<OX\U\]B\K[S[DZ=
W[XZY]PMXOW\XVYV]D[I\AW\Q\Y]1XH],XD[F]MSMRMSZI]P[T=
SGXNYNY]UOXOROYO]U[E[XW[YUZXUZH];@?7]QVWVYVY]P[TSGX
ZCZY]KMXWO]B[C[D[EZYZ]S\>RZY][SSZTW[XZYZ]L[WZXS[Y],XD[F
'4[C[Y]P[Y[]SMAW\R]9NXTZQ[:U[TZ]MSMRMSZI]A\K\XV]).7
LZY]P[IZQ[PZYU[]T\A\YRVJSVH]6WT]L\JS\TZ]S\>RZYW[XZRZK
QNKU[]?@]ZW[]?*]\X\PVYU\]LZX]U\X\WR\QV]ZJ\X[S][UZQMXUOH
NYTN]LZWZQMXPOYOK]B[X[T]UNYQ\U\TZ]TMY#MYTSNXNY
U[EZJR[PZF]!,1:ZY]S\>IZW]\WVR]AXMBX\RW\XVYVY]\K\WR\PVF
UNYQ\U\TZ]WZTZSZU[YZY]\K\WR\PVYVY]MWORPOK
Q\YPVR\W\XVYVY]9NXTZQ[:Q[]Q\YPVQ\D\EVYV]I[]LNQNR[
MX\YW\XVYVY]U\]LZX]RZTS\X]B[XZ]C[TZW[D[EZYZ]S\>RZY][UZQ=
MXUOTH]!\T\S]LOYOY]NK[XZY[]P[Y[]PMYOYU\]MXS\]I\U[WZ
AXMBX\RW\]L[X\L[X]P\QVY]5WZ]<\L\D\Y:VY]\CVTW\UVEV
R\TXM]Z>SZQ\UZ]S[ULZXW[XF]TX[UZ]TOWW\YVRVY\]B[SZXZW[Y]WZR=
ZSW[X]I[]>[R[Y]\T\LZYU[]"9:U[]Q\AVW\Y]\XSVJW\X]R\\W[=
P[2]LO]U\X\WR\YVY]LMQOSOYO]LZX\K]\XSVXRVJ]UOXORU\H'
U[E[XW[YUZXR[PZYU[]LOWOYUOH]8[TSGXNY];@?7]QVWV]ZWT]7
\QWVT]I[XZW[XZYZ]LOBNY]\CVTW\UVTW\XVYV]IOXBOW\Q\Y],XD[F
JO]LZWBZW[XZ]I[XUZ]'6WT]7]\QWVT]I[XZW[X[]L\TSVEVRVKU\
B[C[Y]P[Y[YZY]7]\QVY\]BGX[]Q\TW\JVT]QNKU[];*:WZT]LZX
U\X\WR\QV]ZJ\X[S][UZQMXH]<O]MSMRMLZW]S\X\2VYU\]LZX]RZT=
S\X]U\>\]\KH]&NKU[];;=;$]P[IZQ[PZYU[]B[C[Y]P[Y[YZY]ZWT
7]\QVY\]BGX[]MSMRMLZW]A\K\XV]U\X\WRVJ]UOXORU\H] \2Z2
SZD\XZ]I\PVS\]A\K\XVYU\]ZP[]LO]UNJNJ]MX\YV]QNKU[]$7:W[X[
T\U\X]UNJRNJ]UOXORU\H]<OYOY]Y[U[YW[XZ]\X\PVYU\]>[R
"9]\XSVJW\XV]>[R]U[]<110:YVY]B[SZXUZEZ]PVYVXW\R\W\X
I\XH]<OY\][T]MW\X\T]U\]3\QVP]\QVYVY]PMYOYU\Y]ZSZL\X[Y
TOXW\XU\]DZUUZ]LZX]\XSVJ]PGK]TMYOPO]I[]-D\T]\QVYU\
Q\AVW\Y]2\ZK]\XSVXVRW\XVH]&\YZ]LO]7]MWORPOKWOT]Q\Y]Q\Y\
B[WUZ]I[]R\\W[P[2]P\U[D[]MSMRMSZI]P[TSGXN]ZCZY]U[EZW
LNSNY]9NXTZQ[]ZCZY]ZC]SNT[SZRU[]LZX]\K\WR\]PGK]TMYOPOH
<NSNY]P[TSGXW[X]U[]MWUOEO]BZLZ]MSMRMSZI]P[TSGXN]U[]LO
PMYOCW\XU\Y]MWORPOK][STZW[YRZJ]UOXORU\H' \QXZ],XD[F
MSMRMSZI]ZCZY]ZC]AZQ\P\U\]LZX]TVXRVKV]\W\XR:]UOXOROYOY
MWOA]MWR\UVEV]QGYNYU[TZ]PMXOQ\F]JO]T\XJVWVEVYV]I[XUZ
'1NJNJ]MX\YW\XVY\]L\TSVEVYVKU\]B[XC[TS[Y]QNKU[];*
MX\YVYU\]UNJNJ]CMT]UX\R\SZT]LZX]UNJNTH]NYTN]MSMRMSZI
P[TSGXN]Q\TW\JVT])@@=.@@]LZYWZT]L\YU\]OW\JR\T]ZCZY]CMT
DZUUZ]K\R\Y]>\XD\UVH];@?@=??=?;]QVWW\XV]\X\PVYU\]\YD\T
.@@]LZY]L\YUVY\]MSOXUOH]ZRUZ]LZXU[Y]LZX[]/@@=(@@]LZY
L\YUVY\]B[XZW[RZJ]MWR\PV]TZ]LZK]LO]P[Y[YZY]PMYOYU\
Q\TW\JVT]/*@]LZY]DZI\XVYU\]MW\D\EVYV]PGQW[Q[LZWZXZR
JZRUZU[YH]MT]DZUUZ]LZX]B[XZ]C[TZWR[H]<O]\YW\RU\]U\
T\QL[UZWRZJ]QVWW\X]PGK]TMYOPOH]0VXRVKV]UZQ[R[Q[D[EZR
\R\]CMT]DZUUZ]LZX]P\XV]\W\XR]PGK]TMYOPOH]5WVYRVJ]MW\Y]S=
[ULZXW[XZY]P[XS]MWUOEOYO]BGXNQMXOKH]4[X[T]TX[UZ
TOWW\YVRVY\]Q[YZWZT]S[ULZXW[XZF]B[X[T]"9]MX\YW\XVYU\
\XSVJ]I[]B[X[T]TMY#MYTSNX[W][ST[YW[X]LZXW[JZYD[]DZUUZ]LZX
U\X\WR\]PGK]TMYOPOH]+RZUZRZK]P[Y[YZY]ZTZYDZ]Q\XVPVYU\
LZX]RZTS\X]SMA\XW\YR\YVY]MWR\PV]I[];*]U\X\WR\YVYF]B[Y[
LZX]U\X\WR\]ZW[]T\A\S\D\EVK]\R\]U\>\]R\TOW]P[IZQ[W[X[
B[WR[PZ]J[TWZYU[H'-SMRMSZI]P[TSGXNYU[]X[T\L[SZY]LMQO=
SOYOY]>[X]B[C[Y]BNY]\XSSVEVY\]UZTT\S]C[T[Y],XD[F
'4[XC[TS[Y];@@(]PMYX\PVYU\]Q\J\Y\Y]UNYQ\U\TZ]TXZK]TZ
LO]<NQNT]<O>X\Y:U\Y]PMYX\][Y]LNQNT]TXZK]MW\X\T
\UW\YUVXVWVQMXH]-SMRMSZI]P[TSGXNYN][STZW[UZEZ]BZLZ]SNT[SZ=
DZ]Y[KUZYU[]LNQNT]LZX]BNI[Y]T\QLVY\]Y[U[Y]MWUOEO]ZCZY
LNSNY]P[TSGXW[XU[]U\X\WR\]B[SZXUZH]1NYQ\]B[Y[WZYU[
LGQW[]LZX]PVTVYSV]R[IDOST[YF]5IXOA\]A\K\XVYU\]CMT]UX\=
R\SZT]LZX]UNJNJ]MWUOH]5IXOA\]A\K\XV]?)=?.]RZWQMYW\XU\Y
?7]RZWQMY\]T\U\X]UNJSNH]<ZKZR]SZD\XZ]A\XSY[XZRZK]5IXO=
A\H]1MW\QVPVQW\]5IXOA\]A\K\XVYU\]XMS\Q\]CVT\Y]T\A\PZS[
2\KW\PV]X[T\L[SZ]\XSVXUVH]<O]U\]9NXTZQ[:U[]MSMRMSZIU[
X[T\L[SZ]NPS]P[IZQ[Q[]B[SZXUZH]<O]U\]T\XW\XVY]U\X\WR\PVY\
Y[U[Y]MWUOH']Z2\U[W[XZYZ]TOWW\YUVH],XD[F]'<O]MW\QV][ST=
ZW[Q[Y]LZXCMT]2\TSGX]I\XH]0MY#MYSNX[W]Y[U[YW[XF]P[TSGXNY
T[YUZ]UZY\RZTW[XZ]I\X]I[]U\EVSVR]SNKNEN]I\XH]1\EVSVR
SNKNEN]ZW[]ZWBZWZ]5<:Q[]LZX]OQOR]PNX[DZ]Q\J\UVTH];@@/
QVWVYU\Y]ZSZL\X[Y]5<]ZW[]R[IKO\S]\CVPVYU\Y]\QYV]YMTS\Q\
B[WUZTH]5<]LO]TMYOU\]LZX]\UVR]U\>\]ZW[XZ]\SSVH];@?@
QVWVYU\]P\SVJ]PMYX\PV]ZW[]ZWBZWZ]U\EVSVR]SNKNEN]MXS\Q\]TMQ=
UOH];@?$]QVWVYU\]U\]P\SVJW\]ZWBZWZ]LZX]U\EVSVR]SNKNENYN
U[IX[Q[]PMTSOH]<ZKZR]L[TW[YSZRZK]9NXTZQ[:U[]U[]L[YK[X
\UVRW\XVY]TVP\]PNX[U[]\SVWR\PV]J[TWZYU[H']UZQ[X[T]PGKW[XZ=
YZ]PMYW\YUVXUVH]
Türkiye tekstilde 2012 yılında 11 milyar dolar ile dünyanın en büyük yedinci ihracatçı ülkesi konumuna yükseldi. Tekstilin 2004 yılına kıyasla 2011 yılında girişimci, ücretli çalışan,
üretim, katma değer ve yatırımlar açısından toplam imalat sanayi içindeki payı ise düştü.
İSO Başkanı Erdal Bahçıvan, “Tekstilde büyük teknoloji merkezlerine ihtiyacımız var. Biz
İSO olarak bu tür vizyoner yaklaşımlara her zaman şemsiye örgüt olmaya hazırız.” dedi
6PS\YLOW]8\Y\QZ]-U\PV:YU\]S[TPSZW]NXNYW[XZ]ZR\W\SVYV
S[RPZW][U[Y]L[J]TMRZS[YZY]T\STVW\XV]ZW[]MWOJSOXOW\Y]%9[T=
PSZW]+XNYW[XZ]6R\W\SV]8\Y\QZ]8[TSGX]\AMXO]\CVTW\YUVH
9+60]I[XZW[XZ]L\K]\WVY\X\T]>\KVXW\Y\Y]X\AMX\]BGX[F
9NXTZQ[]S[TPSZWU[];@?;]QVWVYU\]Q\TW\JVT]??]RZWQ\X]UMW\X
Z>X\D\SV]ZW[]UNYQ\YVY][Y]LNQNT]Q[UZYDZ]Z>X\D\SCV]NWT[PZ
TMYOROY\]QNTP[WUZH]8[TSGXNY];@@7]QVWVY\]TVQ\PW\];@??
QVWVYU\TZ]BZXZJZRDZF]NDX[SWZ]C\WVJ\YF]NX[SZRF]T\SR\]U[E[X
I[]Q\SVXVRW\X]\CVPVYU\Y]SMAW\R]ZR\W\S]P\Y\QZ]ZCZYU[TZ
A\QV]ZP[]UNJNJ]BGPS[XUZH68-]1\YVJR\YV]\Y]!O\X]4NX=
W[P[W:ZY]\CVTW\UVEV]X\AMX\]BGX[F]9NXTZQ[]S[TPSZW]P[TSGXN
;@@*]QVWVYU\](F@)]RZWQ\X]UMW\X]MW\Y]Z>X\D\SVYV];@?;
QVWVYU\]??F@.]RZWQ\X]UMW\X\]QNTP[WS[X[T]UNYQ\YVY]Q[UZY=
DZ]LNQNEN]MWUOH]8[TSGXF][Y]CMT]Z>X\D\SV]ZP[]OPQ\F]5W=
R\YQ\F]6S\WQ\F]5<1]I[]8OOUZ]5X\LZPS\Y:\]B[XC[TW[JSZXUZH
<OYOYW\]LZXWZTS[]P[TSGXNY]\QYV]UGY[RU[]9NXTZQ[:YZY
SMAW\R]Z>X\D\SVYU\Y]\WUVEV]A\Q].F/%U\Y]QNKU[])F?%[]B[X=
ZW[UZH]&ZY[]\QYV]UGY[RU[]7F77]RZWQ\X]UMW\X]MW\Y]S[TPSZW
ZS>\W\SV]ZP[]/F*.]RZWQ\X]UMW\X\]QNTP[WZXT[YF]SMAW\R]ZS>\W\S
ZCZYU[TZ]A\QV]U\]QNKU[]$F)%U[Y]QNKU[];F)%[]ZYUZH9[TPSZW
P[TSGXNF];@@7]QVWVYU\Y]LO]Q\Y\]ZPSZ>U\R]I[]T\SR\]U[E[X
Q\X\SR\U\]LNQNR[]BGPS[XZXT[YF]\QYV]L\J\XVQV]SMAW\R]Z=
R\W\S]P\Y\QZ]ZCZYU[Y]\WUVEV]A\Q]MX\YVYU\]BGPS[X[R[UZH
<OY\]BGX[]P[TSGXNY];@@7]QVWVYU\]?.]LZY](;/]MW\Y
BZXZJZRDZ]P\QVPV];@??]QVWVYU\];$]LZY]?;]TZJZQ[]QNTP[WUZH
5QYV]UGY[RU[]QNKU[];F/]\XSVJW\]$7;]LZY]7(7]TZJZQ[]ZPSZ>=
U\R]Q\X\S\YF]NX[SZR]U[E[XZYZ]$?F/*]RZWQ\X]9:U[Y]*.F(/
RZWQ\X]9:Q[]CVT\XR\]L\J\XVPV]BGPS[X[Y]P[TSGXF]T\SR\
U[E[XZYZ]ZP[](F)]RZWQ\X]9:U[Y]??F)?]RZWQ\X]9:Q[
CVT\XUVH]9[TPSZWZY]9NXTZQ[:YZY]SMAW\R]ZR\W\S]P\Y\QZ]ZCZY=
U[Y]\WUVEV]A\Q]ZP[]T\QL\]OEX\UVH]<OY\]BGX[]S[TPSZW
BZXZJZRDZPZYZY]ZR\W\S]P\Y\QZ]ZCZYU[TZ]A\QV];@@7]QVWVYU\
QNKU[](]ZT[Y];@@?]QVWVYU\]QNKU[]/F.:\]UNJSNH]8[TSGXNY
NDX[SWZ]C\WVJ\Y]ZCZYU[TZ]A\QV]\QYV]UGY[RU[]QNKU[]?/:U\Y
QNKU[]?;:Q[F]NX[SZR]U[E[XZYU[TZ]A\QV]QNKU[]??:U[Y
QNKU[].:\F]T\SR\]U[E[X]ZCZYU[TZ]A\QV]QNKU[]??F]/:U\Y
QNKU[].F;:Q[]I[]Q\SVXVRW\X]ZCZYU[TZ]A\QV]QNKU[]?/F7:S[Y
QNKU[][email protected](:[]UNJSNH]8[TSGXNY]NX[SZRZ]U[];@@*=;@?;
QVWW\XV]\X\PVYU\]QNKU[])]B[XZW[Q[X[T]MXS\W\R\]ZR\W\S
P\Y\QZ]NX[SZR]LNQNR[PZYZY]\WSVYU\]T\WUVH]8[TSGXU[];@??
QVWVYU\TZ]Q\SVXVR]SOS\XV]ZP[]*F;$]RZWQ\X]9]MWUOH<O]\X\U\
TMRZS[]NQ[W[XZF]2ZXR\W\X]I[]PZIZW]SMAWOR]TOXOWOJW\XV]S[R=
PZWDZW[XZYZY]T\SVWUVEV]%9[TPSZWZY]1MTOYUOEO]9MAX\TW\X%
L\JWVTWV]SMAW\YSVYVY]\CVWVJ]TMYOJR\PVYV]Q\A\Y]68-]&GY[=
SZR]0OXOWO]<\JT\YV],XU\W]<\>CVI\YF]P[TSGXNY
9NXTZQ[:YZY]ZPSZ>U\R]I[]Z>X\D\SV]ZCZYU[]GY[RZYZY]U[I\R
[SSZEZYZF]GK[WWZTW[]6PS\YLOW]I[]>\IK\PV]ZCZY]>\W\]LNQNT
GY[R]S\JVUVEVYV]T\QU[SSZH]9[TPSZWU[]S[TYMWM#ZF]ZYMI\PQMY
I[]5X=4[:YZY]GYD[WZTWZ]TMYOW\X]MWR\PVYV]B[X[TSZEZYZY
\WSVYV]CZK[Y]<\>CVI\YF]JGQW[]TMYOJSO]5XSVT][EZSZR
T\WZS[PZ]UNJNTF]LZWBZ]LZXZTZRZ]I[]5X=4[]T\A\PZS[PZ]K\QV2F
ZYMI\PQMY]I[]S\P\XVR]BNDN]Q[S[XPZK]NWT[W[XZ]I[]P[TSGXW[XZ
UNYQ\]X[T\L[SZYU[]CMT]U\>\]KMX]BNYW[X]L[TW[UZEZYZ]LZW=
[X[T]>\X[T[S][SR[WZQZKH]&NTP[T]T\SR\]U[E[X
Q\X\S\RVQMXOKF]ZW[XZ]S[TYMWM#Z]NX[S[RZQMXOKH]!\T\S
NX[S[R[UZEZRZK]S[TYMWM#ZQZ]TOWW\YR\TW\]GINYNQMXOKH
<O][Y]CMT]U\]S[TPSZW]P[TSGXNRNK]ZCZY]B[C[XWZUZX]I[]CMT
NKNDN]LZX]UOXORUOXH]<O]Y[U[YW[][WU[][SRZJ]MWUOEOROK
U[E[XW[XZ]\XSVT]Q\L\YDVW\XVY]R\TZY[]A\XTVY\]>\XD\R\YVY
GYNY[]B[C[D[T]\CVWVRW\X]Q\A\LZWR[WZQZKH]9[TPSZW]P[T=
SGXNRNK]LO]\YW\RU\]T[YUZ]R\TZY[PZYZ]NX[S[LZW[D[T
S[TYMWM#ZW[XZ]Q\X\S\LZWR[WZUZXH]8[TSGXU[]NYZI[XPZS[=
P\Y\QZ]ZJLZXWZEZYZY]GY[RZY[]U[]UZTT\S]C[T[Y]<\>CVI\YF
JGQW[]U[I\R][SSZ]
68-]MW\X\T]8\Y\QZ]4[WZJSZXR[]W\S2MXRO:YOF]6PS\Y=
LOWOROKOY][Y]LNQNT]L[J]NYZI[XPZS[PZ]<ME\KZCZF]6PS\Y=
LOWF]3\XR\X\F]69+]I[]&VWUVK]9[TYZT]NYZI[XPZS[W[XZYZY
T\SVWVR]I[]T\STVW\XV]ZW[]TOXROJ]LOWOYOQMXOKH]<O
ZJLZXWZEZYU[Y]S[TPSZW]P[TSGXNRNKNY][EZSZR]\W\YVYU\TZ
\CVEV]ZW[]ZWBZWZ]U[]GY[RWZ]CVTSVW\X]\W\D\EVRVKV
UNJNYNQMXORH],EZSZRZY]Q\YVYU\]LNQNT]S[TYMWM#Z]R[XT[=
KW[XZY[]Z>SZQ\DVRVK]I\XH]<ZK]68-]MW\X\T]LO]SNX]IZKQMY[X
Q\TW\JVRW\X\]>[X]K\R\Y]J[RPZQ[]GXBNS]MWR\Q\]>\KVXVKH
"K[WWZTW[]P[TSGXNRNKNY]U[E[XWZ]S[RPZWDZW[XZYZ
OWOPW\X\X\PV]A\K\XW\X\]\C\D\T]I[]X[T\L[SS[]NPSNYWNT
P\EW\Q\D\T]OWOPW\X\X\PV]S[TPSZW]2O\X]I[]TMYBX[PZ
Q\AR\W\XVY\]U\]MU\]MW\X\T]>[X]SNXWN]U[PS[EZ]I[X[D[EZRZK
GK[WWZTW[]IOXBOW\R\T]ZPSZQMXORH
\AMXOY][W[]\WVYUVEV]I[]P[TSGXNY]PMXOYW\XV]ZW[]CGKNR
GY[XZW[XZYZY]S\XSVJVWUVEV]MSOXORU\]TMYOJ\Y]68-]3[DWZP
<\JT\Y]&\XUVRDVPV]I[]6PS\YLOW]9[TPSZW]I[] \RR\UU[W[XZ
6>X\D\SCVW\XV]<ZXWZEZ]<\JT\YV]6PR\ZW]4NWW[F]NX[SZR]I[
Z>X\D\S]TMYOPOYU\]YZS[WZTWZ][W[R\Y]Q[S[XPZKWZEZYZY]CMT
LNQNT]LZX]PMXOY]S[JTZW][SSZEZYZ]PGQW[UZH
-SOXOR\](H]4XOA]6AWZT]8\Y\QZ]3[PW[T]0MRZS[PZ
<\JT\YV]]3[>R[S]5UY\Y]"D\WBZX\QF])H]4XOA]1MTOR\
0OR\J]8\Y\QZ]3[DWZP]+Q[PZ]I[]3[PW[T]0MRZS[PZ
<\JT\Y]&\XUVRDVPV]5WZ]8\RZ]5QUVYF].H]4XOA]9[TPSZW]9[X=
LZQ[F]<\PTVF]\TVJF]<XMU[F]"XR[]0OR\J]I[]9XZTM]4ZQZR
8\Y\QZZ]3[DWZP]+Q[PZ]I[]3[PW[T]0MRZS[PZ]<\JT\YV]3H
8[WCOT]8\UVXF][email protected]]4XOA]4ZQZR]1VJV]9[TPSZWF],I]9[TPSZWZ
I[]1MTOYR\RVJ]+XNYW[X]8\Y\QZ]3[DWZP]+Q[PZ]I[
3[PW[T]0MRZS[PZ]<\JT\YV]5WZ]\2[X]ZJR\Y]I[]??H]4XOA
0MY2[TPZQMY]&\Y]8\Y\QZZ]3[PW[T]0MRZS[PZ]+Q[PZ]-P=
R\Y],B[]T\SVWUVH Avusturya’nın Ankara Ticaret
Ataşesi Dr. Christian Maier, Bolu
Ticaret ve Sanayi Odası (TSO)
Başkanı Türker Ateş’i makamında
ziyaret etti. Pazar araştırması
yaptıklarını belirten Maier, Bolu’dan ahşap ve kereste ithal etmek
istediklerini söyledi. Türker
Ateş’ten Bolu hakkında ayrıntılı
bilgi alan Maier, her şeyin
mükemmel göründüğünü söyledi.Avusturya’nın Ankara Ticaret
Ataşesi Dr. Christian Maier, pazar
araştırması için geldiği Bolu’da
TSO Başkanı Türker Ateş ile
buluştu. TSO’daki makamında
Ateş’i ziyaret eden Maier, TSO ve
Bolu hakkında ayrıntılı bilgi aldı.
Bolu’nun bir turizm ve üniversite
şehri olduğunu söyleyen Ateş,
Bolu’nun gelişmekte olduğunu
ve umut vaad ettiğini belirtti.Bolu
TSO Başkanı Türker Ateş, “3 bin
civarında üyemiz var. Üye kaydı
her gün artıyor. Bolu gelişmekte
olan bir il. Daha da gelişeceğiz.
Ülke olarak Gayri Safi Milli
Hâsılamız 10 bin dolar civarında.
Bunu 20 bin dolar seviyesine
çıkardığımız zaman ülke
içerisinde bir döngü olacak ve
gelişme potansiyelimiz artacaktır.
Avusturya’yı yakından takip ediyoruz. Bolu olarak ülkenizle yakın
ilişki içerisindeyiz. Avusturyalı
yatırımcıları ilimize bekliyoruz.
Bolu’nun Avusturya ile ihracatı
ithalatından fazla şu anda. Bolu ve
Avusturya stratejik ortaklık yapabilir diye düşünüyorum. Bunu
yapmamız her iki taraf için de
faydalı olacaktır. Yakın zamanda
Bolu’da gümrük Müdürlüğü
açılacak. Bu ticaret için artı bir
değer olacak. Sanayimiz gün
geçtikçe gelişiyor. Hizmet sektöründe gelişmiş durumdayız.
Hizmet sektöründe en büyük
kalemimiz turizmdir. Doğanın bize
verdiği artı bir değer var. Bu nedenle turizmde ileri bir seviyeye
çıkıyoruz. Kanatlı sektöründe
kümelenme söz konusu ve bu
kümelenme sektörün
gelişmesinde önemli bir sebep
teşkil ediyor. Diğer sektörlerde de
bunu sağlayıp o sektörlerin
gelişmesinin önünü açmak istiyoruz. Bolu olarak metal sanayinin
önünü açmamız lazım. İlaç sektörü içinde Bolu ideal bir şehirdir.
Gerekli bütün koşullar burada
mevcut. İlaç sanayisi için firmaları
buraya davet ederek bu sektörün
Bolu’ya gelmesini sağlamamız
lazım.” dedi.Yatırımcılar için
pazar araştırması yaptıklarını
söyleyen Avusturya’nın Ankara
Ticaret Ataşesi Dr. Christian
Maier, Bolu’nun orman ürünleri
sektöründe gelişme potansiyeline sahip olduğunu ifade etti.
Maier, konuşmasını şöyle
sürdürdü: “10 yıldır Türkiye’deyim ama Türkçeyi öğrenmeye 20
yıl önce başladım. Bolu her
açıdan güzel bir şehir. Mengen
çok meşhur ülkemizde. Aşçılık
eğitimi için Mengen’e gelen
vatandaşlarımız var. Mengen bir
markadır. Sizin bölgeniz ile Avusturya arasında büyük bir benzerlik
var. Doğamız ve havamız birbirine
çok benziyor. Turizm ve makine
sektörü ülkemizde gelişmiş durumda. Enerji konusunda
gelişiyoruz. (CİHAN)
Mayıs 2014
8 1Şubat
2013Perşembe
Perşembe
Otomotiv sektöründeki yüksek rekabetin otomobil fiyatlarını düşürdüğü kaydedildi. Araç satış karlılıklarının
sağlayıcılar için yüzde 4 seviyesine gerilerken, dağıtıcılar için yüzde 3'e indiği belirtildi. Otoparklardaki ortalama araç yaşının 12 olduğu dile getirilirken, ilerleyen yıllarda araç talebinin artacağı bildirildi
Rekabet Kurumu ve Uludağ Üniversitesi
(UÜ) işbirliği ile UÜ Mühendislik Mimarlık
Fakültesi Otomotiv Mühendisliği
Bölümü’nde '12. Rekabet Hukuku ve
İktisadında Güncel Gelişmeler Sempozyumu' düzenlendi. Sempozyuma, Rekabet
Kurumu Başkanı Prof. Dr. Nurettin
Kaldırımcı ile UÜ Rektörü Prof. Dr.
Kamil Dilek, sektör temsilcileri ve
öğrenciler katıldı. Programda,
Rekabet Kurumu Uzmanları
Zeynep Şengören ve Recep
Gündüz tarafından hazırlanan
'Motorlu Taşıtlar Sektör
Araştırma Raporu' paylaşıldı.
Raporun; sektörde 59
markanın distribütörü olan
39 sağlayıcı ile sayıları 2
bin 500 olan yetkili bayi ve
servisle, 200 civarında
yedek parça üreticisi ve
150’ye aşkın bağımsız
servisle birebir görüşme
sonucunda elde edilen verilerin derlenmesiyle
oluşturulduğu ifade edildi.
Zeynep Şengören,
araştırmada araç parkları
konusundaki ilgi çekici
sonuçlar elde ettiklerini ifade
ederek, şunları dile getirdi:
“Araç parkı bakımından ilk
dikkatimizi çeken husus, parkta
binek araçların yoğunluğu oldu.
Parkın yaklaşık yüzde 70’i binek
!(*! (((&
Organize Sanayi Bölgeleri Üst
Kuruluşu (OSBÜK) Yönetim Kurulu
Başkanı ve Gaziantep Organize
Sanayi Bölgesi Yönetim Kurulu
Başkanı Cahit Nakıboğlu, sanayide
ödenen elektrik faturalarındaki TRT
payının kaldırılması gerektiğini belirtti
TBMM Sanayi, Ticaret, Enerji, Tabii Kaynaklar, Bilgi ve Teknoloji Komisyonu
üyeleri ve OSBÜK yönetim kurulu üyeleri,
Gaziantep Organize Sanayi Bölgesi
Başkanlığı’nı ziyaret etti. Ziyarette,
Gaziantep OSB ve OSBÜK Başkanı Cahit
Nakıboğlu, komisyon üyelerine kent
sanayisi ve sorunları hakkında bilgi verdi.
Yerli sanayiye sahip çıkılması ve
sanayicinin desteklenmesi gerektiğini belirten Başkan Nakıboğlu, “2023 vizyonu
çerçevesinde hedeflerimize ulaşabilmemiz
için sanayici her konuda desteklenmelidir.
Mesela bunlardan birisi elektrik
faturalarındaki TRT payıdır. Biz sanayiciler
olarak elektrik faturalarındaki yüzde 2’lik
TRT payının kaldırılmasını istiyoruz.” dedi.Nakıboğlu, 3 bin 600 gününü dolduran
çalışanların tazminatlarını alıp iş yerlerinden ayrılmasından dolayı da sıkıntılı
olduklarını kaydetti. Nakıboğlu, “Bizler
çalışanlarımıza her türlü imkanı sağlıyoruz.
Yurt dışına gönderip eğitimler aldırıyoruz.
Fakat 3 bin 600 gün sigortasını
doldurduğu anda çalışan tazminatını alıp
rakip firmaya geçiyor. Bizlerin de bunca yıl
vermiş olduğumuz emekler boşa gidiyor.
Bu durum nasıl düzeltilir bilemiyorum ama
sanayiciler bu konuda çok dertli.” ifadelerini kullandı. (CİHAN)
araçlarından oluşuyor. Bunu kamyonetler
ve diğer araçlar takip ediyor. İkinci
tespitimiz araç parkları yılar itibariyle
büyüyor. Bir diğer tespitimiz ortalama araç
yaşı 12 olarak hesaplanıyor. Bu Avrupa ile
kıyaslanınca yüksek bir oran. Bunun önemi
şu, birincisi satış bakımından araçlar yaşlı,
ilerleyen yıllarda araç talebi olacaktır. İkinci
önemi ise satış pazarı açısından ortaya
çıkıyor. Yaşlı araçlar daha fazla bakıma ihtiyaç duyuyor. Araç yaşlarına göre tüketicilerin servis tercihleri de değişiyor.” Satış
adetleri bakımından sektörde ithal araçların
yoğun olduğuna dikkat çeken Şengören,
“Satılan araçların yüzde 60’a yakını ithal. Bu
şu açıdan önemli, sektör döviz kuru gibi
makro ekonomik değişkenlerden etkileniyor. Satış adetleri yıllar itibariyle
dalgalanıyor. Dolayısıyla istikrarsız bir talep
yapısı var.” dedi. Binek araç pazarının
oldukça rekabetçi bir görüntü sergilediğini
ve tebliğ sonrası (2007) daha da arttığını
vurgulayan Şengören, ticari araçlar
bakımından daha orta derecede
yoğunlaşmış bir pazar yapısı ile karşı
karşıya olunduğunu kaydetti. Toplam pazarda binek araç yoğunluğuna işaret etti.
Şengören, raporun otomotiv fiyatları
konusundaki sonuçları hakkında şu bilgileri
verdi: “Otomobil fiyatlarının enflasyonun
gerisinde bir artış gösterdiği dolayısıyla reel
olarak artmadığını görüyoruz. Bunu rekabet
yapısıyla birlikte değerlendirdiğimiz zaman,
sektörde fiyat artışlarını baskılayan bir rekabet düzeyinin olduğunu söylememiz
mümkün.”Kar marjlarının düştüğünü ifade
eden Şengören, şöyle devam etti: “Binek ve
ticari araç segmentinde araç sağlayıcılarının
vergi öncesi kar marjlarına baktığımızda zaten yüzde 5’ler seviyesinde olan araç satışı
kar marjlarının tebliğ sonrası daha da
düştüğü, buna karşın satış sonrası yedek
parça satışlarındaki kar marjlarının satışa
göre çok daha yüksek olduğu ve tebliğ
sonrası daha arttığı görülüyor. Aynı görüntüyü ağır ticari araçlar pazarında da görüyoruz. Satış pazarı karlı bir Pazar değil, satış
sonrası Pazar daha karlı bir Pazar ve
satıştaki az karlılık, satış sonrası karlılıkla
sübvanse ediliyor.” Recep Gündüz ise
araçların satın alınmasından sonraki pazar
yapısı hakkında bilgi verdi. Sadece satış ve
servis hizmeti veren dağıtıcı sayısının hem
tebliğ öncesi hem de tebliğ sonrası
dönemde yatay bir seyir izlediğini dile getiren Gündüz, üç hizmeti (3S) de
sağlayanların sayısının tebliğ sonrasında iyice arttığını vurguladı. "Satış pazarındaki
sonuçlar rekabetçi bir görünüm olduğunu
gösteriyor. Öte yandan pazara her seviyede
yeni girişler halen var. Satış pazarlarındaki
kar marjlarının satış sonrasına göre oldukça
düşük olduğunu görüyoruz. Bunlar,
sağlayıcılar düzeyinde yüzde 4, dağıtıcılar
için yüzde 3 düzeyinde. Son bir iki yıl içinde
bu kar marjlarının daha da baskılandığını
gördük. Rekabet açısından en önemli
sonuç, satış pazarında araç fiyatlarında
önemli bir artışın olmadığını söylememiz
mümkün." (CİHAN)
)*%)")*")$)
#"#$%**))$))%
Harran Üniversitesi Öğretim Üyesi Prof. Dr. Çullu: "Şanlıurfa'nın verimli ovalarının suya
kavuşmasıyla kentteki mevsimlik işçi göçünün azalacağını bekliyoruz"Ziraat Mühendisleri Odası
Şanlıurfa Şube Başkanı Öztürkmen: "Sulama alanları artıkça mevsimlik göç tersine dönecektir"dedi
5XSRLYVICVKVY-XSXY31SORPYPWTQVYOXSUXLQXYCXURIRNJSMLA
FVDVLYVCVTYG?CYKJTXYWSQV3Y*XSSXTYTVEWSKVOWKVYVSXXO
XPHUOWKVY,BSWOVLYNWKVYSJ@>Y&S>Y)W:LWOY1UVYMUUMA
[email protected];
OWPVYLWEKVLUVPYVICVYG?CHTHTYXDXUX=XBRTRYFWPUVNJSMD3
QWQV*XSSXTYEWY(MSMCYJEXUXSRAY+HTWNQJBMY1TXQJUMYSJ"W;
KVYPX<KXLRTQXYNRUUXSQRSY:XKSWOYPXUQRBRYKMNXYPXEMIOM>Y)JQ;
WSTYOXSRLYOWPTVPUWSVTVTYQWESWNWYGVSLWKVAYNWTVYVKOV:QXL
[email protected]:RTYNHPKWULWKVNUWYF?UGWYVTKXTRTRT
LWEKVLUVPYG?CYNJU=MUMBMTMTYXDXUQRBR
G?DUWTVNJS>PJTJLVPYPXNGRUXSYTWQWTVNUWY:WSYNRUYTVKXT;
PXKRLYQ?TWLVTVYOXSRLYKWPO?SHTHTYNJBMTYJUQMBMYF?UGWU;
WSQWYKXBURPKRDYIXSOUXSQXYGWCVSLWPYDJSMTQXYPXUXTYXVUWUWSYVKW
XSORPYLWLUWPWOUWSVTQWYCXURILXYVLPXTRYFMULXNXYFXIUXQR>
+VOOVPUWSVYNWSUWSQWYNXIXLYLH=XQWUWKVYEWSWTYOXSRL
VICVUWSVTVTYCJ=MPUXSRYQXYXSXYEWSLWPYDJSMTQXYPXUQRPUXSR
WBVOVLUWSVTWYJPMUUXSRTQXYQWEXLYWOLWYVLPXTRYFMUX=XP>
*XSSXTY EXKR6TRTYXSQRTQXTYMNGMUXTXTYVUWSVYOWPTJUJ"VUWS
KXNWKVTQWY/YNRUYGVFVYPRKXYFVSYKHSWQWYOXLXLUXTXTYEW
7XIFXPXTYW=W<Y5XNNV<YSQJBXT6RTYXCRURIRTR
GWSCWPUWIOVSQVBVY(MSMCY5HTWUVYVUWYJEXTRTYKMNXYPXEMILXKR
LWEKVLUVPYG?CHTYXDXULXKRTQXYWTY?TWLUVYWOPWTYJUXSXP
QWBWSUWTQVSVUVNJS>*XSSXTYTVEWSKVOWKVYVSXXOYXPHUOWKV
,BSWOVLYNWKVYSJ@>Y&S>Y)W:LWOY1UVYMUUMAY11
LM:XFVSVTWYNX<ORBRYXCRPUXLXQXY(MSMCY EXKR6TRTYF?UGWTVT
WTYFWSWPWOUVYJEXKRYJUQMBMTMYFWUVSOOV>8%.9YNRURTQXTYVOVFXSWT
[email protected]@XSPURYF?UGWUWSWYGVO;
LWPYDJSMTQXYPXUQRBRTRYXTUXOXTYMUUMAYI?NUWYQWEXL
WOOV37MYNRUYJEXTRTY?TWLUVYFVSYF?UHLHYKMUXTLXKR
<UXTUXTRNJS>Y&JUXNRKRNUXYFVOPVKWUYHSWOVLYXSOX=XBRYVCVT
[email protected]:WNW=XTYEWYXSXDVUWSWYJUXTYOXUW<YXSOLXNX
FXIUXQR>Y(MUXLXYKJTSXKRYFVOPVKWUYHSWOVLQWY?TWLUVYXSORIUXSRT
WUQWYWQVUW=WP>[email protected]
PXEMILXKRNUXYPWTOOWPVYLWEKVLUVPYVICVYG?CHTHT
XDXUX=XBRTRYFWPUVNJSMD>Y*XOOXYPRKXYKHSWQWY&VNXSFXPRSA
1QRNXLXTAY)XSQVTYEWYCWESWYVUCWUWSQWTYVTKXTUXSRTYFMSXNX
CXURILXNXYGWUW=WBVTVYQHIHTHNJSMD>3YVSXXOY)H:WTQVKUWSV
[email protected]'MFWY7XIPXTRY1UVYRDXY,DOHSPLWTYQW
[email protected]$99YFVTYPVIVTVTYOXSRLYVICVKVYJUXSXP
5HSPVNW6TVTY2.YVUVTWYCXURILXNXYGVOOVBVTVYEWYFMTUXSRTY899
FVTVTVYJPMUYCXBRTQXPVYCJ=MPUXSRTYJUMIOMSQMBMTM
FWUVSOOV>[email protected]<JOXTKVNWUVTVTYCJPYNHPKWP
JUQMBMTMYEWYKMUMYOXSRLRTYXSOLXKRNUXYFMYG?CHTYKJTXYWS;
LWKVTVYFWPUWQVPUWSVTVYXTUXOXTY,DOHSPLWTAYIMTUXSRYPXNQWO;
OV3(MUMYOXSRLYXUXTUXSRYGWTVIUWQVPCWY<XLMPAYOX:RUYHSHTUWSVA
@RKORPYEWYLWNEW=VUVPOWYQX:XYGWTVIY<J<HUXKNJTUXS
NXSXORUX=XPYEWYOXSRLYVICVUWSVYFXIPXYNWSWYGVOLWPYNWSVTWYPWT;
QVYOXSUXUXSRTQXYCXURILRIYJUX=XPUXS>Y(MSMCY EXKR6TRT
[email protected]<J<HUXKNJTMYJUXTY29YP?NWYKM
EWSVULWKVY<UXTUXTRNJS>Y(MUXLXYXUXTUXSRYXSORPCXYLWEKVLUVP
G?CYOWSKVTWYQ?TW=WPOVS>[email protected];
UWLWKVTVYEWYWUQWYWOOVBVLVDYHSHTUWSVTYFMSXQXYVIUWTLWKVYVU;
VLVDVY:WSYXUXTQXYGWUVIOVSW=WPOVS>3Y5XSRLYVICVKVY&W:XLY-XSX
VKWY<XSXYPXDXTXFVULWPYVCVTYNRUUXS=XYXVUWKVNUWYCY1TXQJUM
7?UGWKV6TWYGVOOVBVTVYK?NUWQV>Y-?NUWSVTVTYKMUXLXYVLPXTRTX
PXEMIOMBMTMYXTUXOXTY-XSXAY37MYKXNWQWYXSORPYPWTQVYOXSUXL;
QXYCXURIRNJSMLAYFVDVLYVCVTYG?CYKJTXYWSQV3YQWQV>*XKXT
[email protected][email protected]
WQWSWPAY37MYNRUYQXYGVQW=WBVDYXT=XPYP?NHLHDWYKM
GWULWKVTVYFWPUVNJSMD>YTIXUUX:YFMYNJU=MUMBMLMDYKJTX
[email protected]> # '&*' '*'&!&*
Türkiye Cumhuriyeti Merkez Bankası (TCMB), yıllık enflasyondaki artışta gıda fiyatları seyrinin belirleyici
olduğunu kaydetti. Merkez, “Bu dönemde, Türk lirasındaki değer kaybının birikimli etkileri temel mal
fiyatları üzerinde gözlenmeye devam etmiş, çekirdek enflasyon göstergeleri artış eğilimini sürdürmüştür
[email protected]
[email protected]%A4.#WYNHPKWULVIOVS>
7MYQ?TWLQWY,-5+;*YEWY,-5+;YWTQWPKUWSVTVT
NRUURPYXSORIYJSXTRY?T=WPVYXNXYPRNXKUXYKRSXKRNUXY9A/4YEW
9A2!Y<MXTYXSOXSXPYNHDQWY89A9/YEWYNHDQWY%A2YVUW
[email protected]
GWSCWPUWILVIOVS>[email protected]>Y5)76TVTA
[email protected]
NXNRTUXTQR>[email protected]
[email protected]%A4.#W
NHPKWUQVBVYQVUWYGWOVSVUWTYXCRPUXLXQXAYXUOYGSM<UXSRT
[email protected]=WUWTQVBVTQWA
WTYFWUVSGVTYXSORIRTY9A9Y<MXTUXYGRQXYGSMFMTQX
GWSCWPUWIOVBVAYOWLWUYLXUYGSMFMTMTYPXOPRKRTRTYQXY9A!.
<MXTYNHPKWUQVBVYFWUVSOVUWSWPAYI?NUWYQWTVUQVYTWS"VYEW
:VDLWOYGSM<UXSRTRTYPXOPRKRTQXYVKWYFWUVSGVTYFVS
QWBVIVPUVPYG?DUWTLWLVIOVS>Y+RQXYEWYOWLWUYLXU
GSM<UXSRTRTYPXOPRUXSRYFMYQ?TWLQWYKRSXKRNUXY4A!4YEW
!A%!Y<MXTYJUXSXPYGWSCWPUWILVIOVS>Y0VKXTYXNRTQX
:[email protected]//YJSXTRTQX
XSOLRIYEWYGSM<[email protected]$8YVUWYNXOXN
KWNSWOLVIOVS>Y7MYQ?TWLQWAYKXBURPYEWYWBVOVLY:VDLWOUWS;
VTWYFXBURYJUXSXPYQVBWSY:[email protected];
JTMYNMPXSRYN?TUHYKWNSVTVYKHSQHSLHIOHS>Y,OWYNXTQXTA
GRQXYGSMFMTQXPVYJUMLKMDYG?SHTHLWY<XSXUWUYJUXSXPYFVS
KHSWQVSYXSORIYWBVUVLVTQWYJUXTYUJPXTOX;JOWUYGSMFMYNRUURP
[email protected]?TWLYKRTRSURYQXYJUKXYQHIHI
G?DUWTLVIOVS>Y-VSXYEWYMUXIORSLXYPXUWLUWSVTQWYVKWYWT;
@UXKNJTYG?SW=WYRURLURYFVSYKWNVSYVDUWLVIOVS>Y)WEKVLKWU;
UVPOWTYXSRTQRSRULRIYEWSVUWSY:[email protected];
JTMTYXTXYWBVUVLVTVTY0VKXTYXNRTQXYKRTRSURYFVSYLVPOXS
GWSVUWLWPUWYFVSUVPOWYNHPKWPYKWEVNWKVTVYPJSMQMBMTX
VIXSWOYWOLWPOWQVS>[email protected];
JTMTMTY0VKXTYXNRTQXY8A9$Y<MXTURPYFVSYXSORIUXYNHDQW
88A89#XYNHPKWUQVBVAYFMYGWUVILWQWAY5HSPYUVSXKRTQXPV
QWBWSYPXNFRTRTYGW=VPLWUVYWOPVKVNUWYNHPKWUWTYQXNXTRPUR
[email protected]?TY<UXTQXYJUQMBM
PXNQWQVUQV>Y [email protected]
[email protected]
XSORIYNHDQWY4A28YPXNQWOOVBVTWYVIXSWOYWQWTYXCRPUXLXQX
[email protected]?NUWUVPUWAYQXNXTRPURYOHPWOVL
[email protected]/A.#NWYMUXILRIORS>
[email protected]$YVUW
LWEKVLKWUYJSOXUXLXUXSRTRTYHDWSVTQWYXSORIYG?KOWSVSPWT
GSM<[email protected]$8#WYNHPKWULVIOVS>
0VKXTYXNRYGWUVILWUWSVAYOWLWUYLXUYGSMFMTQXYQ?EVDYPMSM
WOPVUWSVTVTYGSM<YGWTWUVTWYNXNRUQRBRTRYG?KOWSLVIOVS>Y7M
QJBSMUOMQXAYLWEKVLKWUUVPOWTYXSRTQRSRULRIYEWSVUWSYQW
GSM<[email protected]
KHSQHBHTWYVIXSWOYWOLVIOVS>Y0VKXTYXNRTQXYWTWS"[email protected]
NHDQWY9A%.YJSXTRTQXYGWSVUWLVIOVS>Y7MYGWUVILWQWAY5HSP
UVSXKRTQXPVYQWBWSUWTLWNWYWPYJUXSXPY&[email protected]
[email protected];
[email protected]=VYJULMIOMS>Y7?NUW;
UVPUWAYWTWS"[email protected]$YVUWYN;
XOXNYKWNSWQWSWPYJUMLUMYKWNSVTVYKHSQHSLHIOHS>Y+RQX
[email protected]
NXPUXIRPY4Y<MXTURPYXSORIUXYNHDQWY84A8/#WYNHPKWUVSPWT
[email protected]?TY<UXTQX
[email protected]>Y Mayıs 2014
81Şubat
2013 Perşembe
Yüksek Seçim Kurulu’na 30 Mart’ta yapılan Mahalli İdareler Genel Seçimi için en
fazla itirazda AK Parti bulundu. AK Parti’nin 131 itirazından 125’ini reddeden
YSK, Cumhuriyet Halk Partisi’nin (CHP) ise 87 itirazından 82’sine ret kararı verdi.
Siyasi partiler 30 Mart’ta yapılan seçimlerle ilgili toplam 278 itirazda bulundu
14;0N*IBMHMN!3NGMHKN-M.BKAKDLNEMHMFIGMINE<7KJ
BL=LJL;LNGK;L=ELHLJKIN*@:IBMHM.LDMHNALHGM;NLJ>KDL
+)A<N?KJGKDLNMHMNDK>LAJKHLNL>LIN9MHELJKHLIN:@
[email protected]?KJLHJKAKBNL>LINBCHMNE)HKIL
G<7KIJKGL3NCHMNE)HKILILINMHGFIGMIN%N#M=BMIF
+<2KI0N,[email protected]+KIKJ
%K>[email protected]?MHLNLJK
AM.MJJLNLGMHKJKHNBKDLINDK>LAND:IC>JMHFIFI
?KJLHJKIGL;LILNGLJKN4KELHKIN+<2KI0N:BNM7NAC.EMHJFB
[email protected]
DK>LAJKHGKN/ [email protected]?M=BMIJF;[email protected]
<@KJL;LNDK>LALNL9EMJNKGLJAL=ELH3N
[email protected]>LAJKHGKNLDKN5,NDK>LANL9EMJ
[email protected][email protected]
DK>[email protected]#CNDKIKN5,
@[email protected]?M=BMIJF;[email protected]?LHJLBEK
[email protected]<@KJL;LN2KNLJN4KIKJNAK8JLDN<@KJL;LNDK>L(
[email protected]*HMNDK>[email protected]+)A<
[email protected]<7KJNBL=LJL;LNGK2MAFN@)I<IGKN2KHLJKI
[email protected]>LA
@M9FJM8MBEFH3N5&NDK>[email protected]:JC9N5,[email protected]
DK>LAN@M9FJM8MBEFH3NGKGL3N
/66'1GMN@M9FJMINAM.MJJLNLGMHLNDK>LAJKHLNLJKN,6
-MHE1EMN@M9FJMINAM.MJJLNLGMHKJKHNDK>LAJKHLNMHMDFIGM
BMH=FJM=EFHAMN@M9MIN+<2KI0N%1IFIN/'N-MHE
/66'1GMN@M9FJMINDK>LAJKHGK0N,6N-MHEN/66'NLJKNDK>LA
D:IC>JMHFIFINLJMINKGLJGL;LN55N-M@FDN/66'1MNBMGMHN?LI
,5/0N,6N-MHEN/65&1EKN@M9FJMINDK>LAJKHGKNLDKN,5N-MHEN
,N-M@FDN/65&NMHMDFIGMN?LIN"&,NBMHMHNMJGF;FN?LJ4LDLILN2(
KHKIN+<2KI0N/66'N-M.MJJLNLGMHKJKHN+KIKJN%K>LALNBKDLI
D:IC>JMHFN55N-M@FDN/66'N4<I<NLJMINKGLJAL=N:JC90N/65&
-M.MJJLNGMHKJKHN+KIKJN%K>LALND:IC>JMHFN5N-M@FDN/65&
LEL?MHFNLJKNMJFIAF=N:JC9N?C4<INKDALN+M7KEK1GK
@M@FAJMIM8MBEFH3N=KBJLIGKNB:IC=EC3NN$MHELN?M7FIGMNLEL(
HM7ND:IC>JMHFIFNGMNM>FBJM@MIN+<2KI0N*N$MHEL1ILIN5,5
LELHM7GMN?CJCIGC;CIC0N?CNLELHM7JMHGMIN1DFIFINBM?CJ
KGLJL9N5/"1LILINHKGGKGLJGL;LILN?KJLHEEL3N$1ILIN !NLEL(
HM7GMN?CJCIGC;CIC0N?CNLELHM7JMHGMIN"1LILINBM?CJ
KGLJGL;LILN2KN /1DLILINLDKNHKGGKGLJGL;LN?LJ4LDLILN2KHKI
+<2KI0N-$1ILIN"6NLELHM7GMN?CJCIGC;CIC0N?CNLELHM(
7JMHGMIN"1LILINBM?CJN&"1LILINLDKNHKGGKGLJGL;LILNGLJKN4K(
ELHGL3NN%L@MDLN9MHELJKHN,6N-MHE1EMN@M9FJMINDK>LAJKHNL>LI
/! NLELHM7GMN?CJCIGC3N#CNLELHM7JMHGMIN5 1LNBM?CJ
KGLJLHBKIN/51LNHKGGKGLJGL3N#0-6D8"
! &((%%'(#(%'
( & (&%''($&(#('(%&
1?B%IBK4I,H>K;FEFCFK/JABJG@K*?:IG.
0F>FE=JABJGC@@K%I,H>HKHCIKHC5HCH.K4I,H!
>HGK=JACJG5@,K'JEHHKK6J)HEJGK&J)JE
5?G?KCF.KJ+G@K5?GKJ<J+C@BK=JA:FEFCJE@
<JK=JACJ+J$JBK:IK=FK=JA:FEFCJEKKI>!
>F)K&IEAI>=IK5?G?K%JJ'K +I
BJ<JEK<I:J>KI<I$IB'HE K<I<H
14;K/JABJG@K*?:IG. ,6N-MHE
@KHKJNDK>LAJKHLN2KN@M9FJM8MB
8CA.CH?M=BMIJF;FNDK>LAJKHL
.MBBFIGMN%1GMNG<7KIJKGL;L
?MDFINE:9JMIEFDFIGM
M>FBJMAMJMHGMN?CJCIGC3
CA.CH?M=BMIJF;FNDK>LA
>MJF=AMJMHFIFIN?M=JMGF;FIFN?K(
JLHEKIN+<2KI0N=CIJMHFND)@JKGL
#LHLI8LNECHNL>LIN:@N2KHAKN4<I<N56
*;CDE:DN$M7MH0N?LHLI8LNECHGMNDMJE
>:;CIJCBNDM;JMIMAMGF;FNEMBGLHGKNLBLI(
8LNECHNL>LIN:@N2KHAKN4<I<N/&N*;CDE:DN$M7MHN:JMHMB
?KJLHJKIAL=ELH3NCHEGF=FIGMN<JBKJKHKN4)HKNGK;L=LBJLB
4)DEKHAKBJKN?LHJLBEKN?LHLI8LNECHNL>LIN,5NKAAC7NN,
*;CDE:DNEMHL.JKHLNMHMDFIGM0N?LHLI8LNECHGMNDMJEN>:;CIJCB
DM;JMIMAMGF;FNEMBGLHGKNLBLI8LNECHNL>LIN5!N*;CDE:DNN/6
*;CDE:DNMHMDFIGMNDK>AKINDM@FJMHFN4)7N)I<IKNMJFIMHMB
?KJLHJKIKIN?LHNLJKNG)HEN4<INL>LIGKN:@N2KHAKNL=JKAL
4KH>KBJK=ELHLJK8KBELH3
*(9;K;D&23D928DK1
;733D8(D
#M=BMIN+<2KI0N4<AH<B
BM9FJMHFIGMN@M9FJM8MBN:@JMAMNLJKNLJ(
4LJLNGKN+<AH<BNBM9FJMHFIGMN:@
2KHAKNL=JKAKDLNLDKN?LHLI8LNECHNL>LIN/
KAAC7NN56N*;CDE:DNMHMDFIGM0N?LH(
LI8LNECHGMNDMJEN>:;CIJCB
DM;JMIMAMGF;FNEMBGLHGKNLBLI8LNECHNL>LI
5!N*;CDE:DNN/&N*;CDE:DNMHMDFIGM
@M9FJM8MBEFH3N%K>LAJKHGKN"&N<JBKN2KN56,
EKADLJ8LJLBEKN@M9FJM8MBN:JC90NF=L=JKHL
#MBMIJF;FN@KEBLJLJKHL@JKN?LHJLBEKNB::HGLIKJLN:JMHMB
.M7FHJFBJMHNGK2MANKEAKBEKGLH3NJBKAL7GKN2KN@CHENGF=F
EKADLJ8LJLBJKHLAL7GKNLJBNBK7N@M9FJM8MBN8CA.CH?M=BMIF
DK>LALIKNLJL=BLIN/"NMGKEN4KIKJ4KN.M7FHJMIAF=N:JC90
7MAMIFN4KJGLB>KNM>FBJMIM8MBEFH3N=KBJLIGKNB:IC=EC3N
07(679/D;D8322K/D797KD9-6CA.CH?M=BMIJF;FNMGM@JFBN?M=2CHCNEMHL.LILNGK
M>FBJM@MIN+<2KI0NB:IC=AMDFIFN=)@JKNEMAMAJMGF
%K>LALIN?M=JMI4F>NEMHL.LN/'NM7LHMIN$M7MHN4<I<N:JC90
M@IFN4<INMGM@JFBN?M=2CHCJMHFNGMN?M=JM@M8MBN2KN?C
?M=2CHCJMHN,NKAAC7N$KH=KA?KN4<I<NDMMEN5!3661@K
BMGMHNGK2MANKGK8KBELH3NCA.CH?M=BMIFN4K>L8LNMGM@
JLDEKJKHLN NKAAC7N%MJFN4<I<0NBKDLINMGM@NJLDEKJKHLNLDKN55
KAAC7NCAMN4<I<NKDALN+M7KEK1GKN@M@FAJMIM8MB
:JC90NBKDLINMGM@NJLDEKDLILINKDALN+M7KEK1GK
@M@FAJMIAMDF@JMN?LHJLBEKN9H:9M4MIGMNG)IKAL
?M=JM@M8MBEFH3N#CICIJMN?LHJLBEKN8CA.CH?M=BMIFN?LHLI8L
ECHNDK>LALN4K>L8LND:IC>JMHFN55N*;CDE:DN$M7MHEKDLN4<I<NL(
JMINKGLJK8KBELH3N#0-6D8"
("$
"$'$&
"$!'#"
!$'"$&#$
Kayseri Büyükşehir
Belediye Başkanı Mehmet
Özhaseki'yi AK Parti Kocasinan İlçe Teşkilatı'nı ziyaret etti. Ziyarette seçim
çalışmalarına ilişkin
değerlendirmelerde bulunan Başkan Özhaseki,
seçim ortamının kavgadan
uzak olmasını özen gösterdiklerini ve millete asla
tutamayacakları sözler vermediklerini söyledi
AK Parti Kocasinan İlçe
Başkanı Hüseyin Cahit Özden ve
yönetim kurulu üyelerinin ziyaretinde seçim döneminde
yapılan çalışmalar ve seçim
sonuçları değerlendirildi. İlçe
Başkanı Özden, Kocasinan'da bir
önceki seçimde aldıkları oy
oranını artırmak için çalıştıklarını
ve bunda da muvaffak
olduklarını belirtti. Büyükşehir
Belediye Başkanı Mehmet
Özhaseki ise seçim çalışmaları
süresince nezih bir ortam olması
için özen gösterdiğini söyledi.
Seçim döneminde kavga
gürültü olmaması gerektiğini, nihayette seçimlerin geride
kaldığını ve yapılan yanlışların
ömür boyu unutulmadığını ifade
eden Başkan Özhaseki, "Nihayette ölümlü bir dünyadayız.
Her yaptığımızın hesabı var. Vebal dünyası. Birisine iftira ederseniz, birisine yalan söylerseniz,
seçimi kazanmak amacıyla haddi
aşan sözler söylerseniz bu hem
içinize dert olur, hem de Cenabı
Allah sorar insana. Biz bütün
bunları düşünerek titiz davranmaya çalıştık. Tabi böyle
düşünmeyenler de oldu. Onlara
karşı sessiz kaldık. Haddi
aşanlar, iftira edenler, yalan
söyleyenler olursa bir şey demeyelim, ciddiye almayalım
dedik. Hakikaten de öyle yaptık.
Doğru da yapmışız. Allah'a şükür
geriye doğru baktığımızda
utanacağımız bir çalışmamız yok.
Bir taraftan da millete dönüp asla
yalan söylemedik. Sadece yapabileceklerimizi söyledik" diye
konuştu. (CİHAN)
&!('(%'(&'!%#%
MHP Kocaeli Milletvekili Lütfü Türkkan, Egemen Bağış'ın kürsüdeki konuşmasına ilişkin,
"Bu vatandaş Bakara'ya 'makara' demek yerine Sayın Başbakanla dalga geçseydi şu
koltuklarda, aramızda oturma şansı var mıydı? Yüce Kitap Kur'an-ı Kerim'le dalga geçene
sessiz kalıp bir zahiri mevcudiyete laf edildiğinde ayağa kalkmak münafıklıktır" dedi
TBMM Genel Kurulu'nda söz
alan Türkkan, Bağış ile ilgili sert ifadeler kullandı. Türkkan, "Bu
Bakanla alakalı bir şey
söyleyeceğim: Diniyle,
diyanetiyle, kitabıyla bir millete bu
kadar hakaret eden adamın burada işi olmamalı arkadaş. Size
yemin ediyorum -hepimizin
tanıdığımız ateist insanlar varateist insanlar bunu yapmaz, bu
işin makarası Bakara'sı da olmaz,
bu iş ciddi bir iş. İnsanların
inancıyla bu kadar dalga geçen,
insanların inancını bu kadar yerlere seren bir adamın buralarda
olmaması lazım, buraya gelip
konuşmaya cesaret bulamaması
lazım -bırakın para işlerini- buna
müsaade etmememiz lazım,
çocuklarımıza bunun hesabını
veremeyiz. Biz inançlı çocuklar
yetiştirmeye çalışıyoruz, inançlı
nesiller yetiştirmeye çalışıyoruz.
Savunduğumuz adamın Kur'an'ın
ayetleriyle dalga geçen bir adam
olmaması lazım bu şartlarda.
Ben utanıyorum, samimi
söylüyorum utanıyorum. Bunun
bu Mecliste konuşuluyor olması
bile çok üzüntü verici. Bu iş
soruşturma, araştırma meselesi
değil, bu bir ahlaksızlık boyutudur. Soruşturma olsa ne olur,
mahkemeye gitse ne olur, aklansa
ne olur, bu nedir arkadaş? Ben bir
şey söyleyeceğim size: Bu
vatandaş Bakara'ya 'makara' demek yerine Sayın Başbakanla dalga geçseydi şu koltuklarda,
aramızda oturma şansı var mıydı?
Yüce Kitap Kur'an-ı Kerim'le dalga geçene sessiz kalıp bir zahiri
mevcudiyete laf edildiğinde ayağa
kalkmak münafıklıktır" diye
konuştu.
"NİYE BU ADAMIN ALTINA,
ÖNÜNE, ARKASINA YATIYORSUN?"
Montaj olduğu iddia edilen bazı
ses kayıtlarına da değinen
Türkkan, "Niye bu adamın altına
yatıyorsun ya? Önüne yatıyorsun,
arkasına yatıyorsun? Yakışır mı
yani 65 yaşında adam. Olur mu
böyle bir şey ya. Çok utanıyorum
ve üzülüyorum, yemin ediyorum
utanıyor ve üzülüyorum. Sizin de
utanmanız gerekir diye
düşünüyorum. Kabinede, parayla
ilgili bakanların bundan sonraki
görev yerlerinin sağlam
olmadığını düşünüyorum.
Rıza Sarraf cezaevinden çıktı,
en iyi bakanlığı o yapar. Sizi
bakanlıktan alabilir Sayın
Başbakan, yeriniz tehlikede. Her
türlü işe 'Evet' diyen bir bakan
var. Rıza Sarraf'ı dışarıdan bakan
olarak ayarlayabilir, adam
paradan iyi anlıyor ya. 'Bütçe
açığının yüzde 15'ini ben yaptım.'
diyor. Bir de Türk Bayrağı'nın
önünde çıkartıyorsunuz onu. Ayıp
değil mi ya, yazık değil mi bu millete? Böyle bir şarlatanı, Türk
Bayrağı'nın önünde, parasını
verdiğiniz bir televizyonun önüne
çıkartıyorsunuz.
İnsanlar yiyecek ekmek
bulamıyor. Bu şarlatan bizim
muhteremleri milyon dolarlarla
beş taş oynuyor. Ve bunların hepsi Başbakanın bilgisi dâhilinde
yapılmış, bakın en acı olan da bu,
insan içine bunu sindiremiyor.
Sayın Başbakan da diyor ki: 'Bu
çok hayırsever bir adamdır.'
Bu bir şarlatandır, hayırsever
değildir. Devleti soyan, devleti
soyanlarla iş birliği yapan bir
şarlatandır. Hayırsever insanlar
farklıdır. Rahmetli Sabri Ülker
hayırsever adamdı, rahmetli Aydın
Bolak hayırsever adamdı, rahmetli
Yusuf Türel hayırsever adamdı.
Eğer bu hayırseverse onlar kim
peki, onu söyler misiniz bana? Bu
para -bakın, ben size bir şey
söyleyeyim- bu rüşvetle ilgili dönen paraları hesap ediyorum, 840
lira olan asgari ücretten 160 bin
kişinin maaşı ödeniyor. Yazıklar
olsun!" diye konuştu.
(CİHAN)
Mayıs
20142013
Perşembe
817
ubat
Per embe
CHP Genel Başkanı Kemal Kılıçdaroğlu, "Bu milletin vicdanına sesleniyorum:
Ayakkabı kutusu için milyonlarca parayı saklayan birisi, görevden alınmak yerine daha büyük bir bankanın yönetim kurulu üyeliğine atanıyorsa, sen acaba vicdanını ne zaman uyandıracaksın? Ben bunu merak ediyorum" dedi
9QRQ@PWSIDRNFX;WSJTLTUTUX1855XASN;XJI;RWUJQLQUPWF
WRX-WCWSQX.VSUVORVSTXVPVSWLMIUN>UPWUX;WSJTMV
OWJQRWURWSWXSICVJRVSTUTXJWOJQBX,-X)SN;X8WEOWU=VOTRT
'UATUX0RJWMFX9QRQ@PWSIDRN>UNUXOIUNEKWLQUPWUX<U?VF
JI;RWUJQMWXOWJQRWURWSXWSWLQUPWX.VUTCX)VCKTE>TU
WDWGVMTX8ISWX)VCKTEXTRVXONCVUTXNUPWX)VCKTEX=V
,HLVMTUX+UWU>QUXOWSPVETX+S2WUX+UWU>QUXPWXGNRNUPNDNUN
PNMNSPNBX9VKWRX9QRQ@PWSIDRNXPWXOIUNEKWLQUWFX!
5WMQL>QUX<UVKTUVXPTOOWJTX@VOVSVOXGWERWPQBX8NAHUHUF
H@X2TPWUQUXPWSWDW?QUWXA<UPVSTRPTDTFXPVKIOSWLTX=V
:NONONUXOWJRVPTRPTDTFXJI;RNKPWXPVSTUXMWSWRWSQU
W@QRPQDQXAHUXIRPNDNUNXGVRTSJVUX9QRQ@PWSIDRNFX77.VUTCF
,HLVMTUX=VX NLN2>NXLWGW:WXOWSEQXTPWKXLV:;WLQUPWU
NDNSRWPQOBX%URWSXTROVRVSTUPVUXWLRWX<PHUX=VSKVPTRVSB
+UWUPQORWSQXPW=WUQUXNDSNUWX:WMWJRWSQUQX2VPWXVJJTRVSB
,T@GTSTUTUXGTSVMLVRXGTSXWKW?QFX@QOWSQXMIOJNBX+LJVPTORVSTF
LWPV?VX<CAHSX=VXGWDQKLQCX1HSOTMV>MPT7XPTMVXOIUNEJNB
.VKIOSWLTUTUXOIRWMXOWCWUQRKWPQDQUQFXGNXNDNSPWXGV6
PVRRVSX<PVUPTDTUTXT2WPVXVPVUX9QRQ@PWSIDRNFXE<MRVXPV6
=WKXVJJTX7!X5WMQL>JWXPWSWDW?QUWX@QOWURWSXWSOWRWSQUW
:T@XGWOKWPQRWSBX+UWUPQORWSQXEVMRVSTXKVMPWURWSPWXPWXT6
PWKXLV:;WLQUPWXPWXL<MRVPTRVSBX.HEHUPHORVSTUPVUXWLRW
<PHUX=VSKVPTRVSBX%URWSXGTCTKXPVKIOSWLTXEV:TJRVSTKTCF
<CAHSRHOX=VXGWDQKLQCRQOXLW=WEQUQX=VSVUXEV:TJRVSTKTCB
%XW@QPWUFXPVKIOSWLTXGTCVXWRJQUXJWGWOXT@TUPVXLNUNRWU
GTSXEVMXPVDTRXNDSNUWXGVPVRRVSX<PVPTOBX%XGVPVRRVSPVU
PVSLXWRWSWOXMIRWX@QOKWRQMQCBX0MUQX:WJWRWSQXJVOSWSXVJ6
KVKVRTMTCBXVPVUX>LTMWLWRXTPWKRWSXPIDSNXPVDTR>XPTM6
ISNCBX.<UH;XAVSTMVXGWOJQDQKQCPWXUVXOWPWSXGHMHO
:WJWRWSXMW;JQDQKQCQX2WSOXVPTMISNCBX0MUQX:WJWRWSQXJVOSWS
VJKVKVOX:V;TKTCTUXISJWOXA<SV=TXIRKWRQPQSB7
-1252=;>%<,4=;8=9=>0:08:;4<31
.VKIOSWLTUTUXIRKWCLWXIRKWCQUQUXLWMPWKXGTSXSV6
TKPVUXAV@JTDTUVXPTOOWJTX@VOVUX9QRQ@PWSIDRNFXPHUX186
55X)VUVRX9NSNRN>UPWFXP<SJXVLOTXGWOWURWXTRATRTX5V?RTL
*ISNEJNSKWX<UVSAVRVSTUTUXA<SHEKVRVSTUVXPVDTUPTB
9QRQ@PWSIDRNFX4&X0SWRQOXAHUHUHUFXHROVUTUXUWLQR
LIMNRPNDNUNUXGVRAVRVSRVXISJWMWX@QOJQDQXAHUXIRPNDNUN
LW=NUPNBX0U?WOXGNXLHSV?TUXGWERWUAQ?QUQX74&X0SWRQO7
IRWSWOXA<SKVKVOXAVSVOJTDTUTXOWMPVPVUX9QRQ@PWSIDRNF
ENURWSQXL<MRVPTXX7NXAVS@VOXGTRTUKVRTBX1WST:X43XNGWJ
3//&BX9W;QONRV>PVXGTSX1$XMWOWRWUQSBX3/3XOTRIASWK
VSITUXGNRNUNSBX$WOWKXGHMHOX@QOQU?WXIRWMXWSWEJQSQRQMISB
)VSTMVXPIDSNXATPTRTMISBX9W;WRQX@WSEQPWXP<=TCXGHSILNM6
RWXGWDRWUJQLQXIRPNDNXLW;JWUQMISBX8NXGHSIPWUXMHOLVO
;WSWRWSQUXOWMQJXPQEQXLTSOHRVXVPTRPTDTXGVRTSRVUTMISB
WSAQ?WXKHSW?WWJXVPTRTMISX=VX>OTKPTSXGNXTULWURWSF
WSWEJQSWRQK>XPVUTRTMISBX.TURVKVXOWMQJRWSQUWXGWERWUQMISB
4&X0SWRQOXLHSV?TUTUXGWERWUAQ?QXGNPNSBXX8WOWURWS
@QOQMISFXGWOWURWSQUX@I?NORWSQFXGWCQXGHSIOSWJRWSX@QOQMISF
GNURWSXLW;JWUQMISBX*IUSWX4XTLWUX3/4(>JVXIRWMQX5+1
PVX2WSOXVPTMISBX.<=TCXGHSILNUNX@WRQEJQSWUX+SWURQXTE
WPWKQBX5+1XIRWMQXA<SHMISBX%RWMQUX:HOHKVJV
NRWEJQDQUQXPWXA<SHMISBX4XTLWUX3/4(XJWST:TUPVX$V?V;
1WMMT;X'SPIDWU>QUX<UHUVXH@XLWM2WRQOXSW;ISXOIMNMISB
8HJHUXIRWMRWSXWURWJQRQMISBX$W;ISNUXLIUN@XG<RHKHUPVF
WSSW2>QUX'OIUIKTX8WOWUQXW2VSXWDRWMWUX=VX=V
+@TERVSTX8WOWUQX5NWKKVSX)HRVSXTRVXKV=?NJXTRTEOTLTUTU
ISJWMWX@QOKWLQUQUX:HOHKVJXWRVM:TUVXONRRWUQRWGTRV?VDT
PVDVSRVUPTSTRKTEBX0SWRQOXWMQUWXOWPWSXJQOXMIOXWKWXIRWM6
RWSXTCRVUTMISBXX8NXWSWPWX$QCWXWSSW2XPWX5+1XJWSW2QUPWU
TCRVUPTDTXOWMAQLQMRWX5NWKKVSX)HRVS>VXJVRV2IUXVPTMISF
>5+1XGVUTXJWOT;XVPTMISXKN#>XPTMVBX
%UNUX=VSPTDTXKVE:NSX?V=W;FX>0SWEJQSPQKFXOTKLV
LVUTXJWOT;XVJKTMISBX5VSWORWUKWXAVSVOTSLVXGVUXLVUTU
<UHUVXMWJWSQK>XPTMISBXXTKPTXGVUXGHJHUXLV@TKXGIMNU6
?WFXNMNMWUX=T?PWURWSWXLVLRVUPTKBX8TSXHROVUTUX+@TERVST
8WOWUQFXSHE=VJXWRPQXPTMVXGTSXGWEOWXWPWKQUX<UHUVXMWJ6
KWCBX.HUXAVRPTDTKTCXLHSV@FXGNXLHSV?TUXGWEOW
UIOJWLQMPQBX%RWMX;WJRWPQFXOWKNIMNUWXMWULQPQBX+OJTPWSF
OVUPTLTUVXPWSGVXMW;QRPQDQXL<MRVKTUTXAVRTEJTSPTBX$HE=VJT
LTCXWRPQUQCFX;WSWRWSQXLTCXA<JHSPHUHCFXKWRQXLTCXMVPTUTC
PWSGVMTXOTKXMW;JQXLTCV#7X9VKWRX9QRQ@PWSIDRNFX)VUVR
9NSNR>PWXPHUXMW;QRWUXA<SHEKVRVSPVXGNOWPWSXWMSQUJQMW
ATSTRKVPTDTUTFXWU?WOXLISNEJNSKWXOIKTLMIUNUPW
GNURWSQUXJWKWKQUQUXA<SHEHRV?VDTUTX=VXOWKNIMNXTRV
;WMRWEQRW?WDQUQXT2WPVXVJJTBX
-1:,8<0>2:>0=;0+9>):.<94<8:91
)VUVRX9NSNR>PWXPHUXMW;QRWUXA<SHEKVRVSTUX5V?RTL
1>PVUX?WURQXMWMQURWUKWKWLQUWXPWXJV;OTXA<LJVSVU
9QRQ@PWSIDRNFX7,WROX<DSVUKVLTUXPTMVX5V?RTLX1>MV
LWULHSXAVJTSPTRVSBX8NUNUXLISNKRNLNFX:T@XOTKLV
WRQUKWLQUXWKWX1855>MTXM<UVJVUXOTETPTSFXMWUTXVKTR
T@VO>JTSBX-WSRWKVUJIMNX:WROWXOW;WJKWOXPTMVXOW=SWK
IRWGTRTSXKT#X+UJVSUVJXHCVSTUPVUXMWMQUQXPWXVUAVRRVKVMV
@WRQEQMISLNUNCBX0SOWPWERWSXNMWSQMISRWSFX>TUJVSUVJXHC6
VSTUPVXWDQSRWEKWX=WSFXTULWURWSXNRWEWKQMIS>XPTMVB
8WOWURWSXOIUNEJNRWSBX8VUXTLJVSPTKXOTXIXGWOWURWS
OIUNENU?WXGHJHUXMNSJJWERWSXLVMSVJLTUBX%URWSWXPWXLWU6
LHSXAVJTSPTBX8VUXGNSWPWUXLVLRVUTMISNKXTSW=NURWSWF
:QSLQCRWSWFXMIRLNCRNOXMW;WURWSWXISJWOXIRKWMQUB
T?PWUQUQCQUXLVLTUTXPTURVMTUBX'KTUXIRNUFXPTURVPTDTUTC
AHUXPVKIOSWLTXOWCWUW?WOFXLTCXOWCWUW?WOLQUQC7XPVPTB
-1<,4=;6;6>;:>#=3=;>52=;469=,=706;1
,->UTUFX7KN:WRV2VJXMW;KQMISFXLVLTXGTRVX@QOKQMIS7
PTMVXVRVEJTSTRPTDTUTXWUQKLWJWUX9QRQ@PWSIDRNFXGNXOIUNPW
GWEJWX1$1XIRKWOXHCVSVXGWLQUQXVRVEJTSPTBX1$1>UTUF
*9>UQUXSWOWKRWSQXHCVSTUPVUFXLTMWLTX;WSJTRVSRVXTRATRT
MWMQUXLHSVRVSTUTXWOJWSWUX9QRQ@PWSIDRNFXE<MRVXPV=WKXVJ6
JTX71WSW2LQCRQDWXGWOQUX33XNGWJ63X5WSJXWSWLQUPWX094(XLWWJX(3XPWOTOWFXX,-X"XPWOTOWFX5,-X"3XPWOTOWF
8.-X3XPWOTOWBX4X5WSJ634X5WSJXWSWLQUPWX0PWRVJX=V
9WROQUKWX-WSJTLTX4&XLWWJX(!XPWOTOWFX,-X4XLWWJX4
PWOTOWFX5,-X4XLWWJBX1WSW2LQCRQDWXGWOQUBX4X5WSJ634
5WSJXJWST:RVSTXWSWLQUPWX0PWRVJX=VX9WROQUKWX-WSJTLTX4!
LWWJX3!XPWOTOWFX,-XXPWOTOWX(/XLWUTMVFX5,-X4
PWOTOWBX*WULHSXSN:RWSQUWXTERVKTEBX8NURWSX *9>UQU
LW;JWPQDQXLHSVRVSPTSBXTKPTXGNX1$1XJWSW2LQCXKQ
TOJTPWSQUXGISWCWURQDQUQXKQXMW;QMIS#X
)HUXAVRV?VOX:V;LTUTUX:VLWGQUQXLISW?WDQCBX8TC
1$1>MTXVRVEJTSPTOFXLWUOTXPTDVSXWRWURWSPWXMIOXATGTBX4&
0SWRQOXLHSV?TXGTCVXGTSXPVX:W=NCXKVPMWLQUQX<DSVJJTBX!(/
KTRMIUXPIRWSRQOX;WSWUQUXUWLQRXJI;RWUW?WDQ
A<SHEHRHMISPNBX,W=NCXKVPMWLQUQUXGWEQUPWOTXTLTK
SW:WJRQORWXOWKNXGWUOWLQUQUXAVUVRXKHPHSHUVXJVRV2IU
VPT;X>WRIX*HRVMKWUX3XKTRMIUXA<UPVS>XPTMISBX8TRTMISXOT
GVUXUVXPVSLVKX09-XIUNUXNMANRWMQ?QLQXIRW?WOJQSBX*IU6
SWXGNX*HRVMKWUX<PHRRVUPTSTRPTBX.W:WXGHMHOXGTS
GWUOWUQUXM<UVJTKXONSNRNXHMVRTDTUVXWJWUPQBX8NXKTR6
RVJTUX=T?PWUQUWXLVLRVUTMISNKX0MWOOWGQXONJNLNXT@TU
KTRMIURWS?WX;WSWMQXLWORWMWUXGTSTLTFXA<SV=PVUXWRQUKWO
MVSTUVXPW:WXGHMHOXGTSXGWUOWUQUXM<UVJTKXONSNRN
HMVRTDTUVXWJWUQMISLWFXLVUXW?WGWX=T?PWUQUQXUVXCWKWU
NMWUPQSW?WOLQU#X8VUXGNUNXKVSWOXVPTMISNKB7
9QRQ@PWSIDRNFX:W=NCXKVPMWLQUPWXOWRVKTUTXOQSWURWSQU
IRPNDNUNFX@QOWSXT@TUFXAVRV?VOXT@TUFXOVLVRVSTUTXPIRPNS6
KWOXT@TUXMWCWURWSQUFXOTSWPWXIJNSNSOVUXIURWS?WXPWTSV
LW:TGTXIRWUXOWRVKRVSTUXGNRNUPNDNUNXLW=NUPNX
,-X)VUVRX8WEOWUQX9VKWRX9QRQ@PWSIDRNFXX78VUTK
T2WPVKTXWRW?WOKQEXGNXLW=?QXGICNUJNLNFXOTKXIRNMISLNU
LVUBX%XLW=?QMWXL<MRHMISNKFXLVUXMVJKVCLVUX8TRWR>TXPV
MWUQUWXWRFXMVJKVCLVXPWMQLQUQXWRFXWK?WLQUQXWRFXMVJKVCLV
GWGWLQUQXWRX=VXAVRXOWSEQKW7XPVPTBX9QRQ@PWSIDRNFX;WS6
JTLTUTUX1855X)SNGN>UPWXMW;JQDQXOIUNEKWPWFXX4&
0SWRQOXLHSV?TUTUFXTOTXEVMTXISJWMWX@QOWSPQDQUQXL<MRVPTB
8TSTU?TLTUTUXGTSX:HOHKVJTUFXGTSXPV=RVJTXUWLQR
LIMPNDNUWXJWUQOXIRPNORWSQUQXLW=NUWUX9QRQ@PWSIDRNFXTO6
TU?TLTUTUFXTOJTPWSXJWSW2QUPWUX'SAVUVOIUFX8WRMIC
PW=WRWSQUQUXUWLQRX2TMWLOIXIRPNDNFXLW:JVXGVRAVRVSRV
OTETRVSTUXUWLQRXT@VSTXWJQRPQDQUQUXPTRRVUPTSTRKVLTUV
JWUQORQOXVJJTORVSTUTXT2WPVXVJJTBX9QRQ@PWSIDRNFXTOTLTUTUXPV
@IOX<UVKRTXIRPNDNUNXPTRVXAVJTSVSVOFX'SAVUVOIUX=V
8WRMIC>PWX:WOLQCRQOXMW;QRPQDQUQXL<MRVPTORVSTUPVFXO6
VUPTRVSTUVFX7*TCXPVX'SAVUVOIU?NLNUNC7XPVUTRPTDTUT
GVRTSJJTBX9QRQ@PWSIDRNFX74&X0SWRQOXLHSV?TUPVUXLIUSWXIU6
RWSXPWXGNUNXPTRRVUPTSKVMVXGWERWPQRWSBX8NUNXUWLQRXPTR6
RVUPTSKVMVXGWERWPQRWSBX3"X0SWRQOX3/4(>JVX'SPIDWU>QU
GWEPWUQEKWUQX WR@QUX0OPIDWUFXISPNMWXONK;WLXONSWU6
RWSPWUXL<CXVPTMISBX+ROX@QOQEJQSBX.HUVXOWPWS
WROQERQMISRWSPQBXX WURQEXPVPTDTKTCPVXVUXWDQSXEVOTRPV
GTCTXVRVEJTSTMISRWSPQ7XPTMVXOIUNEJNBX
8WEGWOWUX$V?V;X1WMMT;X'SPIDWU>QUFX1HSOTMVX8WSI6
RWSX8TSRTDTX8WEOWUQX5VJTUXVMCTIDRNXTRVXX%?WO
3/4">JVXMW;JQDQXA<SHEKVXLIUSWLQUPWFX7 VUTPVU
MWSAQRWUKWXOIUNLNUWXIRNKRNXGWOQMISNCBX8NXOIUNPW
WSOWPWERWSQKQCX@WRQEQMISRWSFXGTJKVOXHCVSV7XEVORTUPV
W@QORWKWPWXGNRNUPNDNUNXWUQKLWJWUX9QRQ@PWSIDRNF
75WMQL>WXAVRTUPTBX,WUTXGTJKVOXHCVSVMPTFX:WUT
:WOLQCRQOX=WSPQ#X0KW@X4&X0SWRQOXSHE=VJXI;VSWLMIUNUN
A<RAVRVKVOBX*WKTKTXPVDTRRVSFXTOTMHCRHRVS7XA<SHEHUH
LW=NUPNBX9QRQ@PWSIDRNFX0PWRVJX8WOWUQX8VOTS
8ICPWD>QUFX4(X%?WOX3/4">JVX78TCXPVX:WJWXMW;JQOB
*ISNEJNSKWX=VMWXOI=NEJNSKWUQUXKN:WJW;RWSQX2WSORQ
IRPNDNUPWXLVLTKTCTXGTSWCXPW:WXAHSX@QOWSKWKQC
RWCQKPQBX0KWXLVLTKTCTX@QOWSWKWPQO7XPVPTDTUTXT2WPV
VPVSVOFXX7*VUX:T@XLVLX@QOWSKWPQUXOTBX)V@KTEXIRLNUF
:WUATXLVLBXCVRXMVJOTRTXKW:OVKVRVSXOWSWSX=VSPTRVSFXLVU
OISIX:WRTUPVXWROQEXJNJJNU7XPVPTB
-19=4=>6#8627:;>*59=4=>;<2:>2=%='06;1
'SPIDWU>WFX75WPVKX:WOLQCRQOX=WSFXKWPVKXTULWURWS
GIENXGIENUWX:W;TLJVXMWJQMISFXUVPVUXAVSVDTUT
MW;KQMISLNU#X VUTPVUXMWSAQRWKWXLHSV?TXGWERWLQUXPTMV
OWUNUXJVORT2TKTCTX=VSPTOBXCVSTUPVUXXWMXAV@KTEXUV6
PVUXIRWMQUXHCVSTUVXATJKTMISLNU#7XPTMVXLISWU
9QRQ@PWSIDRNFXL<CRVSTUTXE<MRVXLHSPHSPHX7*W=?QFX5+1
5HLJVEWSQ>UQXT2WPVMVX@WDQSPQDQXT@TUXWRVRW?VRV
JI;RWUPQRWSFXOWUNURWSX:WCQSRWUPQFXMQRPQSQKX:QCQMRWXAV@JTB
5+1X5HLJVEWSQXLW=?QMWXATJKVPTBX%SWPWX:QCRQMOVUXGN6
SWPWXUTMVXMW=WELQUFXUTMVXGTSXEVMXMW;KQMISLNU#XHUOH
LVUXPIDSNRWSQXL<MRVKTMISLNUFXTULWURWSQXOWUPQSQMISLNUF
TULWURWSQUXPNMANRWSQMRWXIMUNMISLNUBX'LOTXTLJT:GWSWJ
KHPHSHX0RTXNWJX QRKWCVSFX<CVRXJVRV=TCMIUXOWUWRQUW
@QOQ;FX>'SAVUVOIUFX8WRMIC>PWXOTKTUXJNJNORWUW?WDQUWF
:W;LVXWJQRW?WDQUWX'SPIDWUXOWSWSX=VSTMIS>XPTMISBX8NUN
'SPIDWU>WXLISNMISRWSFXIXPWX>0>PWUX>MVXMWRWUBX8VUTKRV
:WMWJQUPWXOW@XOVSVXA<SHEJHUFXGTSFXTOTXMWXPWXH@XOVSV
A<SHEJHU>XPTMISBX,V;LTXMWRWUPQXWKWXA<SHEJHDHUHXOWGNR
VPTMISXGNSWPWBX*IUSWFX>*VUTUXMWSAQXTRVXKHUWLVGVJRVSTUT
GTRTMISNKBX8NXTERVSPVXUVXOWPWSXJVCAW:JWSXIRPNDNUN
GTRVUXGTSTMTK>XPTMVXPV=WKXVPTMISBX8TSXGWEGWOWUFXTLJT:6
GWSWJXKHPHSHMRVXUTMVXA<SHEHS#X+@TERVSTX8WOWUQF
5HLJVEWSQFX'KUTMVJX)VUVRX5HPHSHFXKHPHS
MWSPQK?QRWSQFXPWTSVXGWEOWURWSQX=WSFXA<SHEKHMISLNUXW6
KWXGTSXTLJT:GWSWJXENGVXKHPHSHMRVXA<SHEHMISLNUBX*VU
UVMTXA<SHEHMISLNUXGTSXTLJT:GWSWJXKHPHSHMRVB
*<MRVPTORVSTXPIDSNXMW;QRWUXGHJHUXJNJNORWKWRWSPWUXI6
UNUX:WGVSTX=WSB7
-1676;>$673=2=,=71
9VKWRX9QRQ@PWSIDNFXGNXIRWMRWSXGWERWPQOJWUXLIUSW
4(XOTETUTUX:WMWJQUQXOWMGVJJTDTUTXT2WPVXVPVSVOFXTROX9NP6
PTLTX%OOQSFXLIUXIRWSWOXPWX5NSWJXCWUWR;>TUXMWEWKQUQ
MTJTSPTDTUTXWUQKLWJJQBX9QRQ@PWSIDRNFX78NURWSQUX=T?PWUQ
=WSXKQ#X8NXOWPWSXRW2XVPV?VOLTUFX>:WOLQCRQOX=WSFXGIEN
GIENUWXT@VSTPVXMWJQMIS>XPTMV?VOLTUFX8WEGWOWURQO
OIRJNDNUPWXIJNSW?WOLQUXAQOQUX@QOKWMW?WOFXGTSXEVM
MW;KWMW?WOLQU7XPTMVXOIUNEJNBX5NSWJXCWUWR;XT@TU
MWCQRWUX70KWX<RKVORVXGTJKVMV?VDTCBXVPVUXIRWURWSF
LVLLTCXOWRWURWSFX:T@GTSEVMTXMIOKNEXATGTXMW;WURWSFXGTRTU6
TCFX:WJJWXVKTUXIRNUNCX<RPHSKVORVXGTJKVMV?VDTCB
5NSWJ>QUXOWUQFXHCVSTUTCPVFXA<SHMISNCBX8VMWCPWFXKW6
=TPVFX:WOTPVBX8TRTUTCX<RPHSKVORVXGTJKVMV?VDTC7
PTCVRVSTUTXIONMWUX9QRQ@PWSIDRNFX<RPHSKVORVXHROVUTU
MNSJLV=VSRVSTUTUXWLRWXGTJKVMV?VDTUTX=NSANRWPQB
9QRQ@PWSIDRNFXGNXWTRVRVSTUXMWOQURWSQUQUXLVLLTCX@QDRQO
VMRVKTXGWERWJJQDQUQFXGVORVPTORVSTXPVLJVDTUX:WROJWU
AVRKVKVLTUTXVRVEJTSPTORVSTUTXWUQKLWJJQBX9QRQ@PWSIDRNF
7,WROQXGIS@RWXJVLRTKXWRPQRWSXIUNUXT@TUXPVLJVORVKTMIS6
RWS7XPVPTB
-1:;<>*/9$>*=.=(6;=>0+9+78:2:;><7.<4=94=;1
9QRQ@PWSIDRNFX3//3>PVXT?SWXPWTSVLTUPVX4/XKTRMIUX3!
GTUX343XPILMWXGNRNUPNDNUNFX3//43>PVXGNXLWMQLQUQUX34
KTRMIUX!XGTUX&&">VXNRWEJQDQUQXGVRTSJJTBX-SIJVLJIXVPTRVU
LVUVJRVSTUX3//3>PVX4!XKTRMIUFX3/4(>JVXTLVX&XKTRMWS
"4"XKTRMIUXRTSWXIRPNDNUNXT2WPVXVPVUX9QRQ@PWSIDRNF
ENURWSQXOWMPVJJTX79WSEQRQOLQCX@VORVSX3//3>PVX3XKTRMWS
3/(XKTRMIUXRTSWFX3/4(>JVX4"XKTRMWSX44XKTRMIUXRTSWBX8N
=WJWUPWEXUVXMW;W?WO#X3//3>PVXGWUOWXGIS?NX=VXJHOVJT?T
OSVPTLTUTX<PVKVMVURVSTUXLWMQLQX"&XGTUXOTETBX8NXSWOWK
NGWJX3/4">JVX(XKTRMIUX4XGTUX!XOTETMVX@QOJQBX3//(>JV
WTRVRVSTUXGIS@RWSQX4(XKTRMWSXRTSWFX3/4(>JVX(&3XKTRMWSXRT6
SWBX0TRVRVSTUXGIS@XGWJWDQUWXGWJJQDQUQXA<SHMISNCBXVPVU
LVLLTCX@QDRQOXVMRVKTUVXPVLJVOX=VSKTMISRWSXPTMISNCB
0PWKXWOEWKXUWLQRXV=VXATPV?VDTUTUX2WSOQUPWXPVDTRB
8IS@RWUPQSQMISLNUXLIUSWXJVLRTKXWRQMISLNUBX*V@TK
CWKWUQX>GWEOWX;WSJTMVXIMX=VSKVFX2WTCXMHOLVRTSXGIS?NUN
<PVMVKVCLTUFXTLJTOSWSXGICNRKWLQUFXPIRWSXMHOLVRTSXGIS6
?NUNX<PVMVKVCLTU>BX
-1=9=8:8>%:9)<>4=<9:0<1
9QRQ@PWSIDRNFX=VSATXSVOISJKVURVSTUTUXW@QORWUPQDQUW
TEWSVJXVPVSVOFX7KTRMWSRQOXT:WRVRVSTXWRWURWSQUF
:W=NC?NRWSQUFX1$)'>RTRVSTUXGNSWPWXIRKWPQDQUQ7
L<MRVPTBX9QRQ@PWSIDRNFXX7-VOTXGNX;WSWRWSXUVSVPVFXXLTCXGN
OWPWSXKTRMWSRWSQFXT:WRVRVSTXWRPQUQCFXUVSVPVX<PVPTDTUTC
=VSATRVS7XPTMVXLISPNBX71HSOTMV>UTUX?WSTXW@QDQUQ
OW;WJJQK7XPTMVUX$QCWXWSSW2>QUXGNXRTLJVPVXWPQUQU
IRKWPQDQUQXT2WPVXVPVUX9QRQ@PWSIDRNFXWSSW2>QUXISJWO
IRPNDNXETSOVJRVSTUXGVMWUXVJJTORVSTX=VSATRVSTXLQSWRWPQB
9QRQ@PWSIDRNFX$IMWRX.VUTC?TRTO>TUX&XKTRMIUX3/XGTUXRT6
SWFX$IMWRX,IRPTUA>TUX(!/XRTSWFXIROWUX)QPWX.QE
1T?WSVJ>TUX4XKTRMIUX("!XGTUXRTSWFX*W2TSX0RJQUX1T?WSVJ
+J:WRWJX=VX+:SW?WJ>QUX4XKTRMIUX/&XGTUXRTSWX=VSATXGVMWU
VJJTDTUTXGVRTSJJTBX " !! "
"
"
" "!!
! !
!
>"'>:;:8>='7=;6>"9.5(958
!+97$+&>:07<>*=7=;8=9>=
:9
=(8=2=;&>5=33:9>+8:9&>"):3:;
=(6'>%:>"94/(=;>=29=7.=98=><8)<8<
75958=;>:,8<0>/95'.593=>!/3<02/;5;5;>=76*:.<;<;&>854:9:>/8=26><8:
<8)<8<>75958=;>7/3<02/;>)<*<>/8=,=(6;6
<44<=>:4:9:7&>1!/3<02/;><87
./8=;.606;6>7<3*<8<9>;:>#=3=;
2==,=7.69>5359*='7=;86(6>0:$<3<;4:;>0/;9=>+7+3>%:93:7>459535;4=>7=8=,=7.69&>/>#=3=;=>7=4=9
7<3>8:>7<3>7=8=1>4:4<
!+97$+FX,.-X1855X)SN;X1I;RWUJQLQ>UPW
MW;JQDQXOIUNEKWLQUPWXL<CRVSTUVFX7)HUWMPQUF
SIGWE7XPTMVSVOXGWERWPQBXX02AWUTLJWU>PWOTXPV6
;SVKXUVPVUTMRVX02AWUX:WROQUWXGWELWDRQDQ
PTRVMVUX9HSO@HFXV=RVSTUX=VXTEMVSRVSTUTUXLNRWS
WRJQUPWXOWRPQDQX)<O@VWPW>UQUXW2VJXG<RAVLTXTRWU
VPTRKVLTUTXTLJVPTBXX8NAHUHUX.VUTCX)VCKTEX=V
WSOWPWERWSQUQUX<RHKXMQRXP<UHKHXIRPNDNUN
WUQKLWJWUX9HSO@HFX7%URWSQUX"3XMQRPQSXPTU6
KVMVUXW?QLQX:WRWXMHSVDTKTCPVBX.VUTCXLIUXL<C6
RVSTUPVFX1HSOTMV>UTUX:WRWXPVDTEKVMVUXJVKVRXPV6
=STK?TXLISNUNUNX4!XOVRTKVMVXLQDPQSKWMQ
GWEWSKQEJQBX%URWSQUXTPWKXJNJWUWDQUQ
:WCQSRWMWURWSFXIXL<CRVSTXMWCKWPQFX@HUOHXIUNU
LIUXLIRNDNUPWUXOISOJNRWSBX> WEWLQUX1HSOX=V
9HSJX:WRORWSQUXOWSPVERTDT>XL<CHFXGNAHU
MW;KWKQCXAVSVOVUXTERVSTUXVUXOQLWXRTLJVLTUTXGTCV
LNUNMISBX,.-FXGNXRTLJVMVX=VX.VUTC>RVSTUXWUQLQUW
LWPQOXIRWURWSQUX;WSJTLTXIRWSWOFXIURWSQUXMIRNUPW
MHSHKVMVXPV=WKXVPV?VOJTS7XPVPTB
9HSO@HFX1855X)VUVRX9NSNRN>UNUXPHUOH
GTSRVETKTUPVFX:QSLQCRQORWXLN@RWUWUX"XVLOTXGWOWU6
RWXTRATRTX<UVSAVRVSTUXA<SHEHRPHDHUHXGVRTSJVSVOF
<UVSAVRVSTUXA<SHEHRKVLTXLQSWLQUPWX5V?RTLX1VRV6
=TCMIUN>UNUXMWMQUXMW;KWKWLQUQXVRVEJTSPTB
9HSO@HFXVLOTXGWOWURWSQUFX<URVSTUVXOIUNRKNE
OWDQJRWSQXIONMWSWOX:T@GTSXAVS@VDTX?VLWSVJRV
:WMOQSWKWPQORWSQUQXL<MRVPTB
-1854:9:>/8=26><8:><8)<8<>75958=;>
7/3<02/;>)<*<>/8=,=7.691
'SJNDSNRX9HSO@HFX7.IONUNRKWCRQORWSQ
OWRPQSQRQ;XW?WGWXMWSAQUQUX<UHUVXA<UPVSTRV?VORVS
KTXA<UPVSTRKVMV?VORVSXKT#X+PPTWMWXATSVGTRTSTKF
09X-WSJT>UTUX@IDNURNOJWXIRPNDNXGHJHUX5V?RTL
9IKTLMIURWSQXUWLQRX@WRQEW?WOLWX<MRV
@WRQEW?WOJQSBX9NSNRWUXGNX5V?RTLX*ISNEJNSKW
9IKTLMIUN>UNUXWOQGVJTFXRNPVSVXIRWMQXTRVXTRATRT
ONSNRWUXOIKTLMIUXATGTXIRW?WOJQSBX9IKTLMIUXTRO
JI;RWUJQLQUQXOTKGTRTSXUVXCWKWUXMW;W?WOJQS#
NK:NSGWEOWURQDQXLV@TKTUPVUXLIUSWX:HOHK
=VSKVOXPNSNKNUPWXOWRW?WOJQSFXIXCWKWUWXOWPWS
OTKX<RVXOTKXOWRWBXRNPVSVXIRWMQXTRVXTRATRT
TCRVPTDTKTCXA<SHUJHRVSXW;W@QOXISJWPWXTOVUBBBX09
-WSJT>RTRVSXGNXAVU@RVSTUXWPQKXWPQKX<RHKV
ATPTERVSTUPVXA<CMWERWSQUQXJNJWKWKQERWSPQBX0U6
?WOXSW;ISRWSQUPWX>IRWMPWXOWLQJXMIO>XPTMVX:HOHK
=VSPTRVSBXRNPVSVXIRWMQUPWXV?PVJXCVRXVKST
=VSKTEJTX=VXGNUNXPWX<U?VPVUX8WEGWOWU>W
PWUQEKQEJQ7XPTMVXOIUNEJNB
,.->UTUFX09X-WSJT>UTUXTOJTPWSWXAVRKVLTUTU
WSPQUPWUXT2WPVX<CAHSRHDHUHUXUVXOWPWS
LQUQSRWUPQDQUQUX2WSOQUPWXIRPNDNUNXT2WPVXVPVU
9HSO@HFX78NSWPWXKVPMWX@WRQEWURWSQUWXPWXA<SV=
PHEHMISBX'DVSXAWCVJV?TRVSFXKVPMWX;WJSIURWSQUQU
GWLOQLQXWRJQUPWXLVUPTOWRWSQUQXJVSOVJKVLVRVSPTF
VPTJISMWRXGWDQKLQCRQORWSQUQXLW=NULWRWSPQFXIURWSW
GNURWSQXMW;WGTRTSRVSXKTMPT#7XPTMVXLISPNB
9HSO@HFXPV=RVJTUX.VSLTKXLIMOQSQKQXTRVXTRATRT
AVS@VORVSTXMQRRWS?WX:WROJWUXLWORWPQDQUQXLW=N6
UWSWOFXE<MRVXOIUNEJNX7"X5WMQLX4(&>PVF
9NSJNRNEX*W=WEQ>UQUXGHJHUXGWGWRWSQUQU
GNRNUPNDNXIXGWOWURWSXONSNRNUPWXWRQUWUXOWSWSRWF
GTURVS?VX.VSLTKRTXAWCWXGIDNRN;XJI;SWDW
A<KHRPHBX,WOTOWJRVSTUXISJWMWX@QOWSJQRKWLQXT@TU
PV=RVJXWSET=TUVXATSTRKVLTXAVSVOTMISPNXWKWXGN
GTRATRVSX:WROJWUXLWORWUPQBX+ULWURWSX.VSLTK>PVXUV
IRPNDNUNXGTRKVPVUXGNAHURVSVXAVRPTRVSXWKW
:T@GTSXEVMXLIULNCWXOWPWSXLWORWUKQMISB
%XAHUXXMWEQUPWXGTSXOQCX@I?NDNXGNAHUX
MWEQUPWXGTSXUTUVXIRWSWOXIRWMQXWURWJJQDQUPWXJWST6
:TUXAVS@VORVSTXISJWMWX@QOQMISBX8TCRVSXTUJTOWK
;VETUPVXPVDTRTCXWKWXGNXLIMOQSQKRW
MHCRVEKVRTMTCBX'SKVUTFX.VSLTKFX*HSMWUTFX VCTPT
LIMOQSQKRWSQXTRVXMHCRVEVKVCLVOX:T@GTSXGTSXCW6
KWUX=T?PWURWSQKQCXWSQUKWMW?WOBX.VSLTK>RV
MHCRVEKVOXAVSVOTMISPNXWKWX09X-WSJTXLWPV?V
LTMWLTXSWOTGTUTFX,->MTXGNUNURWX=NSKWOXT@TU
2QSLWJXIRWSWOXONRRWUPQBX*WPV?VXJI;RNKNUXGHJHU
ONSNKRWSQUQUXMHCRVEKVLTFX,HOHKVJTUX>;WSPIU>
PVKVLTXMVJKVCFXISPNPNUFXVKUTMVJTUX=VXHUT=VS6
LTJVUTUXPVXMHCRVEKVLTXAVSVOTSBX SAYFA 8
SONDAKiKA GAZETESİ >>
Meltem
ARIKAN
8 GÜNCEL
8 Mayıs
17
Şubat2014
2013Perşembe
Perşembe
SONDAKiKA GAZETESİ >>
KUŞ CENNETİNİ
meltem.arıkan.5@facebook.com
Kim kime neye
göre üstün?
Bu kadar birbirinden ayrışmış, bu kadar birbirine
öfkeli ve bu kadar birbirine tahammülsüz insanlar
etrafta olunca ardı ardına gelen “ırkçılık ve nefret”
kokan söylemleri aslında çok yadırgamamak
lazım.
Birbirini dinlemeye, fikirlerini duymaya, diğerinin
kendisinden farklı yaşamasına dahi tahammülü olmayan insanların bu kötü ahlaklarının bir sonucu
olarak kendilerinden farklı etnik kökeni ve dili
olan insanlara da tahammülü olmuyor. Biri üstünlük iddiasında oluyor, diğeri bu ülkenin asli unsurlarını bu güzel topraklardan “kovma”
iddiasında. Bu insanların belki de bu garip, akıl
dışı iddialarının en temel sebeplerinden biri küçük
bir pencereden bakarak değerlendiriyor olmaları
gelişmeleri ve Anadolu ruhunu belki de hiç tanımamaları.
Anadolu arif insanların yurdudur. İçiçe nice kültürler nice medeniyetler nice diller yaşar. Biri diğerini
dininden, dilinden, ırkından dolayı düşman
görmez Anadolu’da. Kürt Türk Arap Laz Çerkez
Ermeni Süryani komşudur, dosttur, akrabadır,
kardeştir Anadolu’da. Anadolu insanı yardıma
koşarken “bunun dili, dini, ırkı ne?” diye bakmaz.
Anadolu insanı kapısını açarken, “dinimiz aynı
değil evimde misafir edemem” diye düşünmez.
Anadolu insanı birlikte eğlenirken, “kökeni farklı
niye biraradayız” demez. Çünkü Anadolu insanı
yaratılanı Yaradan’dan ötürü sever, saygı duyar,
korur kollar. Çünkü Anadolu insanı “Arap’ın
aceme, acemin Arap’a üstünlüğü olmadığı”
vasiyetini tüm benliğiyle benimsemiştir. Çünkü
Anadolu insanı üstünlüğün ırkla değil “takvayla”
olduğunu bilir. Ve işte bu yüzden Anadolu
kardeşliğin yurdudur.
YABANCILAR TEMİZLEYECEK
Dünyadaki çevre kirliliğine dikkat
çekmek için yurt içi ve yurt dışından gelecek gençler İzmir Kuş
Cenneti ve Homa Dalyanı
kıyılarını temizleyecek. Avrupa
Birliği Eğitim ve Gençlik Programları çerçevesinde, Çiğli
Belediyesi, Orman ve Su İşleri
Bakanlığı 4. Bölge Müdürlüğü ve
İzmir Kuş Cenneti Koruma
Geliştirme Birliği tarafından
yürütülen proje kapsamında
gönüllü gençler 10 – 11 Mayıs’ta
İzmir Kuş Cenneti kıyılarını temizleyecekler. Proje kapsamında
hem İzmir Kuş Cenneti hem
Homa Dalyanı’nın temizlenmesi,
tanıtımı ve çevrenin korunması
konusunda bilinçlendirme yapılması amaçlanıyor.
KİRLİLİĞE ÇÖZÜM
ARAYANLARIN GÜNÜ
Dünyadaki çevre kirliliğine
dikkati çekmek için gönüllülerle
birlikte vatandaşlarla çalışmalar
yürütecek olan belediye bünyesin-
deki AB Eğitim ve Gençlik Birimi, kampanyaya Çiğli kıyılarından başlayacak. Ciddi sağlık ve
çevre sorunları oluşturan kıyıların
temizliğine ilişkin kamuoyu oluşturmak isteyen birim, “Lets Do İt
Türkiye” adı ve sloganı altında
Çiğli kıyılarında temizlik etkinlikleri gerçekleştirecek.
ÇİĞLİ SAHİLİ
TEMİZLENMEYİ BEKLİYOR
Gittikçe büyüyen atık sorununa, hem bireylerin hem de iş
kollarının arkalarında bıraktıkları
çevresel değişimlere dikkat çekmek istediklerini belirten Çiğli
Belediye Başkanı Hasan Arslan,
yurtiçi ve yurtdışından gelen
gönüllülerle Çiğli kıyılarını temizleyeceklerini söyledi. Hem çevre
kirliliğine dikkat çekeceklerini
hem de bölgenin tanıtımını yapacaklarını belirten Başkan Arslan, “Çevremize sahip çıkmamız
gerekiyor. Kıyılarımız denize
atılan çöpler nedeniyle kirleniyor.
Belediyemizde kurduğumuz AB
birimi ile bu konularda çalışmalar
yürütüyoruz. Gönüllülerimizle
çalışmalar yapıyoruz. Cumartesi
günü büyük bir temizlik kampanyamız olacak. Çiğli kıyılarını
temizleyeceğiz. Aynı zamanda
dikkatleri çevre kirliliğine de çekmiş olacağız” diye konuştu.
(HABER MERKEZİ)
Bu güzel, sıcak, dost canlısı topraklara geçmişte
defalarca nifak sokulmaya çalışıldı. Dostlar
kardeşler birbirlerinden ayrılmak istendi. Kimi
dönemlerde bunda başarılı da oldular. Ama bu
sefer bu girişim tutmayacak. Çünkü biz bu topraklarda sevgiyle, dostlukla, kardeşlikle olduğu kadar
acılar ve çilelerle de yoğrulduk. O acılardan çok
hikmetli dersler aldık. O acılardan bizi biz yapanın
maneviyatımız olduğunu ve maneviyatımıza yönelik her hareketin birliğimize ve dirliğimize darbe
olduğunu öğrendik.
SWEEEP’e bu yıl 66 ülkeden
385 proje katıldı. Doğanata
Eğitim Kurumları İzmir Özel
Fatih Koleji Öğrencileri bu
önemli yarışmada 2 kere kürsüye
çıktı. Enerji dalında yarışan
Yaren Sever “Fabrication and
Characterızatıon of Carbon Nanotube Doped Photovoltaıc Cells
adlı projesi ile dünya 2. oldu ve
gümüş madalya kazandı.
Mühendislik dalında yarışan
İzmir Fatihli öğrenciler Büşra
Yıldırım ve Koray Şekerin de “
Detectıon and Vısualızatıon of
the Quantızed Behaviour of Resistance and Conductıvıty ın
Golden Wıre” adlı ortak projeleri
ile Dünya üçüncüsü oldular ve
bronz madalya kazandılar.
Açılış töreninde yapılan tüm
ülke bayraklarının dalgalandırıldığı bayrak töreninde
Türkiye adına Koray Şekerin
Milli bayrağımızı da onurla taşıyarak ülkemizi temsil etti.
Danışman öğretmenleri Viki
Kalderon, öğrencilerin İngilizce
sunumlarda ve projeyi tanıtmada
gösterdikleri yüksek performans
ve başarıdan çok gurur duyduğunu, uzun süren bir proje
hazırlık süresinden sonra gelen
dünya çapındaki başarıların ekip
çalışmasının eseri olduğunu belirtti. (HABER MERKEZİ)
O yüzden kimse şimdi 19. yüzyılın modası
geçmiş, içeriği çürütülmüş köhne fikirleriyle ortaya çıkıp ırk üstünlüğü iddialarında bulunmasın.
Hiç kimse de bu güzel topraklarda sadece bir
toplumun yaşayacağını sanmasın. 20. yüzyıl darwinist materyalist dünya görüşünün inşa ettiği
komünizmin faşizmin emperyalizmin acılarıyla
geçti. Milyonlar hesabıyla insanların öldüğü, atom
bombalarıyla şehirlerin bir dakikada yerle bir
edildiği, milyonlarca insanın sakat kaldığı, yurtsuzluğun sürgünün hayatın bir parçası haline geldiği
felaketlerle geçti. İnsanların fıtratından uzaklaşmaları acı kaynağı oldu.
Bu yüzyıl ise inşaAllah insanların adeta birer putu
haline gelmiş bu ideolojilerin bilimsel geçersizliğinin tüm delilleri ile ortaya konduğu, yani putların kırıldığı bir yüzyıl. Putlar kırıldıkça insanların
sevgiyi, şefkati, merhameti, aklı, bilimi, kaliteyi,
sanatı, adaleti, eşitliği, insan haklarını, ifade özgürlüğünü emreden İslam ahlakının yani insanlığın fıtratının hakim olduğu bir yüzyıl olacak. Bu yüzyıl
köhne ırkçı söylemlerin değil, gerçek üstünlüğün
güzel ahlakla olduğunu söyleyen hak dinin sıcaklığının hakim olacağı bir yüzyıl olacak. Bu sebeple
kimse geçmişin acılarını, geçmişin karanlık
düşüncelerini diriltmeye gayret etmesin, zira bu
yüzyıl “Hakkın gelip batılın yıkılacağı” yüzyıl
olacak.
Mayıs
2014
Perşembe
Şubat
2013
Perşembe
9 GÜNCEL 817
5 DOSYAYLA
Ankara’ya
uçtu
Bilime yatırım
gözleri Gediz’e
Öğretim üyelerine çevirdi
özel poliklinik
in
İzmir Büyükşehir Belediyesi’nüst
cak
pa
ya
yeni dönemde görev
şkan
düzey kadrolarını belirleyen Ba rı
ala
Aziz Kocaoğlu, bu çalışm
u
tamamlar tamamlamaz soluğ ’ğlu
Ankara’da aldı. Başkan Kocaoa,
nun Başkent programınd
kentin önemli projelerine
ilişkin ziyaretler
bulunuyor
İ
zmir Büyükşehir Belediye
Başkanı’nın Ankara ziyareti sırasında,
başta Çevre ve Şehircilik Bakanlığı
Tabiat Varlıkları Koruma Genel Müdürü
Osman İyimaya, Ulaştırma Bakanlığı Alt
Yapı Yatırımları Genel Müdürü Metin
Tahan, Milli Emlak Genel Müdürü H. Abdullah Kaya ve TCDD Genel Müdürü Süleyman Karaman olmak üzere, pek çok
üst düzey bürokratla bir araya gelecek.
Başkan Kocaoğlu’nun Spor Bakanı Akif
Çağatay Kılıç’la da görüşmesi bekleniyor.
2 günlük Ankara temaslarıyla ilgili bilgi
veren İzmir Büyükşehir Belediye Başkanı
Aziz Kocaoğlu, Çevre ve Şehircilik
Bakanlığı Tabiat Varlıkları Koruma Genel
Müdürü Osman İyimaya ile körfezdeki
ÇED raporu konusunu görüşeceğini
söyledi. Başkan Kocaoğlu, “İzmir Körfezi’ni yüzülebilir hale getirebilmek amacıyla
yürüttüğümüz çalışmaların kritik bir
bölümü için uzunca bir süredir ÇED
onayı bekliyoruz. Sayın Genel Müdür’den
E
bu sürecin hızlandırılmasını talep edeceğim” diye konuştu.
Ulaştırma Bakanlığı Alt Yapı Yatırımları Genel Müdürü Metin Tahan ile yapacakları görüşmenin odak noktasında
metro ve tramvay yatırımlarının yer alacağını kaydeden Aziz Kocaoğlu, şöyle
devam etti: “Bakanlığın ‘Biz yaparız’
dediği Buca tramvayı meselesi var. Onu
konuşacağız. Yapamayacaklarsa biz
üstleneceğiz. F.Altay’dan Narlıdere
merkeze kadar olan 4.5 kilometrelik metro
hattının projesini teslim etmiştik. Bunu ve
Narlıdere Merkez’den İstihkam’a, oradan
da Urla Yüksek Teknoloji Enstitüsü’ne
uzanacak 30 kilometrelik hattın durumunu
soracağız. Ayrıca Üçyol-Buca Tınaztepe
Kampüsü metro hattı var. Bakanlığın bu
projelerle ilgili tasarrufunu öğrenerek yol
haritamızı ona göre belirleyeceğiz.”
Milli Emlak Genel Müdürü H. Abdullah Kaya ile gerçekleştirecekleri toplantıda
İzmirdeniz Kıyı Tasarım Projesi’nin izin
bekleyen iskelelerini gündeme getireceğini söyleyen Büyükşehir Belediye
Başkanı, “Her türlü koşulu yerine getirmemize ve gerekli protokolü imzalamamıza rağmen, Milli Emlak’tan 5
iskeleye ilişkin onayı yaklaşık 1 yıldır
alamıyoruz. Sayın Genel Müdür’le bu
konuyu görüşeceğiz” dedi. TCDD Genel
Müdürü Süleyman Karaman ile İZBAN
konusunu masaya yatıracaklarını belirten
Başkan Kocaoğlu, banliyö seferlerinin hızlandırılması ve hattın yeni çekerlerle birlikte daha verimli kullanılması için
yapılması gerekenleri konuşacaklarını
kaydetti.
İzmir Büyükşehir Belediye Başkanı
Aziz Kocaoğlu, Ankara temasları
sırasında Spor Bakanı Akif Çağatay
Kılıç’la da bir araya gelerek Örnekköy’de
ve Uzundere’de yapmak istedikleri iki
spor kompleksi konusunda görüş alışverişinde bulunmak istediğini sözlerine ekledi. (HABER MERKEZİ)
ge Üniversitesi Tıp Fakültesi Hastanesi
Kampüs Polikliniği bünyesinde emekli
öğretim üyeleri için “C Polikliniği” oluşturuldu. Sürekli bir uzman doktorun bulunduğu
poliklinikte, bazı radyolojik işlemler yapılabiliyor. Laboratuvar tetkiklerinin Tıp Fakültesi Hastanesi laboratuvarlarında
gerçekleştirilmesi sağlanıyor ve gerekirse
farklı uzmanlık alanları için randevular da
alınabiliyor. Ege Üniversitesi Tıp Fakültesi
Hastanesi’nde Tıp Fakültesi çalışanları için
A, Üniversite öğretim üyeleri için de B polikliniği 2009 yılında hizmete açıldı. Ege
Üniversitesi Tıp Fakültesi Hastanesi Kampüs
Polikliniği de öğrenci, personel ve birinci
derece yakınlarına Acil Servis, Aile Hekimliği, Çocuk Sağlığı ve Hastalıkları, Dermatoloji, Göğüs Hastalıkları, Göz Hastalıkları,
İç Hastalıkları, Kadın Hastalıkları ve Doğum,
Kulak Burun Boğaz ve Psikiyatri dallarında
sağlık hizmet veriyor. Ayrıca, Kampüs Polikliniği bünyesinde emekli öğretim üyeleri için
“C Polikliniği” oluşturuldu. Sürekli bir
uzman doktorun bulunuğu bu poliklinikte,
bazı radyolojik işlemler yapılabilmekte, laboratuvar tetkiklerinin Tıp Fakültesi Hastanesi
laboratuvarlarında gerçekleştirilmesi sağlanmakta ve gerekirse farklı uzmanlık alanları
için randevular da alınabiliyor. Tıp Fakültesi
Hastanesi polikliniği olması nedeni ile
üçüncü basamak sağlık hizmeti verilen birim,
mesai günleri 08.00-16.30 saatleri arasında
hasta kabul ediyor. (EGE AJANS)
Gediz Üniversitesi’nin 22 laboratuvarla bilime yaptığı
büyük yatırım, sınırların
ötesinde de yankı buluyor. Bir
hafta içinde önce Filipinler,
ardından Belarus Büyükelçisi
ziyaret etti, ülkelerindeki
üniversitelerle Gediz’in işbirliği yapmasını istedi
Gediz Üniversitesi, bilime
yatırımda hız kesmiyor. Buluşların dünya çapındaki adresleri arasına girmesi ve
teknolojinin sayılı merkezlerinden biri haline gelmesi
amacıyla peş peşe yeni laboratuvarlar kuruluyor. Son eklenenlerle birlikte sayı 22’ye
yükseldi, 23’üncü olacak yenilenebilir enerji laboratuvarının da hazırlıklarına
başlandı. Bilime yönelik bu
hamleler ve başta enerji olmak
üzere farklı alanlarda geliştirilen projeler yurtdışında da ses
getirdi. Diplomatik ve
akademik heyetler Seyrek’teki
kampüste incelemeler yapmaya geliyor. Bir hafta içinde
de önce Filipinler Büyükelçisi
Maria Rowena Mendoza
Sanchez, ardından Belarus
Büyükelçisi Andrei Savinykh
konuk oldu. Mendoza, ülkesin-
den bir öğrencinin de eğitim
gördüğü Gediz’le Filipinler
arasında akademik köprü kurmak istediğini ifade etti, “Güçlerimizi birleştirelim. Bunun
için her türlü desteğe hazırım”
dedi.
Belarus İzmir Fahrikonsolosu Murat Yorgancılar’la
beraber gelen Savinykh ise
nanoteknoloji, fizik, elektrikelektronik, network,
simülasyon-ergonomi ve optisyenlik laboratuvarlarını
gezdi, diğerleri hakkında da
ayrıntılı bilgi aldı. Belarus
Büyükelçisi Andrei Savinykh,
bir vakıf üniversitesinin bilimsel araştırmalar için bu ölçüde
yatırıma imza atmasının kendilerini çok etkilediğini dile getirdi, şöyle konuştu:
El ele verelim...
“Ülkemdeki üniversitelerle
Türkiye’dekiler arasında işbirliğinin gelişmesini önceliklerim arasına aldım. Bu amaçla
ilk olarak Gediz Üniversitesi’ni
ziyaret ettim. Ülkemden bir
öğrenciyi burada görünce de
ayrı bir mutluluk yaşadım.
Ortak projeler ve araştırmalar
yürütülmesini, hem öğrenci
hem akademisyen değişimi
gerçekleştirilmesini hedefliyorum.
Akademik eğitim düzeydeki bu işbirliği, 2 ülke arasındaki ticari ve sosyal ilişkilerde
de itici güç olacak. Belarus’ta
alanlarında iyi ve köklü üniversiteler var, el ele verip birlikte
güzel işler yapabiliriz.”
Rektör Prof. Dr. Seyfullah
Çevik de büyükelçileri bilimsel
ortaklıklar kurulması yönündeki çabaları nedeniyle kutladı.
Prof. Dr. Çevik, her türlü işbirliğine hazır olduklarına işaret
etti, şunları söyledi:
“Ankara’da görev yapan üst
düzey diplomatik temsilcilerin
aralayacağı kapı, ülkeler
arasında sinerji oluşmasına da
zemin hazırlayacak. Eğitim
için karşılıklı birbirimize göndereceğimiz öğrenciler dostluk
köprülerini daha da güçlendirecek, beraber yaşama geçireceğimiz projeler birlikte
gelişmemizi sağlayacak.
İzmir’den kollarını tüm
dünyaya açan Gediz Üniversitesi olarak kuruluş amacımız
zaten bu. Çizdiğimiz bu yolda
ilerledikçe, insanlığa daha çok
hizmet etmiş olacağız.”
(HABER MERKEZİ)
EVDEN BELEDİYEYE BİSİKLETLE GİTTİ
BAŞKAN’IN BİSİKLET KEYFİ
ESHOT şoförlerine
bisiklet eğitimi
İzmir Büyükşehir Belediyesi ESHOT
Genel Müdürlüğü, “Uluslararası Karayolu Trafik Güvenliği Haftası” etkinlikleri kapsamında İzmir Emniyet
Müdürlüğü ile birlikte otobüs şoförlerine yönelik
eğitim programı düzenledi.
Kentte giderek artan bisiklet
kullanımını da göz önünde
bulunduran ESHOT, bu yıl
ilk kez bisiklet sürücülerinin
trafikteki haklarını da uygulamalı eğitim programına
düşük maliyetlerle yaygınaldı. İzmir Büyükşehir
laştırılabileceğini kaydeden
Belediyesi ESHOT Genel
Karakaş "Sistem, zile basılması
Müdürlüğü, güvenli bir yoldurumunda devrenin birbirini
culuk için şoförlere yönelik
tamamlayarak, evdeki ampul
eğitim çalışmalarını aralıksız
sistemi çevresine yerleştirilen
sürdürüyor. “Uluslararası
pervanenin dönmesi üzerine
Karayolu Trafik Güvenliği
çalışıyor.
Haftası” etkinlikleri kapZile basıldığı anda evde otusamında İzmir Emniyeti ile
ran engelli, pervanenin
işbirliği yapan ESHOT,
döndüğünü fark ederek kapıya
çalışanlarını hayat kurtarayöneliyor" diye konuştu.
cak bilgilerle donatıyor.
Bafa Ortakokulu Fen ve
Emniyet Amiri
Teknoloji Öğretmeni Serap
Mustafa Sarı’nın teorik ve
Uygun da engellilerin yaşamını
uygulamalı olarak gerçekkolaylaştırabilecek projenin
leştirdiği eğitim seminerinde
uygulama alanının buluntrafik kuralları hakkında
duğunu ve patent başvurusu yaönemli bilgiler verildi.
pacaklarını dile getirdi. (AA)
Eğitim çalışmasını izleyen
İşitme engelliler için
"kapı zili" yaptı
Doğuştan işitme engelli Bafa
Ortakokulu 6. sınıf öğrencisi 13
yaşındaki Ali Karataş, kendi
yaşadığı zorluklardan yola
çıkarak "İşitme engelliler için
kapı zili" geliştirdi. Buluşunu
"Milas Mucidini Arıyor" yarışmasında sergileyen Karataş,
AA muhabirine yaptığı açıklamada, evde yalnız kaldığı zamanlarda çalan kapı zilini
duymaması nedeniyle gelenleri
karşılayamadığını söyledi.
Kendisi gibi çok sayıda
işitme engellinin de benzer zorluklar yaşadığını ifade eden
Karataş, düzeneğin çalışma
prensibini anlattı. Prototip
olarak geliştirdiği düzeneğin,
SiYAH MAVi KIRMIZI SARI
Başkan Kocaoğlu,
Başkan soluğu
Ankara’da aldı
BAYRAĞIMIZI ABD’DE DALGALANDIRDILAR
28 Nisan-4 Mayıs 2014 tarihlerinde ABD Houston'da gerçekleşenı I-SWEEEP Proje
Olimpiyatı’nda İzmirli öğrenciler
bir Gümüş ve bir Bronz Madalya
kazandı. Dünyanın en kaliteli
projelerinin yarıştığı I-
SAYFA 9
MAVi KIRMIZI SARI
İzmir Büyükşehir Belediyesi Başkan
Vekili Dr. Sırrı Aydoğan, trafik
kazalarının çok büyük bir bölümünün
insan hatasından kaynaklandığını belirterek, “Hangi sektörde ve iş kolunda
olursanız olun, öncelikle işinizi iyi yapmalısınız. Bana bir şey olmaz düşüncesine asla kapılmayın. Eğitimlerde
öğrendiklerinizi aklınızdan çıkarmayın”
diye konuştu.
Yılın şoförüne ödül
Eğitim seminerinin ardından
dikkatli ve kurallara uygun bir şekilde
görev yapması ve örnek davranışları nedeniyle “Yılın Şoförü” seçilen Mevlüt
Acar da ödüllendirildi. İZELMAN
Genel Müdürlüğü kadrosunda çalışan
deneyimli otobüs şoförü, ödülünü
Büyükşehir Belediyesi Başkan Vekili
Dr. Sırrı Aydoğan’dan aldı.
Bisikletlilere saygı eğitimi
Eğitim çalışmasının ikinci aşaması
ise ESHOT Genel Müdürlüğü’nün
Sürüş Teknikleri Eğitim Merkezi’nde
yapıldı. Burada otobüs şoförlerinin
trafikteki bisiklet kullanıcılarının
güvenliğini tehlikeye düşürmemek için
nelere dikkat etmesi gerektiği
konusunda uygulamalı eğitim verildi.
(HABER MERKEZİ)
Kent içinde
bisiklet kullanımını
özendirmek ve
bisikletin
ulaşımda
kullanılmasının
önünü açmak
isteyen Karşıyaka
Belediye Başkanı
Hüseyin Mutlu
Akpınar, evinden
belediyeye kadar
bisikletle gitti.
Trafik Haftası
Etkinlikleri
kapsamında,
İzmir Bisiklet
Derneği tarafından
organize
edilen tura,
üyeler de katıldı.
klet kullanımının yaygınBaşkan Hüseyin Mutlu Akpı- bisi
laştırılması konusunda
nar “Bisiklet kullanımını
uyarmayı da ihmal etmedi.
özendirmek için çalışıyoruz”
dedi. Mavişehir’den “BİSİKLET KULLANIMI
başlayan bisiklet turu,
YAYGINLAŞMALI”
ar
kad
ne
önü
ası
bin
e
ediy
bel
Bisikletin ulaşımda kulsürdü. Sağ şeridi, araçlarla
lanılmasının kent trafiği için
birlikte kullanan Akpınar ve
derece önemli olduğunu
İzmir Bisiklet Derneği son
söyleyen Karşıyaka Belediye
üyelerine, esnaf ve vatanBaşkanı Hüseyin Mutlu
daşlar da yakın ilgi gösterdi.
ına
Akp r “Karşıyaka bir spor
Heyet, araçları ve yayaları,
ER
L
İ
L
İ
M
O
N
O
K
E
R
İ
İZM
BAHARI ÜNLÜLERLE KARŞILADI
İ
kenti. Sporun her branşıyla
ilgilenen bir toplumuz.
Bisikletin, ulaşımda kullanılabilir olduğunu göstermek istedik. Bisikletler için
uygun yolları arttırmak ve
bisiklet kullanımını
k gerek. Bisiklet
rme
özendi
hem spor hem de
sosyalleşme aracıdır. Ben de
sık sık, evden belediyeye
bisikletle geleceğim” dedi.
“AKPINAR ÖRNEK OLDU”
İzmir Bisiklet Derneği
Başkanı Dr. Gülsim Dolgun
ise Karşıyaka Belediye
Başkanı Hüseyin Mutlu
Akpınar’ın diğer başkanlara
da örnek olması gerektiğini
söyledi. Dolgun “Trafik Haftası etkinliklerimize, yerel
yöneticileri de dahil etmek
istedik. Başkan Hüseyin
Mutlu Akpınar’ın bu tutumunun diğer belediye
başkanlarına da örnek olmasını diliyorum. Bisiklet
kullanıcıları olarak, sağ
şeridi, motorlu taşıtlarla
ortak kullanmak istiyoruz.
Bu talebimiz doğrultusunda
işaretleme çalışmalarının
yapılması gerektiğini
düşünüyoruz” diye konuştu.
(HABER MERKEZİ)
zmir Ekonomi Üniversitesi (İEÜ)
öğrencileri, 13. Bahar Şenliği’nin son
gününde Mor ve Ötesi’nin konseriyle
eğlendi. Öğrenciler gün içerisinde de
sevilen diziler Güneşi Beklerken ve
Kardeş Payı’nın oyuncu ve yapımcılarıyla bir araya geldi. Güneşi Beklerken dizisinin oyuncuları Kerem
Bürsin ve Hande Doğan Demir, öğrencilerle “Selfie” fotoğrafı çekti. İEÜ
Konferans Salonu’nda ardı ardına dizi
oyuncularıyla gerçekleştirilen söyleşilerde büyük alkışlarla içeriye giren
oyuncular, uzun süre seyircilerin fotoğraf çekimi ve sevgi gösterileri
karşısında konuşmalarına başlayamadı.
Etkinlikte, Güneşi Beklerken Dizisi’nin
Yapımcısı Selim Eltaş, Yönetmen
Altan Dönmez, başrol oyuncuları
Kerem Bürsin ve Hande Doğan Demir,
öğrencilerle bir araya geldi, hayranlarının sorularını yanıtladı. Yönetmen
Altan Dönmez, samimi bir gençlik
dizisi yaptıklarını, çok sevildiğini belirterek, “Dizide zamanda geri dönüşler
yapılıyor. Samimi bir havası olduğu
için de günümüz gençleri tarafından
seviliyor. Bu sevgi karşısında biz de
çok mutlu oluyoruz” dedi.
Oyunculardan Hande Doğan
Demir, yurt dışında 20 olan dizilerin
Türkiye’de ortalama 60 dakika
sürdüğüne dikkat çekerek, “Hatalar
olabilir ama elimizden gelenin en iyisini yapıyoruz. Kerem ile birlikte haftanın 6 günü çalışıyoruz. 16 – 17
yaşındaki insanlarla bu tür bir dizi çekmek çok olanaklı değil. O yaştaki gençlerin haftanın 6 günü çekimde
tutamazsınız. Okullarından alamazsınız, yoğun bir tempoda çalışıyoruz” diye konuştu.
Özellikle genç kızların yoğun ilgi
gösterdiği Kerem Bürsin de,
Türkiye’de oyuncuların bağlı bulunduğu bir sendika olmadığını ancak ABD’de yaşadığı dönemde üyesi olduğu
bir sendika bulunduğunu söyledi.
‘Kardeş Payı Dizi Ekibi’nden
İEÜ’lü Öğrencilere Staj Sözü’
Etkinlikler kapsamında öğrenciler
ilgiyle izledikleri Kardeş Payı Dizisinin
Yapımcısı Mehmet Yiğit Alp, Senarist
ve Yönetmeni Selçuk Aydemir, Oyuncular Seda Bakan ve Ali İhsan Varol ile
söyleşide buluştu. Dizinin yapımcısı
Mehmet Yiğit Alp, İzmir Ekonomili
öğrencilerin sorusu üzerine üniversite
yönetimiyle bir araya gelerek, öğrencilere staj olanağı sağlayacaklarını
söyledi. Alp, dizilerin neden İzmir’de
çekilmediğini sorusuna da, “Dizi
çekimlerinin İstanbul dışında çekimleri
çok zor oluyor.
Tüm sektör İstanbul’da. Her hafta
90 dakikalık bir dizi çekiliyor. Bunun
başka bir şehirde çekilmesi çok zor”
dedi.
Yönetmen Selçuk Aydemir de,
komedi dizilerinin geç saatlerde neden
yayınlandığının sorulması üzerine,
“Komedi dizilerinin bütçeleri diğer
dizelere göre daha düşük. Bu nedenle
de ister istemez reklam gelirlerinden
diğer dizilerin daha fazla pay alınması
isteniyor” diye konuştu. Oyuncular
Seda Bakan ve Ali İhsan Varol da,
öğrencilerle oyunculuk deneyimlerini
paylaştı.
Söyleşilerin ardından İzmir
Ekonomi Üniversitesi 13. Bahar Şenliği, Mor ve Ötesi konseri ardından
gerçekleştirilen öğrenci gruplarının
gösterileriyle son buldu.
(HABER MERKEZİ)
SAYFA 10
SONDAKiKA GAZETESİ >>
BÜLENT
TOPUZ
CUMHURBAŞKANLIĞI
SEÇİMLERİ YENİ
BİR BAŞLANGICA
VESİLE OLABİLİR
Otuz Mart yerel seçimlerini çok
önemsedik. Yeni bir dönem başlayacağını ümit ve temenni edenler hayal
kırıklına uğradı. Umut gerek bireyi,
gerek sosyal grupları, gerekse toplumu ayakta turan bir motivasyon aracı,
bir tür iç enerji. Umudunu kaybeden
bir toplum, ya mücadele gücünü kaybediyor, ya da mücadele yöntemini
değiştiriyor.
Umutsuzların mücadele yöntemleri şiddete doğru eğilme yönünde olabilir. Sanki umudu olanların da umudunu bitirme ve yoklukta/umutsuzlukta eşitlenme isteği gibi bir çaba
vardır. Çok şükür bu toplumun her
kesimi ezici çoğunlu ile hala gelecekten umutludur ve geleceğini demokratik, meşru zeminde yapılan rekabette
aramaktadır. Bu düşüncelerden hareketle geçen yazımda “seçim bitti önümüzdeki seçimlere bakalım” demiştim;
Önümüzde seçimler var, ama en
yakını cumhurbaşkanlığı seçimi. Biz
akla en yakın gelen senaryo üzerinden fikrimizi paylaşalım. Görünen o
ki Başbakan Erdoğan, Cumhurbaşkanlığı’na aday olacak. Büyük bir ihtimalle açık veya kapalı bazı ittifaklarla cumhurbaşkanı olmayı ilk turda
bile başarabilecek. Cumhurbaşkanı
olduktan sonra açıkça deklare ettiği
gibi anayasal yetkilerini eksiksiz kullanacak. Yani en tepedeki icra heyeti
olan bakanlar kuruluna başkanlık edecek. Bazılarının da ifade ettiği üzere,
bu durumda cumhurbaşkanı belli olduğuna göre başbakan kim olacak.
Bu sorunun cevabı önemli. Zira ÖzalYılmaz ve Demirel-Çiller örnekleri
hafızalarda taze. Cumhurbaşkanı,
Başbakan uyumsuzluğu bir tarafa,
hem Özal’ın, hem de Demirel’in partileri onların yokluğunda eridi gitti.
Yani başbakan olacak kişi, hem cumhurbaşkanı ile uyumlu olacak hem de
partiyi bir arada tutacak.
Bunun için akla hemen geliveren
formül Putin-Medhedov nöbet değişimi. Yani Abdullah Gül partinin ve hükümetin başına geçecek. Bazılarının
beklediğinin aksine, aynı davanın neferi olan bu ikili arasında bu konuda
sorun çıkmayacak. Bu yolda gönüllerinden geçene göre değil, fedakarlık
üzerine kurulu bir karar ve tavır içinde olacaklardır. Bir önceki Cumhurbaşkanlığı seçimlerinde Sayın Gül’ü
işaret ederek fedakarlık gösteren Başbakanın, bu defa kendisini işaret etmesinde şaşılacak bir durum yok.
Buraya kadar yazdıklarım yazılan,
konuşulan ve bilinen şeyler. Benim
asıl gelmek istediğim nokta Türkiye’nin küresel bir oyuncu olmayı ne
kadar içselleştirdiği ve bu konuda ne
kadar umudu olduğu. Bu durumu
cumhurbaşkanlığı seçimleri üzerinden
değerlendirmek istiyorum. Benim düşünceme/temennime göre Abdullah
Gül, ne cumhurbaşkanlığına ne de
parti başkanlığına/başbakanlığa aday
olmasın. Bu millet bir faniye verebileceği en büyük makamı ona vermiş.
Bundan sonra Türkiye, Gül için Birleşmiş Milletler nezdinde bir makam
kovalamalıdır. Birleşmiş Milletler organizasyonunda gıda, güvenlik, insan
hakları, mülteciler, kalkınma vb başlıklar altında 17 alt kuruluş vardır.
Örneğin eğitim, bilim ve kültür örgütü UNESCO başkanlığı neden olmasın. NATO Genel Sekreterliği de olabilir. İllaki olması gerekmez, bu pozisyonlar için uğraşmak Türkiye’nin
yetişmiş değerleri vasıtası ile dünya
barışına/yönetimine katkıda bulunmak istediğinin en büyük kanıtı olur.
Hiçbir şey olmaz ise bölge ve dünya
barışını amaçlayan, tercihen uluslar
arası bir vakıf kurulur. Yabancı devlet
adamları arasında bu güne kadar kurduğu resmi ve kişisel dostluklar bu
amaçla kullanılır. Aksi takdirde, tekrar siyasete dönüşü bizim iç kavgaları, makamları tercih ettiğimiz, ufkumuzun coğrafi sınırlarımızla sınırlı olduğu anlamına gelir.
10 DENİZLİ HABERLERİ
SİYAH MAVİ KIRMIZI SARI
817Mayıs
Şubat2014
2013Perşembe
Perşembe
Ak Parti İl Teşkilatından
Başkan Zolan'a Ziyaret
Denizli Büyükşehir Belediye Başkanı Osman
Zolan, Ak Parti Denizli
İl Başkanı Avni Örki ve
il yönetim kurulu üyelerini makamında ağırladı. Başkan Zolan, " Hep
birlikte Denizlimize 10
yılda yapmış olduğumuz bu hizmetlerin
üzerine daha da güzel
hizmetler yaparak Denizlimizin hak etmiş olduğu, insanımızın beklediği o güzel hizmetlere kavuşturacağız" dedi
A
k Parti Denizli İl Başkanı Avni Örki ve il yönetim kurulu
üyeleri Denizli Büyükşehir
Belediye Başkanı Osman Zolan'ı
makamında ziyaret etti. Ziyaretten dolayı memnuniyetini dile getiren Başkan Zolan, " Seçim kazanmak yetmiyor. Önemli olan
bundan sonrası. Çünkü 5 yıl göz
açıp kapayıncaya kadar geçiyor.
Denizli'nin her noktasına güzel
hizmetler yapmak zorundayız ve
yapacağız da. Halkımız bize büyük teveccüh ve güven gösterdi.
Biz de hizmetlerimizle bu güveni
boşa çıkarmayacağız” dedi.
Şimdi Hizmet Zamanı
Yerel seçimler süresince partisinin tüm mensuplarının inanılmaz
bir gayret gösterdiğini ve herkese
sonsuz teşekkürlerini ilettiğini belirten Başkan Zolan, "Değerli yol
arkadaşlarım. Ziyaretinizden dolayı sizlere çok teşekkür ediyorum. Bu seçim kampanyası boyunca sizlerle birlikte gece gündüz köy köy, ova ova, ilçe ilçe,
mahalle mahalle, sokak sokak,
cadde cedde dolaştık. Nerede insanımız varsa oraya gidip kendimizi anlatmaya çalıştık. Bizlerin
gidemediği yere sizler gittiniz.
Sizler en az bizim kadar gayret
gösterdiniz. Ben öncelikle il başkanıma seçim dönemindeki uyumumuzdan, birlikte yürümemizden dolayı teşekkür ediyorum.
Aynı hedefe giden iki ok gibi olduk. Şükürler olsun ki milletimizin ittifak etmesi ile oklar hedefine ulaştı. Emeğimiz, gayretimiz
ve arzumuz yerine geldi. İnşallah
bundan sonra da Denizlimizin
beklediği hizmet, ilçelerimizde,
beldelerimizde, köylerimizde beklenilen hizmeti vereceğiz. İl baş-
kanımız, il yönetimimiz, kadın
kollarımız, gençlik kollarımız ve
tüm ilçe teşkilatlarımız ile birlikte
nerede dert var, nerede talep var
biz orada olacağız. Yine beraber
Artık emanet ve yük bizdedir. Artık bu yükü birlikte taşıyacağız.
İnşallah beklenen ve arzu edilen
tüm talepler, dertler bitecek, yeni
hizmetler halkımızın hizmetine
olacağız. İnşallah Denizlimize 10
yılda yapmış olduğumuz bu hizmetlerin üzerine daha da güzel
hizmetler yaparak Denizlimizin
hak etmiş olduğu, insanımızın
beklediği o güzel hizmetlere kavuşturacağız. Denizlimiz her şeyin
en iyisine ve en güzeline layık. Bu
çalışkan insanların bulunduğu şehir, inşallah dünya kenti olacak.
Dünya kenti olma noktasında da
tabi ki partimizin, başta Başbakanımızın vizyonu, gayreti ve heyecanı ile il yönetimimizin desteği
ile beraber yürüyeceğiz. Biz tüm
güzelliklerin Denizli’ye gelmesini
arzuluyoruz. İl başkanımızın nezdinde il yönetimimize ziyaretlerinden dolayı teşekkür ediyorum.
Hepinizin çok emeği oldu haklarınızı helal edin. İşinizi, evinizi bıraktınız. Dava milletimizin davası
idi, dava Denizlimizin geleceği idi.
sunulacak" dedi.
Her Zaman Yanınızdayız
Elde edilen başarıdan dolayı Başkan Zolan'ı kutlayan Ak Parti Denizli İl Başkanı Avni Örki ise şunları söyledi: " Sizinle birlikte girdiğimiz bu seçim sürecinde biz çok
mutlu olduk. Seçim kampanyası
esnasında çalıştığımız her gün bir
yorgunluk değil, bir mutluluk vesilesi oldu.
Seçimden sonraki süreçte
önce ilçelerdeki başkanlarımızı ziyaret edelim, en sona da en büyük başkanımıza en güzel ziyareti
gerçekleştirelim istedik. Sizin de
gördüğünüz gibi il teşkilatımızın
moral ve motivasyon noktasında
hiçbir sıkıntısı yok. Bu noktada da
en büyük pay yine sizlere ait.
Çünkü bu seçim kampanyası sırasında ılımlı bir şekilde, birbirimize
kenetlenerek ağabey kardeş, abla
kardeş şeklindeki çalışmalarımızda bize güç verdiniz. Geçirdiğimiz
bu güzel seçim kampanyası dönemi bundan sonraki Ak Parti teşkilatlarına ve diğer siyasi parti teşkilatlarına da örnek teşkil edecektir. Birçoğu da bizi notları içerisine alıp, bundan sonra siyaset öğretmek maksadıyla bu dönemleri
anlatacaktır diye düşünüyorum.
Sizinle birlikte geçirdiğim bu seçim kampanyası hem şahsım hem
de teşkilatım adına güzel bir tecrübe ve deneyim olmuştur. Şimdiye kadar teşkilatımıza göstermiş
olduğunuz özen, ilgi, alaka hakikaten dillere destan oldu. Başka
birçok ilde de konuşulan bir mesele oldu. Biz Denizli teşkilatı olarak diğer iller içerisinde bu birlik
ve beraberliğimizi seçimlerden
büyük bir başarı elde ederek taçlandırdık.
İnşallah bundan sonra da
vizyonunuz ile misyonunuz ile
geçmişteki tecrübeleriniz ile teşkilatçılığınız ile Denizlimiz sizin
kazandıracağınız hizmetlerle yerel yönetimler anlamında da taçlansın istiyorum. Bütün arkadaşlarım adına sizlere çıkmış olduğunuz bu yolda başarılar diliyorum.
İl yönetimi olarak her zaman yanınızda olduğumuzu bilmenizi isterim. Size güç vermeye, destek
olmaya devam edeceğiz. Allah
çıktığınız bu yolda utandırmasın”
(HABER MERKEZİ)
Kültürlerin buluşması
D
enizli Büyükşehir Belediye Başkanı Osman Zolan, 30. Uluslararası Amatör Tiyatro Festivali'ne katılan grupların temsilcilerini başkanlık makamında kabul etti. Festivalin
tiyatro sanatına katkısının yanı sıra
kültürler arası diyaloğu da artırdığını
dile getiren Başkan Zolan, " Festivalimiz insanlar arasındaki diyaloğu
sağlıyor. Diller, dinler ve ülkeler arası
ilişkileri güçlendiriyor" dedi.
Denizli Büyükşehir Belediye Başkanı Osman Zolan bu yıl 30. su düzenlenen Uluslararası Amatör Tiyatro
Festivali'ne katılan grupların temsilcilerini başkanlık makamında kabul
etti. Festivale katılan 18 farklı grubun temsilcilerinin katıldığı ziyaret
oldukça keyifli bir ortamda gerçekleştirildi.
Denizli Büyükşehir Belediye
Başkanı Osman Zolan, tiyatro gruplarını kapıda karşıladı. Ziyarete gelen
heyet Başkan Zolan'a çiçek ve festival tişörtü hediye etti.
Konuklarına şehrimize hoş geldiniz diyerek sözlerine başlayan Başkan Zolan, “ Sizleri ülkemizde, şehrimizde görmekten mutluluk duyuyorum. Denizlimize hoş geldiniz. Bu yıl
30.’sunu gerçekleştirdiğimiz festivalimiz Dünyada en uzun süre aralıksız
devam eden amatör tiyatro festivali
olma özelliği taşıyor. Bu festival inanıyorum ki daha çok uzun yıllar devam edecek. Bu yıl 18 grup 1 hafta
boyunca Denizlili tiyatro severlerle
buluşacak. Bu etkinlik insanlar arasındaki diyaloğu sağlıyor. Diller, dinler ve ülkeler arası ilişkileri güçlendiriyor. Tiyatro insanı anlatma sanatı.
Her biriniz insanın farklı bir yönünü,
farklı şekillerde anlatacaksınız. Denizli’ye bu güzelliği yaşatacağınız
için hepinize teşekkür ediyorum. Denizli’nin kültür ve sanatla anılması
için biz elimizden geleni yapmaya
çalışıyoruz. Çocuklarımızın, gençlerimizin sanata olan ilgisini artırmak
için gayret gösteriyoruz. Bir kez daha
sizlere teşekkürlerimi iletiyorum ve
tüm Denizlilileri oyunları izlemeye
davet ediyorum” dedi.
(HABER MERKEZİ)
Firmamızın üretim
departmanında çalıştırılmak
üzere vasıflı/vasıfsız
işçiler alınacaktır.
Can Meşrubat Ltd Şti.
Hasan Cihan
Telefon -(0258)421 64 10
0 - 533 -541 6428
SAYFA 11
SONDAKiKA GAZETESİ >>
11 DÜŞÜNENLERİN DÜŞÜNCESİ
SİYAH MAVİ KIRMIZI SARI
817
Mayıs
2014
Perşembe
Şubat
2013
Perşembe
"Uzun ince yol"un sonunu
görmek zaman alacak
Mehmet
BARLAS
SABAH GAZETESİ
Artık Yunanistan'da yaşayan bilge dostum
Herkül Millas'ın bir gözlemini hiç unutmuyorum.
"- Yunanistan'da ders verirken, öğrencilere
'Türk Solu'nu anlatamıyorum. Ayrıntılı görüşleri
verince Yunanlı öğrenciler 'Bu Nasyonal Sosyalizm'
diye tepki gösteriyorlar" demişti bir yazısında...
Aynı şeyi bugün yapsa ve Türk Solu yerine bu
defa Türkiye'de kendilerini "Liberal" kategorisinde
görenler veya "Liberal Demokrat" etiketi altında siyaset yapanlar hakkında Yunanlı öğrencilerine bilgiler verse, herhalde yine aynı tepkiyle karşılaşırdı...
- Bu liberallik değil faşistlik, derlerdi herhalde...
Tabii ki her ülkenin kendine özgü bir demokratik
modeli vardır. Mesela İngiltere'deki "Lordlar Kamarası" benzeri bir yapının, Türkiye Cumhuriyeti Anayasası'nda yer alacağını düşünebilir misiniz?
Post-modern İttihatçılık
Ancak kendimize özgü demokratik modeli oluşturmaya çalışırken, bunun içine Batı'dan da Do-
ğu'dan da esintilerle renkler kattık. Mesela Ortadoğu
faşizminin simgesi olan "Baas", Osmanlı'nın "İttihat
Ve Terakki"sinden de esinlenmişti. Militarizme, biraz faşizm biraz da sosyalizm katılarak, Arap Milliyetçiliği'ni önplana alan bir ideoloji türetilmişti. Bizim Tek Parti dönemi CHP'si de Türk Milliyetçiliği'nin eklendiği ve Laikliğin bir devlet inancı biçiminde sunulduğu Baas benzeri bir yapı değil miydi?
Ya da Cumhuriyet'le doğan CHP, bir anlamda
"Post- modern İttihat ve Terakki" değil miydi? Bu
yapılanmaya karşı en ciddi reaksiyon Demokrat Parti ile geldi... Ama unutmayalım ki Demokrat Parti'yi
kuranlar da eski CHP'lilerdi ve liderleri Celal Bayar
da, eski bir İttihatçıydı...
Hep aynı hikâye
Demokratlar "Derin Devlet" yerine "Derin
Halk"a dayanmayı denediler. Ama eski yapılanmayı
değiştiremediler ve 27 Mayıs 1960 darbesi ile bu deneme sona erdirildi. Daha sonraki yıllarda Demokrat
Parti'nin mirasçısı olarak görülen Süleyman Demirel
de iki kez askeri darbeyle devrilince, bu yapılanma
ile baş edemeyeceğini anladı... Sonunda 28 Şubat
post-modern darbesi ile metamorfoza uğrayıp, onlar
gibi oldu. "Halkçılık" ilkesini farklı bir zemine taşıyacakken post-modern darbenin bir aktörü durumuna düşen Bülent Ecevit'in öyküsü de böyle değil midir?
Katı bir ideolojik eğitimle yoğunlaştırılmış ve
hem tabular hem de yasaklarla dolu ortamda siyasal
liderler tam olarak nerede bulunduklarını göremezken, sol adına düşünce üreten yan siyasal akımların
da sosyalizm diyerek faşizme kaymaları, herhalde
doğaldı.
Özal'dan Erdoğan'a...
Bu sürecin yönünü A'dan Z'ye gerçekten ve bilinçle değiştirmeyi deneyen ilk kişi Turgut Özal'dır. Bugün de Tayyip Erdoğan'ın aynı süreci devam ettirdiğini söyleyebiliriz. Ama bir toplumda her şey bir anda ve hatta bir yüzyılda bile değişmiyor. Dünya da
yurt da değişse bile, genlerdeki eski bilgiler kuşaklar
sonra açığa çıkabiliyor.
Dışişleri Bakanı Davutoğlu'nun pek güzel gözlemlediği gibi genlerimizde, kazan kaldırıp sadrazam
kellesi isteyen Yeniçerilerin bilgisi de, Başbakanlığı
basan İttihatçıların öğretisi de var... Kendilerini Liberal Demokrat olarak sunanların söylemlerinde NeoNaziliği bulmak da mümkün... Ve hatta laikliğin cemaatçilikle sarmaş dolaş olduğunu da görmüyor muyuz?
Kısacası uzun ince bir yoldayız hâlâ...
07.05.2014
Kaybolan ya da çalınan kimlik
Abdurrahman
DLPAK
YENİ AKİT GAZETESİ
Bir önerim var. Bu bir fırsat. Nüfus cüzdanları yenilenirken, insanların parmak izlerini, göz retinalarını
ve resimlerini de kayda alalım.. Ve kendilerine e-devlet şifresi ve mail adresi verelim.
Gümrük ve Ticaret Bakanı Hayati Yazıcı, “Merkezi Sicil Kayıt Sistemi (MERSİS) ile kaybolan ya da
çalınan nüfus cüzdanı, ehliyet ve pasaport belgelerindeki bilgilerin kullanılarak şirket kuruluşu yapılmasının önüne geçtik” diye bir açıklama yaptı, ama bu yetmez..
İstanbul Aksaray’da, sokak çocuklarından toplanan kimlikler satılıyor.. Böyle bir karaborsa var.
Daha vahimini söyleyeyim, paralel yapının sahte
kimlik belgeleri ve pasaportları var.. Bu yolu sadece
paralelciler değil, birçok kişi kullanmış. Bu kimlikler
üzerinden banka hesapları açılmış..
Parmak izi, göz, ses kaydı, imza ve resim kaydı
alınır ve eşleştirme yapılırsa, bunlar tesbit edilebilir..
Ve kayıt işleri bittikten sonra, yenilenmeyen kayıtlar
incelemeye alınabilir.. Bu süreç başladıktan sonra kapatılan hesaplar ve işlemler de bu veri tabanı üzerinden incelemeye alınabilir..
Aramızda çifte kimlikli birtakım kripto adamlar
dolaşıyor. Hatta bunların yurtdışından farklı isimlerle
alınmış kimlik ve pasaportları da var.. Aslında ses, fotoğraf ve parmak izi kayıtları ile bu çifte kimlikleri
tesbit etmek de mümkün.. Gümrükler ve el panelleri
ile şüpheliler taranabilir..
On yılda bir resim, ses ve retina kaydı, parmak izi
yenilenmeli..
Bu süreçte paralel, çift seri numaralı kimlik işlemlerinin de bu şekilde önüne geçilebilir..
Eğer ciddi bir tarama yapılacak olursa, ticaret sicilinden banka hesaplarına, memur sicillerinden araç
sahiplerine, diploma işlemlerine kadar bir sürü yasadışı tasarruf ortaya çıkacaktır..
Ticaret sicil işlemlerinde bir ayda 1000’den fazla
illegal işlem başvurusu olmuş, banka hesaplarında bu
rakamın çok daha fazla olacağını düşünüyorum..
Oluşturulan ikinci kimliklerle, yurtdışında da birtakım finansal işlemler ve gümrük işlemleri olduğu
iddiaları var.. Bu konu yargıyı da ilgilendiriyor öte
yandan..
Kaybolan kimliğimiz sadece Nüfus İdaresinin verdiği kimlikler değil, bir de gerçekten alameti farikamız, bizi biz yapan, bizi diğerlerinden ayıran özelliklerimizi de kaybediyor olmayalım sakın.. İnanç, tarih,
kültür, gelenek.. Geçmişe saplanıp kalmayacağız kuşkusuz da, geçmişten tamamen soyutlanmış bir gelecek de sağlıklı bir durum değil..
Firma isimleri, reklam afişleri, sloganlar ve vaad
edilen hayat tarzı tam bir fecaat.. Ciddi bir “yabancılaşma” tehdidi ile karşı karşıyayız.. Çilesiz, hedonist,
kariyerist, mutsuz bir gençlik yetişiyor. Aile çözülüyor.. Bu felaket bir durum.. “Plaza”larda çalışanlar
tam bir Yuppy! Yedikleri, içtikleri, arkadaşlıklar ile
kendine yabancı bir karakter..
Geç evleniyor gençler ya da hiç evlenmiyorlar..
Çabuk boşanıyorlar. Çocuk yapmıyorlar, devam eden
evliliklerde ise mutluluk katsayısı çok düşük.. İslam’dan, gelenekten uzaklaştıkça bu durum daha belirgin bir hal alıyor..
Kreş, okul, çocukları anne babalarından çalıyor gibi sanki.. Atomize, agnostik, başıboş bir gençlik geliyor.. Ne sağda, ne solda, aklı futbolda ya da sev-genç..
Aile ve gençlik konusu, öncelikli, acil ve hayati
öneme sahip iki konu. Bu anlamda basını, gazetesi,
dergisi, interneti, radyosu, televizyonu, sosyal mediası
ile yeni baştan ele almamız gerekiyor..
Bu konuda hepimize büyük sorumluluklar düşmektedir.. Sadece basın değil, devlet, sivil toplum,
herkes, Milli Eğitim ve Kültür Bakanlıklarına da bu
konuda büyük sorumluluklar düşüyor.. Devleti yönetenler ve akil insanların, kanaat önderlerinin bu konuda güzel örnekler olması gerekiyor.
Batılın tasviri saf zihinleri idlâl ediyor/bozuyor.
Suçun/ayıbın/günahın alenileşmesi geniş halk kitlelerinin kafasında bu sapmaların meşrulaşmasına sebeb
oluyor..
Kimliğimize her anlamda sahip çıkmamız gerekiyor. Bu konuda en büyük sorumluluk da ailelere düşüyor..
Selâm ve dua ile.. 07.05.2014
Fehmi
KORU
STAR GAZETESİ
Feryatlar ve çığlıklar yükseliyor, ama...
Biraz önce izlediğimde YouTube üzerinden ulaşan
19 milyon 957 bin 643. meraklı olmuştum; önceki yarım-cümleyi yazdıktan sonra yeniden baktım, benimle
birlikte 20 bine yakın kişi daha izlemiş İngiliz gencinin
‘Look up’ (‘başını kaldır’) isimli videosunu... 25 Nisan’dan buyana 20 milyon insan...
Gary Turk’ün şiirsel mesajı çok açık: Bugünün genci elektronik cihazlara bağımlılığı yüzünden ‘insan’ olma özelliklerinden çoğunu kaybediyor ve kalabalık
içinde yalnızlaşıyor... “Telefonlarımız akıllandıkça bizler aptallaşıyoruz” diyor Gary...
Mesaj basit olmasına basit, ama önemli. Yanyana
yaşadığı halde birbirleriyle ilişkisi giderek sanallaşan,
yüzyüze geldiğinde bile elektronik cihazlarından uzak
kalamayan bir insan sürüsüne dönüşüyoruz... Bugünün
bebekleri tabletli ortamlara doğuyor ve sokağı tanımadan büyüyorlar...
Dünyanın dört bir tarafından 20 milyon kişi, içlerinden birinin kopardığı feryadı, yine sanal dünyanın
sağladığı imkânı kullanarak işitiyor.
Bunu bir kenara not edin...
Eş zamanlı bir gelişme de kitap dünyasında yaşanıyor. Sınırlı bir ilgiyle karşılaşacağı beklentisiyle bir
üniversite yayınevi (Harvard University Press) tarafından yayınlanmış, Fransız ekonomi profesörü Thomas
Piketty’nin yazdığı ‘Capital in the Twenty-First Century’ (‘21. Yüzyılda Kapital’) adlı eser, başta ABD olmak üzere, Batı’da kapış kapış gidiyor...
Matbaalar 700 sayfalık eseri kitapçılara yetiştiremiyor. İnternet kitapçısı Amazon kitapla ilgili sayfasına
günler öncesinden “Geçici olarak elimizde yok, sipariş
verin, gelince gönderelim” duyurusunu koydu. Çok
meraklı olanlar ancak e-kitap olarak indirip okuyabiliyor.
Kimi, yazarının ‘solcu’ kimliği ve adındaki ‘kapital’ sözcüğünden hareketle Karl Marx’la ilinti kurarak
kitaba önyargıyla yaklaşsa da, Piketty’nin tezinin
Marksizm ile bir ilişkisi yok. Kendisiyle yapılmış bir
röportajda, Piketty, Marx’la ve özellikle de başeseri
‘Kapital’le gözünü yormadığını, kitabının kolay ulaşılabilir verilere dayandığını açıkça söylemiş...
Fransız profesörün ‘Kapital’ kitabının tezi karmaşık
değil: Bütün aksine iddialara rağmen, gelişmiş ülkelerde gelir dengesizliği fakirlerin aleyhine; fakirlerle zenginlerin gelirlerinin arası açıldıkça açılıyor. Dünya gelirinin yüzde 25’ine hükmeden ABD’de, nüfusun yüzde
1’i ülke gelirinin yüzde 20’sini alıyor... Bu oran 32 yılda yüzde 10’dan yüzde 20’ye çıkmış bulunuyor... Gelir
artıyor, ama artan gelirin yarısı nüfusun yüzde 10’unu
teşkil eden zenginlere gidiveriyor...
Oranlar değişse de hemen her ülkede gelir dağılı-
mındaki adaletsizlik günümüzde dayanılmaz boyutlara
ulaşmış durumda.
‘Yüzyılın eseri’ adı verilen kitapta işlenen tezin izlerini hemen bütün ülkelerde önceki gün açıklanan gelir vergisi rekortmenleri listesine bakıp Türkiye’de de
bulmak mümkün...
Amazonkitabın etkisini azaltmak için özel bir çaba
gösterildiğinden, kitabı edinmediği ve okumadığı halde
hakkında olumsuz kanaatler bildirip ‘0’ puan vermeye
kalkışanların varlığından söz ediyor; müşterilerini uyarıyor...
Ne oluyor?
Pikettyve Turk gibi erken uyananlardan feryatlar ve
çığlıklar duyuyoruz dünyamızın gittiği istikametle ilgili, ama içine düşülen kıskaçtan çıkış ve kurtulma yolunda henüz ciddi siyasi çabalar görmüyoruz.
Esas ona ihtiyaç var. 07.05.2014
SAYFA 12
SONDAKiKA GAZETESİ >>
ACİL TELEFONLAR
İtfaye
AKS110
Acil Yardım
Polis İmdat
Elektrik Arıza
Jandarma İmdat
İZSU Su Arıza
Doğalgaz Acil Müdahale
Cenaze Hizmetleri
Sahil Güvenlik
Orman Yangınları
110
110
112
155
186
156
185
187
188
158
177
YANGIN TELEFONLARI
İzmir
Karşıyaka
Kadifekale
Bornova
Bostanlı
Buca
Karabağlar
Çamdibi
Çiğli
Balçova
Evka 4
Evka 1
Gaziemir
Hatay
Narlıdere
Güzelbahçe
110
372 58 74
225 49 99
388 10 03
386 17 86
487 13 61
237 13 07
433 65 59
376 73 23
278 76 02
351 09 04
452 24 77
251 00 44
250 86 40
238 35 97
234 25 34
HASTANE TELEFONLARI
-Devlet HastaneleriAliağa
616 87 87
N.S. İşgören Alsancak
463 64 65
Alsancak Acil Servis
Ağız ve Diş Sağlığı
422 00 76
Alsancak Diş Hast.
464 78 62
Atatürk Devlet
244 44 44
Behçet Uz
489 56 56
Bornava Dev. Hast.
375 58 58
Bozyaka Eği. Hast.
250 50 50
Buca S.D. Hastanesi
452 52 52
Çeşme A. Çizgenakat
712 07 77
Foça
812 14 29
Göğüs Hastanesi
433 33 33
Konak Diş Hastanesi
441 81 81
Karşıyaka
366 88 88
Çiğli Dev. Hastanesi
376 23 33
Menemen Dev. Hast.
832 58 59
Nejat Hepkon
Seferihisar Hastanesi
743 20 10
Selçuk Dev. Hast.
892 70 36
Urla Dev. Hastanesi
752 10 04
Tepecik Dev. Hast.
469 69 69
12 GÜNCEL
SİYAH MAVİ KIRMIZI SARI
817Mayıs
Şubat2014
2013Perşembe
Perşembe
CHP İl Başkanı Engin:
Aday gösterilmeyince
partiye küsmedim
CHP İzmir İl Başkanı Ali Engin, yerel
seçimler öncesinde bazı partililerin, aday gösterilmeme gibi nedenlerle parti aleyhine
çalıştığını belirterek “Partiyi küçük
düşürmek, parti aleyhinde çalışmak siyasi bir
suç olmasının dışında etik ve ahlaki değil.
Ben de 25 yıllık partiliyim. Aday gösterilmediğim zamanlarda partiye küsmedim,
hep ön sıralarda yürüdüm. Bana ‘disiplin
sopası mı gösteriyorsun’ diyorlar. İnsanlar
muhalefet yapsınlar, iddialarını sürdürsünler,
partide kalsınlar düşüncesi bizi sıkıştırıyor.
Bu noktada sıkışıyoruz. Şahsıma yönelik iftiralar çok yapıldı. İl yönetim kurulunda bunu
söyledim. Şahsıma yapılan hakaretleri disiplin konusu yapmayacağım. Partiye yapılanları ne yapacağız bunu konuşuyoruz. Partinin
vicdanı var. Partinin aklının bu konuyu aşacağını düşünüyorum.”
dedi.
Engin, kendisini istifaya davet eden ve et ettiği ve önümüzdeki günlerde imza hareketi
başlatacaklarını açıklayan partililer için de,
“Bir an önce toplayacaklarsa toplasınlar. Toplarlarsa kongre olur. Aday
olurum. Karşıma rakip
çıkar. Yaptığım icraatların
tabanda ne kadar karşılık
olduğunu görmüş olurum
kongrede.” şeklinde
konuştu.
CHP İzmir İl Başkanı
Ali Engin, parti olarak
İzmir’in Karabağlar, Buca ve Bayraklı
ilçelerini kazanmalarının büyük önem arz ettiğini söyledi. AKP’nin bu 3 ilçeye
‘kazanırız’ gözüyle baktığını ileri süren Engin, “Bu 3 ilçeyi kaybetseydik, AKP kent
merkezine yerleşecekti. Yeşil alanlar yok
edilecekti. Ucube yönetimler görebilirdik buralarda. Bu yüzden örgütü kutluyorum. Tire
ve Bayındır’ı 60 yıl sonra almak başarıdır.”
diye konuştu. Engin, parti olarak İzmir’de 8
ilçenin kaybedilmesini başarısızlık olarak
gördüklerini, bu konuyu 40 gündür tartıştıklarını belirtti.
İzmir’de 8 ilçenin kaybedilmesinin parti için başarısızlık olduğunu aktaran Engin,
“Bu konuyu 40 gündür tartışıyoruz, tartış-
25 yıldan beri CHP'de
siyaset yaptığını
söyleyen CHP İzmir İl
Başkanı Engin, "Aday
gösterilmediğim zamanlarda partiye küsmedim,
hep ön sıralarda
yürüdüm. Halen aynı
tavrımı koruyorum. Bana değil ama partiye
yanlış yapandan hesap
sorulmalı" dedi
maya da devam edeceğiz. 8 ilçeyi kaybetmemizin nedenlerine yönelik rapor hazırlayıp kamuoyuyla paylaşacağız. Bizden kaynaklanan nedenler de var. Bunlardan kaçmayacağız, tartışacağız. Eksikleri Genel
Başkan ve il başkanına yüklemek, vicdani,
siyasi ve ahlaki olarak doğru değil. İl başkanları toplantısındaydım geçen hafta. İl başkanları beni kutluyordu. Ankara’dan baktığında
İzmir başarılı. Büyükşehir’i almışınız. Yüzde
50 büyük bir oy. İstanbul’u Antalya’yı,
Ankara’yı alamamışız. Herkes beni kutladı.
CHP’nin İzmir’de başarısız olduğunu tabanda belli arkadaşlar dile getiriyor.” ifadelerini
kullandı.
(CİHAN)
Akhisar'da kermes şenliği
Manisa'nın Akhisar ilçesinde
faaliyet gösteren Akhisar Kültür ve
Eğitim Geliştirme Derneği
(EKDER), maddi durumu iyi olmayan öğrenciler ve ihtiyaç sahipleri
için 'Eğitim Kültür ve Sanat Şenliği'
adı altında kermes düzenledi. Açılışa
Dernek üyeleri ve çok sayıda vatandaş katıldı. Kermes, Özel Em-
inbey Koleji Din Kültürü Öğretmeni
İbrahim Kocataş’ın duasıyla açıldı.
İkinci Nakliye Caddesi, Körfez Dershanesi çaprazındaki kermesin 8 gün
açık kalacağını belirten Dernek
Başkanı Hacer Erden, “Yardıma
muhtaç çocuklarımıza sahip çıkmak,
onların burs ve ihtiyaçlarını karşılamak maksadıyla kermes düzenledik.
Kermesimizde gıdadan giyime, tatlı
çeşitlerinden ev yemeklerine, pike
takımından, iğne oyalı yazmalar ve
çeyizlik eşyalarına kadar birçok
ürünü vatandaşlarımızla buluşturduk. Elde edilecek gelirle ihtiyaç
sahiplerinin yüzlerini bir nebze olsun
hep beraber güldüre bilirsek ne mutlu bize.” şeklinde konuştu. (CİHAN)
-Belediye HastaneleriEşrefpaşa Bel. Hast. 293 80 00
-Özel HastanelerAnadolu Tıp Merkezi
272 00 11
Agora Tıp Merkezi
425 73 73
Atakalp Kalp Hastanesi
483 14 14
Atakent Tıp Merkezi
336 11 95
Atagöz Göz Hastalıkları 435 35 35
Atafizik, Fizik Ted. Mer.
231 25 15
Batıgöz Hastanesi
489 03 03
Bornova Tıp Merkezi
388 20 40
Bornova Özel Tıp Mer.
343 23 50
Bornova Özel
Sağlık Tıp Merkezi
339 77 83
Buca Tıp Merkezi
438 14 14
Buca Sağlık Merkezi
438 06 20
Central Hospital
341 67 67
Can Tıp Merkezi
232 13 48
Caner Göz Merkezi
278 81 11
Çağdaş Tıp Merkezi
285 95 95
Çankaya Tıp Merkezi
425 31 31
Çesav Tıp Merkezi
362 67 67
Çeşme Sissus Has.
723 05 55
Çınarlı Hastanesi
462 27 27
Çiğli Özel Sağ.
386 26 16
Diyabet Hastanesi
449 13 19
Diamed Dah. Dal Mer.
465 27 37
Doğa Tıp Mer.
244 16 16
Dr. Sıhhat Tıp Merkezi
367 67 47
Efes K.B.B. Merkezi
446 15 16
Ege Sağlık Hastanesi
463 77 00
Ege Tüp Bebek Merkezi 445 31 45
Egeria Çocuk Sağlık
Hastanesi Dal Merkezi
489 35 35
Ekol K.B.B. Dal Mer.
386 55 05
Ekol K.B.B. Şube
369 89 65
El ve Mikro Cerrahi
441 02 21
Gazi Kent Tıp Merkezi
252 45 00
Gaziemir Tıp Merkezi
251 47 67
Hayat Hastanesi
441 41 96
İzmir Hastanesi
483 31 31
İrenbe Tüp Bebek Mer.
464 58 88
441 41 70
Karataş
Karşıyaka Tıp Merkezi
369 00 91
POLİKLİNİK TELEFONLARI
Borcanevi
Bornova Yeni Yaşam
Bozyaka Halk
Bozyaka Dispanseri
Buca Çözüm
Cansu Karabağlar
Çamdibi Derman Polik.
Çizgi Polik.
Deniz Sağlık Polik.
Ege Sağlık
Egeform Fizik
Eşrefpaşa Ö.Sağ.
Eşrefpaşa Zinde Polik.
Gaziemir Dr. Polik.
Gazi Kent Polik.
Halk Polik.
Hatay Özel Sağlık
İhtisas Polik.
Karşıyaka Park Sağlık
Mevlana Polik.
Mersinli Özel Sağlık
Neron Psikiyatri
Nergiz Özel Sağlık
Onur Polik.
Özel 9 Eylüllüler Polik.
Özel Altındağ
Özel Brn Dr. Dispanseri
Özel Çiğli Polik.
Özel Eylül Polik.
Özel Gülhan Polik.
Özel İrem Sağlık Polik.
Özel İzmir Polik.
Özel Pınarbaşı Polik.
Özel Sarnıç Polik.
Özel Seferihisar Polik.
Özel Serin Polik.
Özel Yedigöller Polik.
Özel Yenişehir Polik.
Park Sağlık Polik.
Sevgi Özel Sağlık
Şöferler Odası
Sağlık Polik.
Teos Polik.
Vefa Polik.
Yeşiltepe Polik.
Yıkık Cami Halk.
255 04 44
388 03 31
261 39 13
256 09 86
438 76 26
237 73 83
435 00 77
226 34 34
369 90 91
487 57 64
464 24 24
227 35 26
262 64 71
252 36 92
274 13 74
285 46 34
250 51 52
254 13 13
367 22 22
343 32 43
461 19 99
256 76 76
364 08 10
458 77 45
453 81 11
458 05 89
347 38 92
386 05 95
373 85 74
347 99 91
251 84 24
343 23 50
479 80 25
281 64 03
743 58 48
261 29 99
442 29 92
433 09 24
367 22 22
438 37 38
227 99 35
743 57 77
341 84 24
351 38 72
271 27 27
-Askeri HastanelerHava Hastanesi
285 96 50
Kara Hastanesi
262 55 55
ÜNİVERSİTE TELEFONLARI
Başkent Üni. Zübeyde Hanım Uyg.
Merkezi
330 52 30
Dokuz Eylül Ünv.
412 22 22
Dokuz Eylül Üni.
Karşıyaka Polik.
369 30 40
Ege Üniversitesi
444 13 43
İlaç ve Zehir Dan.
277 73 33
Ege Üni.Uyg.ve
Araş.Merkezi
330 52 30
-Doğum EvleriEge Üni. Tıp Fak.
388 19 63
Konak Doğum Evi
489 09 09
Tepecik Doğum Hast.
449 49 49
-Kan MerkezleriKızılay
463 63 53
Çocuk Hastanesi
433 06 08
Ege Üni.
388 28 61
Tepecik Kan Merkezi
433 38 74
ULAŞIM TELEFONLARI
Denizyolları
THY Rezervasyon
Basm. Rezervasyon
Alsancak Gar
Santral Garaj
-Türk TelekomArıza
Bilinmeyen Numara
Danışma
Uyandırma
Posta Kodu
Fono Tel
Borç Ögrenme
Çağrı
-SinemalarAgora Balçova
Afm Park Bornova
Afm Forum Bornova
Afm Ege Park
Afm Passtel
121
11811
444 14 44
135
119
141
163
133
277 25 25
373 73 20
373 03 50
324 42 64
489 22 00
Avşar Palmiye
Cinebonus
Cinebonus
Cinebonus (Ykm)
Cinecity Kipa Çiğli
Çeşme Hollywood
Çamlıca
Deniz Karşıyaka
Batı Sineması
Çınar Sineması
Karaca Sineması
Kipa Hollywood
Menemen Kültür
Şan Konak
Çınar Center
277 48 00
278 87 87
446 90 40
425 01 25
386 58 88
712 07 13
343 83 15
381 64 61
347 58 25
489 88 85
445 87 76
252 56 66
832 14 11
483 75 11
277 11 00
Sema Sineması
Konak Sineması
Desem Sineması
Karşıyaka Sineması
İzmir Sİneması
-TiyatroKonak Sahnesi
Ragıp Haykır Sahn.
İzmir Devlet Tiyat.
Uğur Mumcu Sahnesi
İzmir Tiyatro
Bab-ı Sanat Merkezi
İsmet İnönü
Sanat Merkezi
483 91 00
483 21 91
422 53 10
381 50 98
421 42 61
483 50 35
369 14 87
445 89 41
343 04 33
446 77 95
441 09 02
464 88 89
444 08 49
484 86 38
464 77 95
472 10 10
-Körfez Ulaşım İskelelerKonak
484 98 56
Karşıyaka
368 00 42
Alsancak
464 78 31
Bostanlı
330 89 22
Bayraklı İskele
345 77 53
Pasaport İskele
484 22 56
Göztepe İskele
224 20 22
Üçkuyular İskele
259 40 13
-Elektrik ArızaGenel Kesinti Seb.
435 11 84
Buca
426 69 37
Çiğli
376 90 91
Karşıyaka
369 79 80
Bornova
388 83 78
Narlıdere
238 32 90
261 48 04
Eşrefpasa
Gaziemir
251 92 05
Güzelbahçe
234 05 34
Konak
425 60 60
Çeşme
712 63 46
SAYFA 13
SONDAKiKA GAZETESİ >>
13 SAĞLIK
SİYAH MAVİ KIRMIZI SARI
817
Mayıs
2014
Perşembe
Şubat
2013
Perşembe
Bebeklik döneminde kafaya alınan darbelerin çocuklar için gelecekte risk anlamına geldiğini
belirten uzmanlar havale nöbetleri, hareket kusuru, gelişme geriliği ve ciltte oluşan morlukların
bu kapsamda değerlendirilebileceğini kaydetti. Dr. Yılmaz, " Hemen hekime gidilmeli" dedi
n
a
n
ı
l
a
a
y
a
f
a
k
e
d
r
e
l
k
e
Beb
!
r
o
y
ı
t
r
a
r
a
k
t
a
y
a
h
r
e
darbel
Ç
ocuk ve bebeklerin
yaralanmalarında en çok
mama sandalyesinden,
beşikten düşmeler ya da
oyun parklarındaki
yaralanmalar öne çıkıyor. Uzm. Dr. T. Alper
Yılmaz, bazı çocukların kafaya alınan
darbeler ve travmalar konusunda daha
fazla risk taşıdığını belirterek anne babaların bu konuda tedbirli davranması
gerektiğini söyledi. Yılmaz, çocukların
yetişkinlerle kıyaslandığında yaralanmalara karşı daha dayanıklı olduğunu belirtti. Bunun yanında çocukların kafa
yapıları ve kemiklerinin daha esnek
olduğunu belirten Yılmaz, kafaya alınan
darbelerde bıngıldak denilen zarın beyni
koruduğunu ve bu zarın bilinenden daha
hassas değil koruyucu olduğunu hatırlattı. Yılmaz, “Çok sert bir darbe almadıkça, hafif çarpmalardan zarar
görmez. Bazı çocuklarda kafaya alınan
darbeler ve travmalar daha fazla risk
taşır. 2 yaşından küçük olan, epileptik
yani havale nöbetleri geçiren, felç gibi
hareket kusuru olan, gelişme geriliği,
kanamaya yatkınlık ve cildinde kolayca
morluklar oluşan çocuklar bu gruba girer.” dedi.
Çocukta göz kaymaları ve kusma
gibi durumlar oluşmuşsa hemen doktora
başvurlaması gerektiğini belirten Yılmaz,
“Düşme gerçekleştikten sonra en çok
dikkat edilmesi gereken, çocukların gözlerindeki kaymalar ve kusmadır. Vaka
sonrasında ağızdan fışkıracak tarzda kusmalar olabilir. Bu tip durumlarda öncelikle acil servislere başvurulmalı, ardından da bir beyin cerrahı uzmanının
değerlendirmesi alınmalıdır.” diyerek zaman kaybı yaşanmaması gerektiğinin altını çizdi.
Başa alınan
darbeden hemen
sonra öncelikli olarak çocuğun
dilinin içeriye kaçmadığından ve rahat nefes aldığından
emin olmak gerektiğini anlatan Yılmaz, “Bunlara
ilaveten çocukta unutkanlık, dezoryantasyon denilen durum yani nerede ve
kiminle olduğunu
kavrayamama, baş
ağrısı ve uyku hali
gözlemleniyorsa bu
belirtilerde önemli uyarıcılardır. Ancak
çocukta uykuya eğilim hali hemen darbe
sonrası oluşmayabilir,
ilerleyen günler içinde de ortaya çıkabilir.” açıklamasında bulundu.
Olayın ardından ilk yapılan iş olan
çocuğun yerden kaldırılmasında bile çok
dikkatli olunması gerektiğini belirten
Yılmaz, şöyle konuştu: “Çocuğun
görmesinde bozukluk, gözkapağında bir
değişiklik, gözbebeklerinde farklılaşma,
kulaktan su gibi bir sıvının
gelmesi, bir tarafının tutmaması, yürümesinin
bozulması gibi durumlar
da gözlenebilir. Çocuk,
düşme sonucu şuursuz bir
şekilde yerde yatıyorsa ebeveynlerin veya çocuğa
o an refakat eden kişilerin mutlaka ambulans
çağırması ve bir sağlık
kuruluşuna başvurmaları
gerekir. Çünkü çocuğu
olduğu yerden kıpırdatmak daha ciddi zararlara neden olabilir.
Büyük çocuklarda ise
mide bulantıları, kusma
ve konuşma bozuklukları yaşanabilir.”
Kafaya alınan
darbelerin anne babalar tarafından mutlaka önemsenmesi
gerektiğini, hasarın o-
laydan çok sonra bile ortaya çıkabileceğinin unutulmaması gerektiğini hatırlatan Yılmaz, “Darbe esnasında hiçbir şey
olmamış gibi görünebilir. Ancak her darbeyi mutlaka önemsemek gerekir. Önden
alınan darbe başın arka kısmını, arkadan
alınan darbe başın ön kısmını etkileyebilir. Eğer darbe sonucu oluşan açık bir
yara gözlemleniyorsa, gazlı bir bezle
yoksa temiz bir bezle yara-kesik üzerine
bastırılarak kanama durdurulabilir." dedi.
DARBELERDEN NASIL KORUNMALI
Çocukların yürümeye başlamasından
sonra alınacak önlemlerin farklılaştığını
söyleyen Yılmaz, şöyle devam etti:
“Eğer çocuk tutunarak ayağa kalkıyorsa,
bu defa bariyerler tek başına yeterli
gelmez. Burada dikkat edilecek nokta,
karyolanın fazla yüksek olmamasıdır. Bu
şekilde etrafına minder tarzı yumuşak
malzemelerden oluşturulan bariyerleri
aşıp düşmesi ihtimaline karşı koruma
sağlar. Emekleme döneminde olan
çocuklar ise, uzun süre tek başlarına
bırakılmamalıdır. Pencerelerde çocuk kilidi olmalı, üzerine basıp düşebileceği
eşyalar sabitlenmeli, balkon ve merdivenlerden çocuk uzak tutulmalıdır. Ayrıca evdeki mobilyaların sivri köşelerine
takılan plastik köşe koruyucular da kullanılabilir." ifadelerini kullandı.
(CİHAN)
Çay, kalp krizi
riskini azaltıyor
Diyetisyen Gizem Şeber, günde bir kupa çay
tüketiminin kalp krizi riskini yüzde 44'e kadar
azalttığını söyledi. Yapılan 7 ayrı bilimsel
çalışmanın da bu yönde verilerinin bulunduğunu aktardı. Diyetisyen Gizem Şeber,
çayın insan sağlığı üzerindeki etkileri hakkında bilgi verdi. Çay tüketiminin kanın homosistein düzeyi ile ters ilişki oluşturduğunu dile getiren Şeber, "Çay tüketiminden 30 dakika sonra tansiyonda hafif bir artış gözlenir. Sonrasında tansiyonun normale döner." dedi. Çayın
kalp krizi riskini de azalttığını kaydeden Şeber,
günde bir kupa çay tüketiminin kalp krizi
riskini yüzde 44 oranında azaltabileceğini vurguladı. Diyetisyen Şeber, çayın barındırdığı
diğer özeliklerini ise şöyle sıralıyor: "Yeşil çay
ve siyah çayın antioksidan kapasitesi; sarımsak, ıspanak, karnabahar ve Brüksel lahanasından daha fazladır. Tek bardak çayın, 30-60
dakika içerisinde kanda antioksidan seviyesini
yükselttiği gözlenmiştir.
300 ml suya hazırlanmış yeşil çayın (3 kupa)
tüketiminden sonra kan antioksidan seviyelerinde ciddi artışlar oluşmuştur. Çin'de
yapılan bir çalışmada, 40 erkek sigara bağımlısına 7 gün boyunca günde 6 kupa yeşil çay
tükettirildiğinde, DNA hasarında ve serbest
radikal üretiminde azalma olduğu saptanmıştır." (CİHAN)
Göz muayenesi değil
sanki CHECK-UP
G
öz Hastalıkları Uzmanı Op.
Dr. Neslihan Astam, şeker
hastalığı ve yüksek tansiyonun görme kaybına neden olabileceğini belirterek göz sağlığında ki
değişiklikler pek çok ciddi hastalığa
işaret edebileceğini söyledi. Astam,
"Gözlerde herhangi bir sorun olmasa bile yılda bir kez kontrol yaptırılması, hastalıkların teşhisi açısından büyük önem taşıyor." dedi
Memorial Ankara Hastanesi Göz
Hastalıkları Bölümü’nden Op. Dr.
Neslihan Astam, göz sağlığı ve sistemik hastalıklar arasındaki ilişki
hakkında bilgi verdi. Önemli
hastalıkların gözleri vurabileceğini
söyleyen Astam, "Basit bir retina
muayenesi sayesinde; diyabet,
hipertansiyon, her türlü damar, kan
ve beyin hastalıkları tespit
edilebilmektedir. Herhangi bir boya
maddesi ya da röntgen ışını kullanmadan, göz siniri ve retina damar
yapısından kişinin kalp damar sistemi ve beyin içi hakkında bilgi almak mümkündür." diye konuştu.
Şeker hastalığının ani görme
Açlığınız tamamen duygusal olabilir
Beslenme ve Diyet Uzmanı Başak Kefeli,
açlığın tamamen duygusal olabileceğini söyledi.
Kefeli, iştahının kesilmesini isteyenlerin bulgur
pilavı, süt ve ayran gibi gıdalar tüketmesi gerektiğini söyledi. Uyandıktan saatler sonra yemek
yiyor, ilk yediğiniz besin de şeker içeren veya
saf karbonhidrat olan bir besin oluyorsa dikkatli
olun. İştahınızın bütün suçlusu seçtiğiniz besinlerdir. Şekerli bir çayın yanına 4-5 bisküvi,
meyve suyu, çikolata atıştırıyorsanız, öğle
yemeğinde boş boş makarna veya pirinç pilavı
yiyip kalkıyorsanız akşama doğru veya gece
önünü alamadığınız bir iştah sorunu yaşamanız
muhtemeldir. Beslenme ve Diyet Uzmanı Başak
Kefeli, "İştahınızı azaltmak ve daha uzun süre
tokluk hissini yaşamak için yumurta, tam buğday ekmeği, süt ve ayran, tavuk ve hindi eti, çiğ
sebze salataları, bulgur pilavı, nohut, kuru fasulye, barbunya ve mercimek, leblebi ve badem
tüketin." dedi.
Özel Biyofiz Tıp Merkezi Beslenme ve
Diyet Uzmanı Başak Kefeli, şunları kaydetti:
"Bazı insanlar üzülünce, sevinince, strese girince, canı sıkılınca veya mutlu olunca hep
yemek yemek isterler. Duygularını yiyerek
açığa vurma veya acılarını yiyerek bastırma,
‘duygusal açlık’ olarak tanımlanır. Eğer
sizde bir şeye takıldığınızda veya canınız
sıkıldığında yada herhangi bir duygu
değişiminde yemek yemeğe meylediyorsanız dikkat etmelisiniz. Bu tamamen
koşullanma sonucu hissedilen bir açlık
duygusudur. Yani bu fizyolojik açlık
dediğimiz mideniz boşaldığı için yemek
yemek arzusu değildir. Bu konumdayken yapılacak tek şey telkindir. Bu
durumun duygusal olduğunu, duygu
durumunuzun üstesinden yemeyerek de
gelebileceğinize kendinizi inandırmalısınız. Benim danışanlarıma önerim
kafanızı dağıtmak adına başka bir uğraşı
ile ilgilenmeleridir. (CİHAN)
kayıplarına yol açabileceğini belirten Op. Dr. Astam, şunları ifade
etti: "Şeker hastasının ilk bulguları
sırasında gözde gelip geçici görme
değişiklikleri yaşanabilmektedir. İlerleyen dönemde damar değişiklikleri ve göz dibinde ufak kanamalar
görülmektedir. Tedavinin yeterliliği
hakkında göz muayenesi belirleyici
bir takip kriteridir. Diyabet, gözün
arka bölümünde bulunan ve görme
işleminde çok önemli bir yeri olan
retina tabakasındaki damarlara hasar
vermektedir. Retina tabakasının tutulmasına ‘diyabetik retinopati’ adı
verilir. Retina damarlarında oluşan
hasar, görme merkezinde su toplanmasına yani ödeme yol açarak
yavaş ve ilerleyici bir şekilde
görmeyi azaltmaktadır. Bunun
dışında, göz içersine kanama yaparak ani görme kayıplarına yol
açabilmekte ve erken yaşlarda
katarakt oluşmasına neden olmaktadır. Diyabetli kişiler genellikle
görmeleri azaldığında göz doktoruna muayeneye gitmektedirler.
Ancak, unutulmamalıdır ki gözdeki
hasar başladığında hastaların hiçbir
şikayeti olmayabilir. Bu da, diyabetli kişilerin göz şikayetleri başlamadan göz doktoruna gitmelerinin
ve doktorun tavsiye ettiği sıklıkta
düzenli takip edilmelerinin önemini
göstermektedir. Diyabetik
retinopatiye ait erken bulgular,
görme azalması olmadan aylar
öncesinde ortaya çıktığından dolayı,
modern cihazlarla desteklenmiş
erken retina muayenesi tedavide ilk
adımdır."
Hipertansiyonun göz içindeki
damarlara zarar verdiğini ifade eden
Neslihan Astam, "Göz muayenesi
sırasında, retina incelemesinde göz
dibi damarlarına da bakılmaktadır.
Göz içindeki damarların basınçtan
dolayı uğradığı şekil değişiklikleri,
rahatlıkla bir göz doktoru tarafından
belirlenebilmektedir. Yüksek tansiyonu olan kişilerde retina damarlarında tıkanıklık saptanabilir. Kalp
damarlarının tıkanması gibi gözün
retina tabakasındaki damarlar da
tıkanabilmekte ve damar tıkanıklıkları ciddi görme sorunlarına yol açabilmektedir. Retina damarlarında
oluşan tıkanıklıkta en büyük etken
hipertansiyondur. Yüksek tansiyonlu kişilerde, retinadaki atardamarlarda kalınlaşma ve sertleşme olduğu
için belirli bir süre sonra atardamarlar yakındaki toplardamarlara baskı
uygular ve tıkanıklık gelişebilir."
dedi.
Kan sulandırıcı ilaçların aşırı
kullanımı gözlerde kanamalara sebep olduğunu belirten Op. Dr. Neslihan Astam, "Retina damar tıkanıklığını oluşumunda yaşlanma, sigara
içme, yüksek kan basıncı, şeker
hastalığı, glokom yani göz içi
basınç artışı ve çeşitli kan hastalıkları rol oynamaktadır. Bununla birlikte kalp krizi geçirmiş ya da
damar sertliği olan hastalarda, kan
sulandırıcılar kullanılmaktadır. Bu ilaçlar kanın akışını hızlandırmakla
birlikte, fazla verildiği takdirde
kanamalara neden olabilmektedir.
Cilt altı kanamalarından önce göz
dibindeki retina etkilenmekte ve
kanamaları görülmektedir." diye
konuştu.
Op. Dr. Neslihan Astam,
"Glokom gelişme riski diyabetik
olan hastalarda %35; yalnızca yüksek tansiyon hastalarında %17, hem
diyabetik hem de hipertansiyonu
olan hastalarda %48 daha fazla
görülmektedir. Glokom, dünyada tedavi edilemeyen körlüğün başlıca
nedeni olup, ilerleyene kadar belirti
vermemektedir. Bu nedenle, diyabetik ve hipertansif hastalar dahil,
glokom riski yüksek hastalara
düzenli göz muayenesi yapılmalıdır.
Böylelikle, düzenli olarak taramadan geçirilip takip edilen hastaların glokom riski öngörülebilir."
MS hastalığı ve kan kanserinin
göz muayenesiyle ortaya çıkacakabileceğini belirten Op. Dr. Astam,
"Bir merkezi sinir sistemi hastalığı
olan Multipl Skleroz (MS) aslında
teşhisi bir oldukça zor olan hastalıklardandır. Ancak ilk belirtisini gözde
verebilmektedir. Gelip geçici çift
görmeler ve görme bozuklukları, bu
hastalığın ilk belirtileridir. Lösemi
yani kan kanseri hastalarında kan
hücrelerinde hasar ve kanamaya yatkınlık ortaya çıktığında göz
dibinde retina tabakasında kanamalar oluşabilmektedir. Bazen bu
kanamalar merkezi görme bölgesinde geliştiğinde hastanın ilk
şikayeti görme bozukluğu olabilmektedir. Görme sinirini ve beyin
içinde görme yolları ve görme
merkezini etkileyen tümörler görme
alanı ve göz muayenesiyle tespit
edilebilmektedir." ifadelerini kullandı. (CİHAN)
SAYFA 14
SONDAKiKA GAZETESİ >>
SİYAH MAVİ KIRMIZI SARI
Mayıs2013
2014Perşembe
Perşembe
14 GÜNCEL787ubat
İçiniz rahat olsun
fiyat artışı olmayacak
Hazır giyim ürünlerindeki fiyat artışının döviz kuru ve ithalata getirilen koruma vergileri ile kontrol altına alındığını söyleyen Türkiye Giyim Sanayicileri Derneği Başkanı Cem Negris, "Yeni döviz
kuru ve yeni vergilerle bir denge kuruldu. Bu dengeyi bozacak bir etken görünmüyor" dedi
T
ürkiye Giyim Sanayicileri
Derneği (TGSD) Başkanı
Cem Negris, hazır giyim
ürünlerindeki fiyat artışının döviz
kuru ve ithalata getirilen koruma
vergilerinin sonucu olarak arttığını, gelecek dönemde yeni artışlar
beklenmediğini söyledi. AA muhabirine açıklamalarda bulunan
Negris, nisan ayı enflasyon rakamlarının yüksek çıkmasında etkili olan giyim ürünlerindeki fiyat
artışının bir süredir sektör tarafından dile getirildiğini belirtti. İthalata karşı 2011 Temmuz ayında
getirilen koruma önlemleri kapsamında ithalat vergilerinin yüzde
30'lara çıktığını, hazır giyim markalarının kurun düşük olması nedeniyle buna uyum sağlayabildiğini, fiyatların bu süreçte çok fazla yükselmediğini anlatan Negris,
şöyle konuştu:
"İthal ürünlerin maliyetindeki
artışa karşı markalar zam yapmadan ayakta kalmaya çalıştı. Ancak
kurların artışı ve AVM kiralarının
da buna paralel olarak yükselmesi
kaçınılmaz olarak etiketlere yansımaya başladı. Bunu sektör zaten
bir süredir dile getiriyordu. Ancak
bunun devam edeceğini zannetmiyorum. Çünkü yeni döviz kuruyla yeni vergilerle bir denge kuruldu. Bu dengeyi bozacak bir etken ufukta görünmüyor"
İthalata karşı yerli üretimin
korunması amacıyla alınan önlemlerin işe yaramadığını, verginin artmasına rağmen bitmiş
ürünlerde ithalatta bir gerileme
görülmediğini savunan Negris, bu
önlemlerin tekrar gözden geçirilmesi gerektiğini savundu.
Özellikle Türkiye'de üretimi
bulunmayan polyester ve naylonlu ürünlerde vergilerin eski seviyesine getirilmesi gerektiğini ifade eden Negris, "Pamuklu mallarda da yerli üreticilere maliyetlerini düşürme konusunda süre verilmeli. Koruma önlemi tüm dünyada süreli olarak verilir. O süre
içinde sektör eksiklerini tamamlar
ve önlem kaldırılır. Hayat boyu
koruma önlemi olmaz" dedi.
Önlemlerin getirildiği dönemde yeteri kadar incelenmeden kararlar verildiğini iddia eden Negris, "Şimdi tekstilden anlayan bir
bakanımız var. Bana göre artık ithalata uygulanan korunma vergi-
lerine tekrar bakılması lazım. En
azından bir an önce Türkiye'de
üretimi olmayan ürünlerin ithalatının önündeki engellerin kalkması gerekiyor" dedi.
Negris, enflasyon rakamları
incelendiğinde yerli girdiden ziyade ithalata bağımlı olarak üretilen mont, ceket ve kaban gibi
ürünlerin daha yüksek fiyat artışlara sahip olduğunun görülebileceğine de dikkati çekti.
- Asıl neden kur artışı
Ege Tekstil ve Hammaddeleri
İhracatçıları Birliği Başkanı Sabri
Ünlütürk ise fiyat artışlarında asıl
etkenin "kur artışı" olduğunu, ithalata getirilen verginin etkisinin
sınırlı olduğunu savundu. Son dönemde kur artışıyla birlikte konfeksiyon sektörünün en önemli
girdilerinden olan boyar maddelerin fiyatların 3 kata yakın oranda
artmasının da etkili olduğuna işaret eden Ünlütürk, "Fiyat artışları
artık devam etmez, çünkü kurlar
stabilize oldu. Gelecek 6 ay veya
1 yıllık dönemde herhangi bir fiyat artışı beklemiyoruz" dedi.
(AA)
İ
şletmelerin profesyonel mentor ihtiyacını dikkate alan İzmir ABİGEM (Avrupa Birliği İş Geliştirme Merkezi) büyük bir başarıya imza attı. TÜBİTAK’ın
1601 Programı kapsamında açılan “Özel
Sektör Firmalarının Ar-Ge ve Yenilik
Kapasitesini Artırmaya Yönelik Mentörlük Mekanizması Geliştirilmesi ve Uygulanması” çağrısına başvuran İzmir
İhtiyaçlar dikkate alındı
ABİGEM İzmir Yönetim Kurulu
Başkanı ve Ege Bölgesi Sanayi Odası
Yönetim Kurulu Üyesi Ateş Demirkalkan, mentorEGE Programının ürün, servis ve iş modeli ile uluslararası ölçekte
büyüme potansiyeli taşıyan, ancak ArGe, inovasyon yönetim kapasitesi düşük
KOBİ’ler için uluslararası standartlara
uygun, yerel ve ulusal ihtiyaçlara özgü
sürdürülebilir ve izlenebilir bir mentorluk mekanizması olduğunu belirtti. 2
aşamalı projenin üç ay sürecek ilk aşa-
masında akredite mentorlar ve mentorluk hizmeti alacak 25 KOBİ’nin belirlenerek eşleştirme süreçlerinin tamamlanacağını kaydeden Demirkalkan, “mentorEGE ile İzmir, Egeli firmaların yenilik yeteneklerinin geliştirilmesi ve ülkemiz için yenilik yönetimi adımları için
özgün bir model oluşturulması hedefleniyor” diye konuştu.
Mentör adayları
Demirkalkan, proje tamamlandıktan
sonra da işlerliğini koruyabilecek şekilde tasarladıkları projenin çözüm ortaklarının ise EÜ EBİLTEM Teknoloji Transfer Ofisi, Ege Üniversitesi İktisadi İdari
Bilimler Fakültesi ve Egam Group olduğu bilgisini verdi. Süreç hakkında bilgi
veren Demirkalkan, “Mentorluk hizmeti
verebilme potansiyeline sahip kişiler,
projeye özgü geliştirilen mentorEGE
Mentorlük Eğitim Testi ve mülakatlarla
mentör seçim kriterleri doğrultusunda
belirlenecek. 40 mentor adayı 60 saatlik
eğitim programına alınacak ve mentorluk yetkinlikleri geliştirilecek. Mentorluk hizmetinden yararlanacak firmaların
ise öncelikli olarak daha önce bir Ar-Ge
ve yenilik desteğine başvurmuş ancak
destek almamış olmasını bekliyoruz”
dedi.
100 firmadan 25’i dahil olacak
Demirkalkan, 100 civarında firmanın başvurmasını bekledikleri Programda firmalara özel bir “Yenilik Düzey
Testi” uygulanacağının altını çizdi. Ana
başvuru kriterlerini sağlayan her firmanın yenilik düzeylerini gösteren bir “Yenilik Karnesi” alacağı seçim süreci sonunda seçilecek 25 firmanın Programda
eğitim almış profesyonel mentorlar ile
eşleştireleceğini kaydeden Demirkalkan,
“Program sonunda KOBİ’lerin Ar Ge ve
yenilik kültürlerini sağlam temeller üzerine oturtmuş olmalarını beklediklerini
vurguladı. Demirkalkan, “Birçok paydaş
ile birlikte yürütülecek Program, ekosistemdeki aktörler arasında bir köprü oluşturarak bölgesel kalkınma üzerinde pozitif sonuçlar doğuracak, mentörlük mekanizması, eğitim seti, profesyonel mentorleri ve faydalanıcı firmaları ile bölgenin yenilikçilik ekosisteminin gelişmesine katkıda bulunacaktır” dedi.
(HABER MERKEZİ)
Akpınar’a İMAF ziyareti
Mazlum Vesek
İzmir Mardinliler Federasyonu (İMAF)
Karşıyaka Belediye Başkanı Hüseyin
Mutlu Akpınar’a hayırlı olsun ziyaretinde
bulundu. Akpınar’a görevinde başarılar
dileyen İMAF Genel Başkanı Mehmet
Şakin Irmak ve federasyon yöneticileri,
Akpınar’ın Karşıyaka’ya yakışır bir yönetim sergileyeceğine inandıklarını söyledi. İMAF Genel Başkanı Mehmet Şakin
Irmak ve yönetim kurulu üyelerini ağırlayan Akpınar, Karşıyaka’nın ve İzmir’in
iyi yönetilmesi adına sivil toplum kuruluşlarının desteğine ihtiyaç duyduklarını
kaydetti. Akpınar, ziyaretten duyduğu
memnuniyeti ifade ederek, “Mehmet başkanı ve ekibini yakından tanırım. Federasyon olarak yaptıkları çalışmaları takip
ediyorum. Belediye başkanı seçilmeden
önce de sürekli yan yana geldiğim arkadaşlarımdır. Karşıyaka’daki çalışmaları-
mızda da onların görüşleri bizim için
önemlidir” dedi.
Akpınar, halka dokunan bir yönetim
anlayışının her zaman başarıya ulaştığını
ifade ederek, “Karşıyaka’daki bu kısa sürede sokaktaki insanımızdan esnafımıza
kadar kurduğumuz yakınlığın sonuç aldığını gördük. Halka dokunduğunuzda halk
size sahip çıkıyor. STK’lara yaklaşımımız
da budur. İMAF gibi kurumları bu açıdan
dikkate alıyoruz” diye konuştu.
KARŞIYAKA
ÖRNEK BİR KENT
İMAF Genel
Başkanı Mehmet
Şakin Irmak da, Akpınar’ın Karşıyaka’da örnek bir yönetim sergileyeceğine inandıklarını söy-
leyerek, “Karşıyaka, bugüne kadar zaten
örnek olmuş bir ilçe. Sizin de bu düzeyi
daha da ileri götüreceğinize inanıyoruz.
Mardinliler olarak görevinizde başarılar
diliyoruz. Yolunuz açık olsun” sözlerine
yer verdi. Ziyaret esnasında belediyeyi
ziyaret eden sanatçı Onur Akın da, Mardinlilerin sohbetine dahil oldu. Akpınar,
İMAF ekibi ve Onur Akın’la hatıra fotoğrafı çektirdi.
B
ornova Belediyesi çalışanlarına ‘Vatandaşı karşılama eğitimi’ verilecek. Personelin belediye hizmet
binasının girişinden, müdürlüklere kadar her aşamada
vatandaşa güleryüzlü hizmet vermesini sağlamak için
planlanan eğitim kısa sürede başlayacak. Bornova Belediye Başkanı Olgun Atila, ‘Bornova bizim evimiz’
sloganıyla çıktığı yolda vatandaşların belediyeye geldiklerinde kendilerini evlerindeymiş gibi hissetmeleri
için personele yönelik eğitim çalışması başlatıyor. Vatandaşı karşılama, istek ve sorunlarını çözmek için gerekli yönlendirmelerde bulunma gibi konu başlıklarının yer alacağı eğitimin periyodik aralıklarla yıl boyunca devam etmesi planlanıyor.
Hizmet kalitesini yükseltmenin ilk ve en önemli aşamasının vatandaşı karşılarken gösterilecek sıcak tutum
olduğunu söyleyen Başkan Olgun Atila, “Belediyemize gelen vatandaşlarımızın hepsi bizim için değerli.
Onları güler yüzle karşılamak, kendilerini mutlu ve güvende hissetmelerini sağlamak, sorunlarını çözmek kadar önemli” diye konuştu.
İnsan odaklı belediyecilik anlayışı
Başkan Olgun Atila “İnsanın kendisini en rahat
hissettiği yer evidir. Bornova Belediyesi personeli de
vatandaşlarımızla büyük bir aile oluşturuyor. Belediyemize herhangi bir sorununu çözmek ya da istekte bulunmak için gelen vatandaşımıza güven vermek, rahat
hissetmesini sağlamak dinamik ve güler yüzlü personel yaklaşımıyla mümkün olacak” dedi.
İnsan odaklı belediyecilik anlayışıyla hareket ettiklerini vurgulayan Başkan Olgun Atila şöyle konuştu:
“Amacımız vatandaşlarımızın kaliteli, huzurlu ve mutlu yaşamalarına katkı sağlayacak hizmetler yapmak.
Bunu da güleryüzle yapmak istiyoruz.”
(HABER MERKEZİ)
İşletmelere profesyonel
MENTORLAR geliyor!
ABİGEM’in “mentorEGE Programı”
desteklenmeye uygun bulunan 6 programdan biri oldu. 15 Mayıs’ta başlayacak Program kapsamında belirlenecek
40 mentor adayı 60 saatlik özel bir eğitim sonrası “mentor sertifikası” alacaklar. Programın mentor havuzunda sürekli olarak yer alacak mezun mentorlar yine Program tarafından özel bir süreç ile
belirlenecek 25 KOBİ ile eşleştirilecek.
Eşleşme sonrası işletme ve firma, 9 ay
sürecek “Ar- Ge ve inovasyon kapasitesini artırmaya yönelik özel bir mentorluk mekanizması yürütecek.
Bornova’da güleryüzlü
hizmet dönemi
Çocuklarımız
kanatlarımızın
altında olacak
Kiraz Belediye Başkanı Saliha Şengül, ilçesinin spora
ve sanata da çok yönlü desteklerinin olacağını söyledi.
Türkiye’nin gelecekteki sporcu ve sanatçılarının Kiraz
ilçesinden çıkacağını savunan Şengül, “Belediye Başkanı olarak minik ve genç sporcularımıza aynı zamanda sanata dönük çocuklarımıza gerekli desteği vereceğiz. Bir kolumuz her zaman onların üzerinde olacak ve
geleceğimiz olan çocuklarımızı kanatlarımızın altına
alacağız” dedi. Bu hafta sonu kutlanacak olan ‘Anneler
Günü’ne dikkat çeken Şengül, annelerin bir gün değil
her gün ilgi beklediğini söyledi. Kiraz’ın çiçeği burnunda Belediye Başkanı Saliha Şengül, çalışmalarına
hızlı başladı. Sık sık kadınlarla buluşarak sıkıntı ve taleplerini dinleyen kadın başkan, hemcinsleri ile sohbet
ederken aynı zamanda dinlendiğini belirterek “Annelerimizin isteklerini dinliyorum. Söyledikleri benim için
çok önemli. Her zaman başımızın üstünde yerleri olan
büyüklerimizi, annelerimizi sadece ‘Anneler Günü’nde hatırlamayı doğru bulmuyorum. Her fırsatta ellerini öpmeli ve hayır dualarını almalıyız. Bizden ilgi
bekleyen annelerimizi unutmamalıyız” diye konuştu.
Spora ve sanata tam destek
Kiraz Ortaokulu Spor Salonu’nda düzenlenen
Masa Tenisi Turnuvası’na da katılan genç başkan Saliha Şengül, spora ve sanata yönelik her türlü etkinliğe
ev sahipliği yapacak çok amaçlı salonların sayısının artırılacağını bildirdi. Lig Usulü yapılan turnuvada daha
önce Türkiye 2.’liği olan Fatih Dadaş’a 1.’cilik, Asım
Kaçan 2.’cilik, Murat Dadaş’ada 3.’cülük ödülünü veren Başkan Şengül, tenisçileri başarılarından dolayı
tebrik etti. Başkan Şengül, turnuvaya hakemlik eden
Beden Eğitimi Öğretmenleri Fatih Kuru Şekertekin ve
Süleyman Yaman’a da çiçek vererek desteklerinden
dolayı teşekkür etti. (HABER MERKEZİ)
Yamanlar Koleji Akdeniz’in de incisi oldu
4-5 Mayıs 2014 tarihlerinde
Akdeniz Üniversitesi`nin Antalya’da düzenlediği 19. Ulusal Akdeniz Matematik Olimpiyatında İzmir Özel Yamanlar Koleji, 7 altın, 5 gümüş, 3
bronz toplam 15 madalya kazanarak birinci oldu. Türkiye’nin seçkin okullarının 9,10
ve 11. sınıflarında okuyan öğrencilerin katılımı ile yapılan
olimpiyatta İzmir Özel Yamanlar Fen Lisesi 10. sınıf öğrencisi Ahmet İleri, 100 tam
puan alarak birinci oldu. Ak-
deniz Üniversitesi Hukuk Fakültesi Konferans Salonu'nda
düzenlenen ödül töreninde
madalyalarını Akdeniz Üniversitesi Rektörü Prof. Dr. İsrafil Kurtcephe ve jüri başkanı
Prof. Dr. İlham Aliyev`den
alan Yamanlar Koleji öğrencileri başarılarını büyük bir sevinçle kutladı.
4-6 Mayıs 2014 tarihleri
arasında Bulgaristan’nın Plevne şehrinde düzenlenen 31.
Balkan Matematik Olimpiyatlarında Yamanlar Koleji öğ-
rencileri Osman Akar altın
madalya alırken, Emre Girgin
gümüş madalya kazandı. 6 kişiden oluşan Türk Milli Takımının tek altın madalyasını
Yamanlar Koleji öğrencisi Osman Akar aldı. Yamanlar Eğitim Kurumları Genel Müdürü
Sebahattin Kasap, “Öğrencilerimizin her girdiği ulusal ve
uluslararası yarışmada başarılar kazanması onları geleceğe
hazırlarken bizim çalışma heyecanımızı artıyor.” dedi.
(HABER MERKEZİ)
SAYFA 15
SONDAKiKA GAZETESİ >>
15 SPOR
SİYAH MAVİ KIRMIZI SARI
817
Mayıs
2014
Perşembe
Şubat
2013
Perşembe
Fenerbahçe'nin nöbetçi golcüsü Semih, gittiği Antalya küme düşünce serbest kaldı
Nöbetçi serbest
Spor Toto Süper Lig'in 32. haftasında Elazığspor'a 2-1 yenilince küme düşmesi kesinleşen Medical Park Antalyaspor'da yönetimden sonra golcü Semih Şentürk'te gitti
F
enerbahçe'nin 'nöbetçi
golcüsü', 'Genç Semih'
olarak isim yapan ve Süper Lig'in devre arasında Fenerbahçe'den ayrılarak Medical Park Antalyaspor'a transfer
olan Semih Şentürk, kırmızı
beyazlı takıma veda ediyor.
ntvspor.net'in haberine göre,
sözleşmesindeki maddeden
yararlanacak olan Semih Şentürk'ün, Spor Toto Süper Lig kulüplerinden gelecek teklifleri değerlendireceği belirtildi.
Ara transfer döneminde Fenerbahçe'den alacaklarını silen ve
buna karşılık bonservisini alan
golcü futbolcu, Antalyaspor ile
yaptığı sözleşmeye 'Takım küme
düşerse serbest kalır' şeklinde
Trabzonspor-Galatasaray
maçı Fırat Aydınus'un
Spor Toto Süper Lig'in 33. haftasında oynanacak Trabzonspor ile Galatasaray arasındaki karşılaşmayı hakem Fırat
Aydınus yönetecek.
Süper Lig ikinciliğini yakından ilgilendiren ve 11 Mayıs
pazar günü saat 19.00'da Avni Aker Stadı'nda başlayacak karşılaşmada Aydınus'un yardımcılıklarını Serkan Ok ve Aleks Taşçıoğlu yapacak. (CİHAN)
madde ekletmişti.
Medical Park Antalyaspor'un
geçiğimiz hafta sonu düşmesi kesinleşince, Semih Şentürk'e serbest kalma yolu açıldı. Deneyimli
futbolcu, kırmızı beyazlı formayı
Gençlerbirliği ve Trabzonspor
maçlarında son kez giydikten
sonra boşa çıkacak.
PTT 1. Lig'de forma giymek istemeyen Semih Şentürk, Spor Toto Süper Lig kulüplerinden gelecek teklifleri değerlendirecek.
Semih Şentürk, ligde bu sezon
13 maçta 3 gol, Ziraat Türkiye
Kupası'nda ise 5 maçta 2 gol atmıştı.
ÇAPA'NIN SÖZLEŞMESİ 2015
SONUNA KADAR AMA,
SÖZLEŞMEDE ÖZEL MADDE VAR
Bu arada Medical Park Antalyaspor'un teknik direktörü Fuat
Çapa'nın da aynı maddeden se-
zon sonunda serbest kalacağı
açıklandı.
Görevinden istifa eden ve Olağanüstü Genel Kurul kararı alan
Başkan Gültekin Gencer, yaptığı
açıklamada, "Türkiye Futbol Federasyonu'nun sitesine baktığınızda da göreceksiniz ki Fuat Çapa hocanın 2014-2015 sezonu sonuna kadar sözleşmesi var.
Ancak bu sözleşmede 'Medical
Park Antalyaspor'un küme düşmesi durumuda serbest kalır'
maddesi de var. Onun için Fuat
Çapa hocamız da 2013-2014 sezonu bitiminde serbest kalacaktır." dedi. Buna göre Fuat Çapa
sezonun bitimine 2 hafta kalırken
Medical Park Antalyaspor ile 33.
haftada Gençlerbirliği deplasmanında, 34. ve son haftada ise
Trabzonspor ile oynanacak maçların ardından serbest kalacak.
(HABER MERKEZİ)
Bursaspor'un merhum Başkanı İbrahim Yazıcı, dualarla anıldı
Bursaspor'un geçtiğimiz yıl
vefat eden Başkanı İbrahim
Yazıcı, Emirsultan Mezarlığı'ndaki mezarı başında dualarla anıldı.
Düzenlenen törene, Yazıcı'nın
ağabeyi Hayri Yazıcı, oğlu
Serkan Yazıcı, Bursaspor
İkinci Başkanı Rıdvan Şen,
eski ve yeni yönetim kurulu
üyeleri, Bursaspor Divan Ku-
rulu Başkanı Kadir Şankaya,
teknik direktör İrfan Buz, yeşil-beyazlı futbolcular ve taraftarlar katıldı.
Kabri başında Yasin-i Şerif
okunmasının ardından Hayri
Yazıcı ve Serkan Yazıcı, taziyeleri kabul etti. Anma törenine katılanlara lokma ikram
edildi.
İbrahim Yazıcı'nın oğlu Ser-
kan Yazıcı, "Acımız büyük
söyleyecek bir şey yok. Çok
büyük bir insandı. Allah nur
içinde yatırsın, mekanını cennet eylesin. Müthiş bir uğurlama ile geldi buraya, binlerce insan tekbirlerle getirdi.
Allah yattığı yerde dinlendirsin, bizi de cennetinde kavuştursun inşallah." diye konuştu. (CİHAN)
İZMİR VERGİ DAİRESİ BAŞKANLIĞI ŞİRİNYER VERGİ DAİRESİ MÜDÜRLÜĞÜ
Gazete
Çakır ve ekibinin FIFA Dünya
Kupası hazırlık kampı başladı
F
IFA Dünya Kupası
Brezilya 2014'te ülkemizi temsil edecek FIFA
kokartlı hakemlerimiz
Cüneyt Çakır, Bahattin
Duran ve Tarık Ongun,
FIFA Dünya Kupası'na
Merkez Hakem Kurulu'nun organize ettiği
kampta hazırlanacaklar.
Hazırlık kampında hakemlerin yanı sıra Hollandalı FIFA Dünya Kupası
hakemleri Bjorn Kuipers,
Sander Van Roekel ve Erwin Zeinstra da yer alacak.
UEFA Hakem Kurulu
üyesi ve MHK Eğitim
Danışmanı Jaap Uilen-
berg, MHK Eğitim Direktörü Oğuz Sarvan ve Hakem İşleri Müdürü Burçin
Keskin tarafından hazırlanan kampta UEFA EURO
2008 finalini yöneten Roberto Rosetti, MHK Yardımcı Hakem Eğitim Danışmanı Giovanni Stevanato, Milli Takımlar Analiz Departmanı Sorumlusu Metin Çakıroğlu ve Fiziksel Gelişim Sorumlusu
Ali Kızılet de görev yapacak. Türkiye Futbol Direktörü Fatih Terim de
kampın bir bölümüne katılarak turnuva tecrübelerini paylaşacak.
(CİHAN)
Finalde Çakır da var
Şampiyonlar Ligi'nde iki İspanyol ekibi
Real Madrid ile Atletico Madrid arasında oynanacak final mücadelesini yönetecek hakem dörtlüsü belli oldu. Türk
hakem Cüneyt Çakır, müsabakada 4.
hakem olarak görevlendirildi.
UEFA Hakem Kurulu'ndan yapılan
ve uefa.com'dan duyurulan haberde,
Şampiyonlar Ligi'nde Real Madrid ile
Atletico Madrid arasında Portekiz'de
oynanacak final maçının hakemleri belli oldu.
24 Mayıs Cumartesi günü saat
21.45'te Portekiz'in Lizbon şehrinde
oynanacak karşılaşmayı Hollandalı hakem Björn Kuipers yönetecek. Kuipers'in yardımcılıklarını Sander van
Roekel ile Erwin Zeinstra yapacak. İlave çizgi hakemler isse Pol van Boekel
ile Richard Liesveld olacak.
Türk hakem Cüneyt Çakır ise mücadelede dördüncü hakem olarak görev
alacak. Yedek asistan hakem ise Angelo Boonman olacak. (CİHAN)
ASILMA TARİHİ
İNDİRME TARİHİ
SIRA
NO VERGİ NOSU
MÜKELLEFİN ADI SOYADI
1
2
3
4
Onur Gıda Paz.San.Tic.Ltd.Şti
Kübra YÜCEL
Sektörel Lojistik Paz.Dağ.Tic.Ltd.Şti
Fevzi ÖZER
6430046550
9910220159
4730267195
6880218677
DÖNEMİ
2013
2013
2013
2013
ADRESİ
MİKTARI
90.174.07
5.873.00
47.627.50
5.617.00
TÜRÜ
FİİLİ HACİZ TUTANAĞI
FİİLİ HACİZ TUTANAĞI
FİİLİ HACİZ TUTANAĞI
FİİLİ HACİZ TUTANAĞI
MAHALLE
ADRES
İLÇE
İL
Akıncılar Mah.
Çaldıran Mah
Yenigün Mah
Yıldız Mah
Akdoğan Cad.No:108 BUCA İZMİR
433/11 Sk.No:10/c
BUCA İZMİR
.268 Sk.No:45/B
BUCA İZMİR
Hoca Ahmet Yesevi BUCA İZMİR
Cad.No:42/A
5 4680139682 Serkan IŞIKLAR
2013
18.362.83
FİİLİ HACİZ TUTANAĞI Yıldız Mah
.242/11 Sk.No7/3
BUCA İZMİR
6 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 200711200711 108.215,09 TL KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
7 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 200712200712 135.471,06 TL KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
8 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201008201008 15.229,93 TL KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
9 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201010201010 7.329,07 TL
KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
10 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201011201011 9.827,88 TL
KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
11 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201005201005 9.143,74 TL
KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
12 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201006201006 2.666,12 TL
KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
13 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201007201007 28.082,64 TL KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
14 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201012201012 21.039,94 TL KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
15 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201012201012 78.064,25 TL STP.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
16 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 200801200812 5.258,70 TL
KUR.V.G.FAİZİ.V.ZİY.C YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
17 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 200810200812 3.645,00 TL
GEÇ.V.G.FAİZİ.V.ZİY.C YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
18 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201201201203 10.771,22 TL GEÇ.V.G.FAİZİ.V.ZİY.C YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
19 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201204201206 9.126,37 TL
GEÇ.V.G.FAİZİ.V.ZİY.C YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
20 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201007201009 45.425,41TL
GEÇ.V.G.FAİZİ.V.ZİY.C YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
21 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201010201012 38.919,20 TL GEÇ.V.G.FAİZİ.V.ZİY.C YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
22 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201001201003 27.231,60 TL GEÇ.V.G.FAİZİ.V.ZİY.C YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
23 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201004201006 13.113,74 TL GEÇ.V.G.FAİZİ.V.ZİY.C YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
24 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201003201003 12.622,75 TL KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
25 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201201201201 2.378,35 TL
KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
26 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201002201002 12.133,10 TL KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
27 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201207201207 6.181,35 TL
KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
28 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201205201205 1.937,49 TL
KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
29 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201204201204 6.538,57 TL
KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
30 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 2012022201202 7.610,22 TL
KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
31 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 200901200912 32.446,49 TL KUR.V.G.FAİZİ.V.ZİY.C YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
32 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 200910200912 27.754,53 TL GEÇ.V.G.FAİZİ.V.ZİY.C YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
33 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 200911200911 15.077,52 TL KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
34 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 200910200910 12.242,03 TL KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
35 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201105201105 6.824,76 TL
KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
36 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 200912200912 14.948,41 TL STP.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
37 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201106201106 133.878,39 TL KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
38 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201107201107 100.654,19 TL KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
39 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201108201108 60.318,00 TL KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
40 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201109201109 34.365,44 TL KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
41 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201110201110 4.857,50 TL
KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
42 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201111201111 2.258,75 TL
KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
43 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201112201112 2.022,70 TL
KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
44 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201001201012 128.893,58 TL KUR.V.G.FAİZİ.V.ZİY.C YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
45 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201101201103 32.064,87 TL GEÇ.V.G.FAİZİ.V.ZİY.C YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
46 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201104201106 155.801,36
GEÇ.V.G.FAİZİ.V.ZİY.C YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
47 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201110201112 53.203,15 TL GEÇ.V.G.FAİZİ.V.ZİY.C YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
48 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201104201104 13.207,96 TL KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
49 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201103201103 26.731,10 TL KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
50 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201102201102 5.654,08 TL
KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
51 6300213566 NAZARIM SEY.TUR.TAŞ.VE TİC.LTD.ŞTİ. 201101201101 3.460,13 TL
KDV.G.FAİZİ.V.ZİY.C.
YEŞİLBAĞLAR MAH. 637/19 SOK.NO:123 BUCA İZMİR
"Şirinyer Vergi Dairesi Müdürlüğü’nün yukarıda kayıtlı vergi numaraları ile ad ve soyadları, ünvanları yazılı mükelleflerin isimleri hizalarında gösterilen vergi ve cezalara havi tebliğ
evraklarının bilinen adreslerinde gerek PTT ile gerekse memur eliyle tebliği mümkün olmamıştır. Muhatapların ilan tarihinden başlayarak 1 ay içinde Müdürlüğümüze bizzat veya
vekaletine haiz vekili vasıtasıyla müracaat etmeleri veyahut taahhütlü mektup veya telgrafla açık adreslerini bildirmeleri halinde kendilerine süre ile kayıtlı tebliğ yapılacağı, aksi halde 1
(BİR) ayın sonunda tebliğ yapılmış sayılacağı ilanen tebliğ olunur. "
Sondakika 8/5
Resmi İlanlar: www.ilan.gov.tr’de
Basın: 5335
SAYFA 16
SİYAH MAVİ KIRMIZI SARI
Düğün dernek törenleri salonları doldurdu
Esnafın dört gözle beklediği düğün sezonu açıldı. Beyaz eşyadan mobilyaya, çerezden
gelinliğe, kuyumcudan davetiyeye, düğün salonundan kuaförüne 20'den fazla sektörü
hareketlendirdiği belirtilen evlilik pazarının yıllık bütçesinin 15 milyon lirayı aştığı tahmin
ediliyor. Düğün ekonomisinde aslan payını alan salonlar, ramazan ayı öncesi ve sonrası
yüzde yüz doluluğa ulaştı. İstanbul Toplantı ve Düğün Salonları İşletmecileri Esnaf Odası (İSTDO) Başkanı Ümit Yaşar Demir, AA muhabirine yaptığı açıklamada, "mürüvvetini görme törenleri"nin ekonomiye büyük bir katkı sağladığını söyledi. (AA)
8 Mayıs 2014 Perşembe
www.sondakikagazetesi.com
zmir’e yakışan FUAR
Deniz kenti İzmir, en renkli fuarlardan birine ev sahipliği yapıyor. Birbirinden güzel tekne ve yatların
görücüye çıktığı BOAT İZMİR–2.
Tekne, Yat ve Denizcilik Fuarı’na
dünyanın dört bir yanından 156 firma katılıyor
Açılış töreninde konuşan Deniz Ticaret Odası
İzmir Şubesi Başkanı Yusuf Öztürk, Deniz
Endüstrisi ve Denizciliği Geliştirme Derneği
Başkanı Alparslan Sirkecioğlu ve İzmir Tekne ve
Yat İmalatçıları Derneği Başkan Vekili Fatih
Yağınlı ise sektörün sorunlarından ve beklentilerinden bahsetti. Açılış törenin ardından Başkan
Vekili Aydoğan ve davetliler fuarı gezerek
sergilenen tekne ve yatları inceledi.
Tekne, Yat ve Denizcilik Fuarı’na yurt içinden
çok sayıda firmayla birlikte A.B.D, Almanya,
Avustralya, Avusturya, İngiltere, Çin, Finlandiya,
Fransa, Güney Kore, Hırvatistan, Hollanda,
İsveç, İsviçre, İtalya, Japonya, Meksika, Norveç,
Tayvan, Ukrayna ve Yunanistan’dan 156 firma
katılıyor. Lüks ve pahalı tekne ve yatların yanı
sıra her keseye uygun teknelerin de sergilendiği
BOAT İZMİR Fuarı kapsamında kapsamında İZFAŞ ve İMEAK Deniz Ticaret Odası İzmir Şubesi işbirliği ile DTO Atatürk Kupası Optimist
Takım Yelken Yarışları gerçekleştirilecek. Fuar
süresince organize edilecek panel ve sergiler
BOAT İZMİR’e farklı bir boyut kazandıracak.
(HABER MERKEZİ)
2. Tekne, Yat ve Denizcilik Fuarı,
Kültüpark’taki İzmir Uluslararası Fuar
Alanı’nda düzenlenen törenle başladı.
11 Mayıs Pazar gününe dek sürecek fuar,
15 bin metrekare alanda ve 156 firmanın
katılımıyla organize ediliyor. Bu yıl ikinci kez
düzenlenen fuarın açılış törenine katılan İzmir
Büyükşehir Belediyesi Başkan Vekili Dr. Sırrı
Aydoğan, İzmir’in başlıca özelliğinin bir körfez
kenti kimliği taşıması olduğunu belirterek, “Adı
Latince’de ‘gelin’ anlamındaki Nif Dağı ile
çevrelenen, Victor Hugo’nun prensese benzettiği
İzmir’e ‘Gelinlik Fuarı’ nasıl yakışıyorsa, deniz
ve liman kenti olması nedeniyle bu fuar da o
kadar yakışıyor” diye konuştu.
Aydoğan, denizciliğin Türkiye’de ve dünyada
önü kesilemeyecek 2-3 sektörden biri olduğunu
vurgulayarak, Gaziemir’de yapımı süren yeni
fuar kompleksiyle birlikte çok daha geniş
katılımlı fuarlar düzenlenebileceğini söyledi.
‘Reklam tabelalarını LED ile ışıklandırın
hem tasarruf edin hem çevreyi korun’
İzmir Ticaret Odası (İTO) Reklam Grubu, enerji
tasarrufu ve çevrenin korunmasına destek olmak
için ışıklı reklam panolarındaki florasan ve akkor
lambalar yerine LED aydınlatma konulması için
kampanya başlattı. İTO Reklam Grubu Meclis
Üyesi Filiz Avcı Belet, bu şekilde yüzde 65 tasarruf yapmanın mümkün olduğunu belirtirken, İTO
Yönetim Kurulu Başkanı Ekrem Demirtaş da projeyi desteklediklerini söyledi. Belet, iş hayatının
her alanında yoğun olarak kullanılan ve reklam
sektörünün can damarını oluşturan ışıklı
tabelalarda, ışıklı totemler ile tüm yönlendirmelerde akkor veya florasan lambalar kullanıldığını
belirtti. Sektör olarak bu lambaların yerine LED
aydınlatma sistemlerinin kullanılmasını önerdiklerini ifade eden Belet, “Meslek komitemiz olarak
Yönetim Kurulumuzun da desteği ile birlikte enerji verimliliğinin arttırılması, çevrenin korunması
için Ege Üniversitesi Mühendislik Fakültesi Elektrik Bölümü ile birlikte ’Reklam Panolarının Aydınlatılmasında Enerji Tasarrufu Proje ve Kampanyası’ konulu bir proje başlattık.” dedi.
Aydınlatmada LED kullanımının akkor lambalara
göre yüzde 90, florasan lambalara göre ise yüzde
65 oranında tasarruf sağladığına dikkat çeken
Belet, “Bu proje kampanya ile İzmir’de mevcut
veya yeni yapılacak olan tüm ışıklı tabela, totem
ve yönlendirmelerin aydınlatılmasında LED sisteminin kullanılmasını öneriyoruz.” dedi. Florasan
veya akkor lambadan LED’e geçişin başlangıç
maliyetinin yüksek olarak algılandığını ama
bunun doğru olmadığını kaydeden Belet, şunları
söyledi: “İlk geçişte yüksek gözüken maliyet kısa
sürede sağlanacak tasarruf ile kara dönüşüyor.
Örneğin 5x3 metre ebadında bir ışıklı tabelada 50 adet LED kullanıldığında ve günde 10
saat yandığında LED’li sistem yılda 3285 kw
enerji harcar ki bunun karşılığı 1.182 TL. Aynı
şartlardaki florasanlı bir sistem ise 6 bin 570
kw enerji harcar ve karşılığı 2 bin 365 TL.
Yani tasarruf oranı yüzde 65’e yaklaşıyor”.
LED KULLANIMI
ÇEVREYE DE DOST
Bu kampanya ve proje için Enerji
ve Tabii Kaynaklar Bakanlığı ve
İzmir Büyükşehir Belediyesi’nin
teşviklerinin çok önemli
olduğunu vurgulayan Belet, “LED sistemli
tabelaların tercih edilebilmesi için bu tabelalardan alınan metrekare vergi bedeli düşürülmesi
veya belirli bir süre vergi alınmaması gibi
teşvikler verilebilir”. önerisinde bulundu. LED kullanımı ile birlikte enerji tasarrufu ve düşük
maliyetin yanında karbondioksit salınımının azalacağını, bakım maliyeti düşeceğini ve gelecek
nesillere daha temiz bir dünya bırakılacağını
kaydeden Belet, “Çevreye de dost olan bu
sistem ile İzmir’de bir ilki gerçekleştirmek
ve tüm ülkeye örnek olmak istiyoruz.”
diye konuştu.
‘HER TÜRLÜ ENERJİ
TASARRUFUNA İHTİYACIMIZ VAR’
İTO Başkanı Ekrem Demirtaş da Reklam
Meslek Komitesi’nin başlattığı proje kampanyaya tam destek verdiklerini
söyledi. Işıklı tabelaların,
ticaret yapan her dükkan
için olmazsa olmazlardan
birisi olduğunu belirtti.
(CİHAN)
Çaycılık yaptığı esnaf
odasına başkan seçildi
Burdur’un Yeşilova ilçesinde 17 yıl önce Esnaf ve Sanatkarlar Odası Başkanlığı'nda çaycı olarak işe başlayan Erhan Sönmez,bugün odanın başkanlığını yürütüyor. Sönmez: "Sorunları bilmem ve sıkıntıların çözümünü kendime en büyük hedef
olarak seçmemden dolayı başkan seçildim" dedi
Yeşilova'da 17 yıl önce Esnaf ve
Sanatkarlar Odası Başkanlığı'nda çaycı
olarak işe başlayan 41 yaşındaki Erhan
Sönmez, odanın başkanlığına seçildi.
Sönmez, 1997 yılında Yeşilova Esnaf
ve Sanatkarlar Odası Başkanlığı'nda
çaycı olarak işe başladı. Yedi yıl çaycılık yaptıktan sonra 2004 yılında oda
genel sekreterliğine atanan Sönmez,
2011 yılında açtığı konfeksiyon
dükkanıyla görev yaptığı odaya aynı zamanda esnaf olarak kaydoldu. Sönmez,
21 Mart'ta yapılan seçimlerde de oda
başkanı oldu.
"Teşkilatın mutfağından geldim"
Sönmez, AA muhabirine yaptığı açıklamada, esnafın teveccühü ve verdiği
destekle oda başkanlığını kazandığını
söyledi. İlkokul yıllarında yaz tatillerinde terzide, çaycıda, eczanede, kırtasiyede çıraklık yaparak esnaflıkla
tanıştığını dile getiren Sönmez, "Çaycı
olarak hem gerçek hem de mecazi anlamda esnaf teşkilatının mutfağından
geldim. Yakınen takipçisi olduğum için
esnafımızın sorunlarını biliyorum. Bu
sorunları bilmem ve sıkıntıların
çözümünü kendime en büyük hedef olarak seçmemden dolayı başkan
seçildim" diye konuştu.
"Hiçbir zaman
yüzümüzü kara çıkarmadı"
İlçede 30 yıldır terzilik yapan
Mehmet Öncü de Yeşilova Esnaf ve
Sanatkarlar Odası Başkanlığı'nda bazı
dönemlerde yönetim ve denetim kurulu
üyeliğinde bulunduğunu, Erhan Sönmez'i görev yaptığı dönemde çaycı olarak işe aldıklarını anlattı. Öncü, "Erhan, hiçbir zaman yüzümüzü kara çıkarmadı. Her zaman en güzel şekilde
hizmet etti, tüm esnafı kucakladı. İnşallah bundan sonra başkan olarak yine en
iyi bir şekilde hizmet eder, bir şeyler
kazandırır" dedi.
Esnaf Süleyman Bektaş ise Sönmez’in esnafın yanında ilçe halkına da
hizmet ettiğini dile getirerek, "Herkese
iyi niyet ve alaka gösterdi. Esnaf olarak
memnun olduğumuz için başkan olarak
aramızda görmek istedik. Hiçbir zaman
bizden yardımını esirgemedi" diye
konuştu.
(AA)
"İzmir'deki
150 hekimden
119'u nöbet
görevine gitmedi"
Türk Sağlık Sen 1 No'lu Şube
Başkanı Ahmet Doğruyol, İzmir'deki
150 hekimden 119'unun nöbet
görevine gitmediğini söyledi. Şehir
merkezinde çalışan aile hekimlerinin
Kınık, Kiraz, Çeşme, Dikili, Bayındır ve
Tire gibi ilçelerde görevlendirildiğini
belirten Doğruyol, uygulamadan bir an
önce geri adım atılmasını istedi.
Basmane'deki Türkiye Kamu Sen binasında yapılan basın açıklamasında
konuşan Başkan Doğruyol, "İzmir'de
nöbet saat 16.00'da başlıyor. Şehir
merkezinde görev yapan aile hekiminin
o saatte görev yerinde olabilmesi için
saat 14.00'de yola çıkması gerekecek.
Bu zamanda mevcut hasta hizmet alamayacak. Böyle bir uygulama doğru
değil. Aile hekimlerinin nöbet görevi
verilmesine gerek yok. Zaten bütün
gün çalışan doktor, acillerde verimli olarak görev alamaz. Aile hekimlerinin
nöbet tutmaması hiçbir aksamaya neden olmadı. Daha önce de dediğimiz
gibi, ilimizdeki aile hekimlerine bu noktada ihtiyaç yok." dedi.
KEYFİ UYGULAMA VAR
Aile hekimlerinin bir günde ortalama 100 hastaya baktığını söyleyen
Doğruyol, "Yoğun çalışma temposu
olan hekimlere getirilen gece nöbeti
uygulamasının kabul edilemez
olduğunu belirten Doğruyol, "İzmir'deki bazı hastaneler hiç doktor istemiyor,
bazıları ise sadece hafta sonu doktor
talep ediyor. Aile hekimleri keyfi uygulamalara tabi tutuluyor. Süt iznindeki
aile hekimlerine hafta sonlarında nöbet yazılması yasal değildir. Kiraz Devlet Hastanesi acilinde çalışan bir
hekimin Selçuk Devlet Hastanesi'ne
geçici görevlendirme yapılması, ardından aynı hastane için aile hekimine nöbet yazılması doğru değildir. Sisteme
tanınmadıkları için acillerde verdikleri
hizmeti kendileri adına yapamayacaklar. Ayrıca kendilerinin reçete yazma,
tahlil isteme yetkilerinin olmaması,
yaptıkları işten performans alamamaları, hastane acillerinde triyaj görevi
yapmaları kabul edilemez " şeklinde
konuştu.
(CİHAN)
Download

Önce çaycılık yaptı sonra başkan seçildi