TEZÖZETLERİ
MALATYAİLİNDEKİAİLESAĞLIĞIVETOPLUMSAĞLIĞIMERKEZLERİNDEGÖREVYAPANSAĞLIK
ÇALIŞANLARININİŞDOYUMU,TÜKENMİŞLİKVEANKSİYETEDÜZEYLERİ
JOBSATISFACTION,BURNOUTANDANXIETYLEVELSOFMEDICALSTAFFWORKINGINFAMILYHEALTHCENTERSANDCOMMUNITYHEALTHCENTERSINMALATYA
ÖzlemÇAĞAN
ErciyesÜniversitesiSağlıkBilimleriEnstitüsü
HalkSağlığıAnabilimDalı
DoktoraTezi,Şubat2014
Danışman:Prof.Dr.OsmanGÜNAY
ErciyesUniversity,GraduateSchoolofHealthSciences
DepartmentofPublicHealth
PhDThesis,February2014
Supervisor:Prof.Dr.OsmanGÜNAY
ÖZET
ABSTRACT
Malatya’da Aile Sağ lığ ı Merkezleri’nde (ASM) ve Toplum Sağ lığ ı Merkezleri’nde (TSM) gö rev yapan sağ lık
çalışanlarının işdoyumu, tü kenmişlik veanksiyete dü zeylerininsaptanmasıamaçlanmıştır.
Malatya il merkezi ve ilçelerdeki ASM ve TSM’lerde
gö rev yapan sağ lık çalışanlarının tü mü ne ulaşılması
Ouraimwastodeterminejobsatisfaction,burnoutand
anxietylevelsofmedicalstaffworkinginFamilyHealth
Centers(FHC)andCommunityHealthCenters(PHC)in
Malatya.
Itwasalsoaimedtoreachallthemedicalstaffworking
in FHC and PHCs in theprovince of Malatya and in its
districts. Of 213 physicians, 186 and of 281 midwives
and nurse, 232 were reached. In this study, we used
MinnesotaJobSatisfactionScale,MaslachBurnoutScale
andTrait-StateAnxietyInventory.
Females consist of 66.7% of research group, 87.1% of
them is married and 84.4% had children. Their ages
varied between 21 and 60, and the mean age was
36.6±6.3 years. Of those who attended the research,
44,4%werephysiciansand55.6%weremidwivesand
nurses. Of those working in FHCs, 61.6% and in PHCs
vehemşirenin232’sineulaşılmıştır.Çalışmada,Minne-
Durumluk–
Araştırmagrubunun%66.7’sikadın,%87.1’ievlidir,%
84.4’ü nü nçocuğ uvardır,yaşları21–60arasındadeğ işmekte olup, ortalama yaş 36.6±6.3 yıl bulunmuştur.
Araştırmaya katılanların %44.4’ü hekim, %55.6’sı ebe
ve hemşiredir. ASM çalışanlarının %61.6’sı, TSM çalışanlarınınise%64.0’ıgenelolarakişlerindenmemnun
olduklarını ifade etmişlerdir. ASM çalışanlarının %
46.9’u gelirini, “iyi”, %9.4’ü “kö tü ” olarak algılarken,
TSM’deçalışanların%41.0’ıgelirini“iyi”,%4.0’ı“kö tü ”
olarak algılamaktadırlar. Araştırma grubunun genel,
içselvedışsalişdoyumpuanortancalarısırasıyla3.35,
3.50 ve 3.12; Maslach Kişisel Başarı puan ortancası
23.00,DuygusalTü kenmepuanortancası15.00veDuyarsızlaşmapuanortancası3.00;Durumlukkaygıpuanı
ortancası38.00,Sü reklikaygıpuanıortancasıise42.00
bulunmuştur.
Birincibasamaksağ lıkçalışanlarındaişdoyumu,tü kenmişlik ve kaygı puanları orta dü zeydedir. Çalışanların,
çalıştığ ı birimde gö revlendirilme biçimi, ekonomik durumalgısıveçalıştığ ıbirimdenmemnunolmadurumu;
işdoyumu,tü kenmişlikveanksiyetedü zeylerinietkilemektedir.
Anahtarkelimeler:Birincibasamakçalışanları,anksiyete,iş
doyumu,tü kenmişlik
46.9% of those working in FHCs perceived their salaries as “good” and 9.4% as “poor”, whereas 41.0% of
thoseworkinginPHCs“good”and4.0%“poor”.General
internal and external job satisfaction score medians
were 3.35, 3.50 and 3.12; Maslach Personal Success
score median 23:00, Emotional Burnout Score median
15.00,Desensitizationscoremedian3.00,Stateanxiety
score median38.00, Trait anxiety score median 42.00,
respectively.
In primary health care staff, job satisfaction, burnout
and anxiety scores were moderate. Job satisfaction,
burnoutandanxietylevelsseemtobeaffectedwiththe
assigned manner of the medical staff, their economic
perceptions and their satisfaction with the unit they
workat.
Keywords:Primaryhealthcareworkers,anxiety,jobsatisfaction,burnout
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
29
TEZÖZETLERİ
FARKLIDEZENFEKSİYONYÖNTEMLERİNİNREZİNESASLIKANALDOLGUPATLARININADEZYONUVEYÜZEY
SERTLİĞİÜZERİNEETKİSİ
THEEFFECTOFDIFFERENTDISINFECTIONMETHODSONADHESIONANDSURFACEHARDNESSOFRESIN
BASEDROOTCANALSEALERS
ÖznurTUNCAY
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
DişHekimliğiFakültesi
DişHastalıklarıveTedavisiAnabilimDalı
DoktoraTezi,Mart2014
Danışman:Doç.Dr.ÖzgürER
ErciyesUniversity,GraduateSchoolofHealthSciences
FacultyofDentistry
DepartmentofDentalDiseasesandTreatment
PhDThesis,March2014
Supervisor:Doç.Dr.ÖzgürER
ÖZET
ABSTRACT
ÇalışmanınamacıfarklıdezenfeksiyonsistemlerininAH
PlusveEndoREZkö kkanalpatlarınıninsankö kkanal
dentinine adezyonu ü zerine etkilerinin push-out test
yö ntemi ve sertliğ i ü zerine etkisinin ise Atomic force
microscopy(AFM)kullanılarakdeğ erlendirilmesidir.
Bu amaçla 120 adet tek kö klü insan ü st santral dişin
kö k kanalları temizlenip şekillendirildi. Numuneler
Grup 1(n=30): % 2.5’lik NaOCl, Grup 2(n=30): FotoSan,,Grup3(n=30):OzonveGrup4(n=30):Distilesu
(kontrolgrubu).Gruplardakiö rneklerinyarısıAHPlus/
gü taperka,yarısıiseEndoREZ/rezinkaplıgü taperka
kullanılarak tek kon yö ntemiyle dolduruldu. Her alt
grupta push-out uygulanacak 10 adet dişö rneğ i pushoutbağ lanmadayanımtesti,5adetdişö rneğ iiseAFM
içinkullanıldı.SonuçlarANOVAveTukeypost-hoctestlerikullanılarakistatikselkarşılaştırmayatabitutuldu.
AH Plus en yü ksek bağ lanmadayanımını, NaOCl uygulamasındagö sterirken,endü şü kbağ lanmadayanımını
ise
Ozon
grubunda
gö stermiştir
(NaOCl>Kontrol>FotoSan>Ozon) (p< 0.001). EndoREZ
ise en yü ksek bağ lanma dayanımını NaOCl grubunda
gö sterirken, en dü şü k bağ lanma dayanımını kontrol
grubunda gö stermiştir (NaOCl> FotoSan> Kontrol
>Ozon). Yü zey sertlik değ erlerinde sıralama AH Plus
içinOzon>FotoSan>NaOCl>Kontroliken;EndoREZiçin
Ozon> NaOCl> FotoSan> Kontrol (p< 0.001) şeklinde
olmuştur.
Ozon ve FotoSan'ın NaOCl'ye alternatif dezenfeksiyon
sistemiolarakkullanımı,rezinesaslıpatlarınadezyonu
veyü zey sertlik değ erlerindedeğ işimlere nedenolabilir.
The aim of this study was to investigate the effect of
different disinfection procedures on surface hardness
using Atomic Force Microscopy (AFM) and push-out
bond strength of AH Plus and EndoREZ endodontic
sealerstorootcanaldentin.
One hundred-twenty extracted single-rooted human
maxillary central teeth were preperated. Teeth were
then randomlydividedinto three groups,according to
n = 30): 2.5%
sodium hypochlorite (NaOCl). Group 2 (n = 30): gaseousozone.Group3,controlgroup(n=30):0.9%distillatedwater.Eachgroupwasthendividedintotwosubgroups, according to obturation methods. Subgroup A:
-perchaandAHplus.
Subgroup B: root canals were obturated with EndoREZ/resincoatedcones.Inallsubgroupssamples, n
= 10 was used for push-out tests, n = 5 was used for
surface hardness tests. After obturation, the bond
strength of the test materials was measured using a
push-out test. Atomic force microscopy (AFM) measurementwasperformedtoanalyzesurfacehardnessof
the sealers. Statistics were calculated using one-way
ANOVAandTukeypost-hoctests.
Among the disinfection protocols, the bond strength
Anahtarkelimeler:AFM,dezenfeksiyon,push-out,rezin
esaslıpat,yü zeysertliğ i
Keywords:Disinfection,resinbasedsealers,push-out,atomic
forcemicroscopy,surfacehardness
30
Control > Ozone (p < .001) for AH Plus and NaOCl>
FotoSan> Kontrol >Ozon for EndoREZ. AFM analysis
showedthatthesurfacehardnessvalueswereOzone>
NaOCl > FotoSan> Control for AH Plus; only the sequenceofNaOClandFotoSanchangedforEndoREZ(p
<.001).
disinfection methods to NaOCl may alter the bond
strengthandsurfacehardnessofresin-basedsealers.
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
TEZÖZETLERİ
BEYAZNOKTALEZYONLARININTEDAVİSİNDEUYGULANANFARKLITEDAVİYÖNTEMLERİNİNKLİNİKTAKİBİ
WHITESPOTLESIONSOFDIFFERENTTREATMENTMODALITIESINTHETREATMENTOFCLINICAL
FOLLOW-UP
MuhammedÇAYABATMAZ
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
DişHastalıklarıTedavisiAnabilimDalı
DoktoraTezi,Nisan2014
Danışman:DoçDr.Y.OrçunZORBA
ErciyesUniversity,GraduateSchoolofHealthSciences
DepartmentofRestorativeTreatmentandEndodontics
PhD.ThesisApril2014
Supervisor:Assoc.Prof.Dr.Y.OrçunZORBA
ÖZET
ABSTRACT
Bu çalışmanın amacı mikro invaziv bir yaklaşımla başlangıç çü rü klerini durdurmak için geliştirilen rezin
Theaimofthisstudywastoclinicallyassessboththe
effectiveness of masking white spot enamel lesions
ğ ini değ erlendirmektir. Sabit ortodontik tedavi gö ren
hastaların apareylerinin çıkarılmasından sonra beyaz
noktalezyonutespitedilen43hastanın220beyaznokta lezyonu çalışmaya kaydedildi ve randomize klinik
çalışma için iki gruba ayrıldı. Uygulama grubuna Icon
of white spot enamel lesions. Totally 220 teeth with
white spot lesions detected in 43 patients undergoing
kelenmesindekietkinliğ inivebeyaznoktalezyonlarının
yon tekniğ i uygulandı, kontrol grubuna ise 1450 ppm
mithkline,Newyork)iledişlerinifırçalamasıkonusunda
bilgilendirildi. Mü dahale periyodu 12 hafta sü rdü ve
-D
Biluminator TM (Inspektor Research Systems BV, Amsterdam,Netherland)ilerenkdeğ işimiisespektrefotometre(VITAEasyshadeCompact,VITAZahn-fabrik,Bad
Sä ckingen,Almanya)iledeğ erlendirildi.VerilerMannWhitney U testive Friedmananalizi(FriedmanRepeatedMeasuresAnalysisofVariance)ileincelendi.
sonrasıve klinik takip sonrasıdü zeldiğ i gö rü ldü . Renk
değ işimi kabul edilebilir sınırlarda (∆E< 3.7) bulundu.
Florituygulanangruptaisebeyaznoktalezyonalanlarıedildi,renkanalizindeiserenkdeğ işimikabuledilebilir
demineralizedişlerinestetikgö rü nü mü nü iyileştirmektedir.
developedtoarrestincipientcariesinamicro-invasive
rolled and randomly allocated to a randomized controlledtrialwithtwoparallelgroups.Theintervention
Icon(DMG,Hamburg,Germany)andthesubjectsofthe
controlgroupwasinstructedtobrushteethwith1450
Glaksosmithkline, Newyork). The intervention period
was12weeksandtheendin enamel and color changes, assessed by QLF-D Biluminator TM (Inspektor Research Systems BV, Amsterdam, Netherland) and spectrophotometer (VITA
Easyshade Compact, VITA Zahn-fabrik, Bad Sä ckingen,
Germany).ThedatawereanalyzedwithMann-Whitney
U test and Friedman (Friedman Repeated Measures
AnalysisofVariance)analyze.
Fluorescence loss in enamel of white spot lesions was
improved both after immediately intervention and 12
Icon. Color shifts were found in the acceptable limits
(∆E< 3.7). Fluorescence loss in enamel of white spot
lesionswasimprovedbothafterimmediatelyintervenspot lesions was improved in the control group with
improves the esthetic appearance of demineralized
teeth.
Anahtar kelimeler:
şım
Key words: White spot lesions, quantitative light induced
siveconcept
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
31
TEZÖZETLERİ
ÜÇFARKLINİTİKÖKKANALŞEKİLLENDİRMESİSTEMİNİNKÖKKANALIANATOMİSİÜZERİNEETKİSİNİN
MİKRO-BİLGİSAYARLITOMOGRAFİİLEDEĞERLENDİRİLMESİ
THEMICRO-CTEVALUATIONOFTHEEFFECTSOFTHREEDIFFERENTNITIROOTCANALSHAPINGSYSTEM
ONROOTCANALANATOMY
BanuUYSAL
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
DoktoraTezi,Nisan2014
Danışman:Doç.Dr.BurakSAĞSEN
ErciyesUniversity,GraduateSchoolofHealthSciences
PhDThesis,April2014
Supervisor:Assoc.Prof.Dr.BurakSAĞSEN
ÖZET
ABSTRACT
Bu çalışmanın amacı, respirokasyon(Resiproc; VDW,
Mü nih, Almanya) ve rotasyon[(ProTaper; Dentsply
-Mega,
BesanconCedex,Fransa)]hareketiileçalışansistemlerin şekillendirme yeteneklerinin ve kanallarda transportasyon oluşturma potansiyelinin mikro bilgisayarlı
-BT)ilekarşılaştırılarakdeğ erlendirilmesidir.
Bu amaçla yeni çekilmiş 60 adet mandibular birinci
Theaimofthisstudywastocomparetheshapingabilities and canal transportation of three different rotary
systems working with reciprocal (Resiproc; VDW, Mü nih, Germany) and rotation movement systems
[(ProTaper; Dentsply Maillefer, Ballaigues, Switzerland), (OneShape; Micro-Mega, Besancon Cedex, France)],usingmicrocomputedtomography(Micro-CT).
Sixtymesialrootcanalsoffreshlyextractedmandibular
le ü ç gruba ayrıldıktan sonra şekillendirme ö ncesi ve
sonrasıtü mö rneklerinmikro-BTtaramasıyapıldı.Elde
edilen gö rü ntü ler ü zerinde alan ve hacim değ işimleri,
transportasyon ve merkezde kalma oranı ü ç boyutlu
modelleme ile değ erlendirildi. Elde edilen verilerin
gruplararasıkarşılaştırmasındatekyö nlü varyansanaliziveçoklukarşılaştırmalariçinTukeyHSDtestikullanıldı. P<0,05 değ eri istatistiksel anlamlılık dü zeyi olarakkullanıldı.
Elde edilen bulgulara gö re farklı seviyelerdeki transportasyon değ erleri ve farklı bö lgelerdeki transportasyonmiktarlarınıngruplararasındakikarşılaştırılmasındaistatistikselolarakanlamlıfarklılıktespitedilmemiştir.Farklıseviyelerdekimerkezdekonumlanmaoranlarıaçısındangruplararasındaistatistikselolarakanlamlıfarklılıktespitedilmemiştir.Farklıseviyelerdekialan
değ işimlerinin karşılaştırılmasında her ü ç eğ e sistemi
için 3, 4, 5 ve 6 mm’de gruplar arasında sırasıyla
P=0,001;P<0,001; P=0,001veP=0,015dü zeyindeistatistiksel olarak anlamlı fark meydana gelmiştir. Farklı
seviyelerdeki hacim değ işimlerinin her ü ç eğ e sistemi
için 6 mm seviyesinde alınan kesitler hariç (P=0.141)
diğ ertü mseviyelerdeistatistikselolarakanlamlıfarklılıkgö sterdiğ ibulunmuştur.Enbü yü kfarklılıkOneShape
veReciprocsistemleriarasındameydanagelmiştir.
Sonuç olarak, çalışmamızda kullandığ ımız sistemlerin
hepsi kabul edilebilir dü zeyde transportasyon oluşumuna sebep olmuştur. Sistemlerin hepsi merkezi konumlanmayı tam olarak gerçekleştirmeyip bir miktar
sapma gö stermiştir. Bu durum transportasyon oluşumunda etkili olmaktadır. Kullanılan sistemlerin şekillendirme ö ncesive sonrası meydana gelen alan ve hacim değ işikliklerinin istatistiksel olarak anlamlı farklılıkgö sterdiğ ibelirlenmiştir.
Anahtar kelimeler: Mikro-BT, transportasyon, resiprokasyon,dö neraletler,tekeğ e
32
randomlydividedintothreegroupsandscannedbefore
andafterpreperationwithMicro-CT.Regionalandvolumechanges,transportationandcenteringratiowere
assessedbyusing3DreconstructionsonMicro-CTimages.One-wayanalysisofvarianceandTukeyHSDtests
were used for inter- group and multi-group comparisonsoftheobtaineddata,respectively.StatisticalsigniP<0.05.
Accordingtotheresultsobtained,nostatisticallysigni-
atdifferentlevelsandatdifferentareas,ininter-group
comparison. In regards to centering ratio at different
in interchangesoccuredat3,4,5and6mmforallthreeinstrumentationsystemsinthecomparisonofregionalchanges at different levels, in P=0.001; P<0.001; P=0.001
andP
all levels except 6 mm (P=0.141) for all three instrumentationsystems.Themajordifferencewasobserved
betweenOneShapeandResiprocsystems.
In conclusion, all systems used in the present study
caused the formation of transportation in acceptable
levels. All systems showed deviation due to not properly centering in canals. This condition is effective in
theformationoftransportation.Allsystemswerefound
after instrumentation in regional and volumetric measurements.
Keywords:Micro-CT,transportation,reciprocation
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
TEZÖZETLERİ
HALKDANSÇILARININGÖRSELALGILAMAVEUZAYSALBEKLENTİDÜZEYLERİNİNİNCELENMESİ
ANALYZINGTHEFOLKDANCERS’LEVELSOFVISUALPERCEPTIONANDSPATIALANTICIPATION
MustafaKAYA
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
BedenEğitimiveSporAnabilimDalı
DoktoraTezi,Mart2014
Danışman:DoçDr,AlpaslanYILMAZ
ErciyesUniversity,GraduateSchoolofHealthSciences
DepartmentofPhysicalEducationandSport
PhDThesis,March2014
Supervisor:DoçDr,AlpaslanYILMAZ
ÖZET
ABSTRACT
Bu çalışmanın amacı; 16 hafta sü re ile dü zenli yapılan
halkdanslarıçalışmalarınındahaö ncehiçhalkdansları
çalışması yapmamış deney ve kontrol grupları ile profesyonel halk dansçılarında gö rsel-mekansal algılama
veuzaysalbeklentidü zeylerineetkisiniincelemektir.
Araştırmaya daha ö nce halk oyunları ile hiç ilgilenmemiş60kadın,60erkekgö nü llü ileDevletKonservatuarı
Tü rkHalkOyunlarıBö lü mü ndeokuyan30kadınve30
erkek olmak ü zere toplam 180 ü niversite ö ğ rencisi
katılmıştır.Araştırmadadeneygrubuna16haftasü ren
halkoyunlarıantrenmanıyapılmıştır.Kontrolgrubuna
ise herhangi bir antrenman yaptırılmamıştır. Deney,
kontrol ve dansçı gruplarına antrenmanların başlamasındaitibarenbirinci,sekizinciveonaltıncıhaftalarda
BrixtonMekansalBeklentitestiuygulanmıştır.
Araştırmada geçerliliğ i daha ö nceden yapılmış olan
“Brixton Mekansal Beklenti Testi” kullanılmıştır. Elde
edilen verilerin istatistiki analizi hesaplamalar hazır
istatistikyazılımıileyapılarak,(IBMSPSSStatistics19,
SPSSinc.,anIBMCo.,Somers,NY)ö nemseviyesiolarak
0.05ve0.01alınmıştır.
Araştırmada,deneyvekontrolgruplarıarasındaparalel
sonuçlareldeedilirmiştir.Fakatprofesyonelhalkdansçılarınınhataortalamalarıdeneyvekontrolgruplarına
gö redahadü şü kolduğ ubulunmuştur.(p<0.05)Cinsiyetler açısından ise kadın grupları ile erkek grupları
arasındaanlamlıfarkbulunmamıştır.
Sonuç olarak; Yapılan halk oyunları antrenmanlarının
zihinselboyutlarının,halkdansçılarınınmekansalalgılama ve uzaysal beklenti dü zeylerine etki edebileceğ i
dü şü nü lmektedir. Bu etkinin var sayıla bilmesi için
uzun sü reli olarak halk dansları antrenmanlarının yapılmasıgereklidir.Ayrıcayapılanhalkoyunlarıantrenmanlarının mekansal algılama ve uzaysal tahmin dü zeylerindecinsiyetleraçısındanaynıderecedeetkiettiğ iyanikadınveerkekdansçılararasındafarkolmadığ ı
sonucunavarılmıştır.
The purpose of this study was to analyze the effect of
16-weekfolkdancingtraininguponthespatialperceptionandspatialanticipationlevelsinsedentary,andto
compareprofessionalfolkdancers’levelofspatialperceptionandspatialanticipation.
Totally 180 university students including 60 female
and60 male volunteers who have not beeninterested
infolkdancingbefore,and30femaleand30malestudents studying at State Conservatory Turkish Folk
Dances Department were included into the study. No
trainings were practiced with the control group. BrixtonSpatialAnticipationTestwasperformedtoexperi-
Anahtar kelimeler: Tü rk Halk Oyunları, mekansal algılama,
brixtontest
Keywords:TurkishFolkDances,spatialperception,brixton
test
andsixteenthweeksasofthetrainingsstarted.
“Brixton Spatial Anticipation Test” that was predeterminedintermsofitsvaliditywasusedintheresearch. The statistical analysis calculations of the obtained data were carried out with statistical software
(IBM SPSS Statistics 19, SPSS inc., an IBM Co., Somers,
and0.01.
Intheresearch,parallelresultswereobtainedbetween
the experimental and control groups. However, error
averagesofprofessionalfolkdancersweredetermined
tobelowerthantheaveragesofexperimentalandcondifference was found between the female groups and
malegroups.
Consequently, metal dimensions of the practiced folk
dance trainings were considered to have effect upon
the spatial perception and spatial anticipations of folk
dancers.Inordertoassumethiseffect,itisnecessaryto
practicefolkdancetrainingsforalongtime.Moreover,
itwasalsoconcludedthatfolkdancetrainingsaffected
the spatial perception and spatial anticipation levels
had equal effects in terms of gender, and therefore
andmaledancers.
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
33
TEZÖZETLERİ
KARMADİŞLENMEDESÜRMEMİŞPOSTERİORDİŞLERİNBOYUTTAHMİNİNDEKULLANILANÜÇFARKLI
YÖNTEMİÇİNTÜRKNORMLARININBELİRLENMESİ
DETERMINATIONOFTURKISHNORMSFORTHREEMETHODSUSEDFORPREDICTIONOFSIZEOFUNERUPTEDPOSTERIORTEETHINMIXEDDENTITION
GülşahYAĞAN
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
OrtodontiAnabilimDalı
DoktoraTezi,Mart2014
Danışman:Doç.Dr.SabriİlhanRAMOĞLU
ErciyesUniversity,GraduateSchoolofHealthSciences
DepartmentofOrtodontics
PhDThesis,March2014
Supervisor:Doç.Dr.SabriİlhanRAMOĞLU
ÖZET
ABSTRACT
Çalışmamızda farklı etnik topluluklardan elde edilmiş
karmadentisyonyeranalizleriolanTanakaveJohston
denklemlerinin ve Tü rk popü lasyonundan Arslan ve
ark.’nın elde ettiğ i regresyon denklemlerinin Tü rk po-
One of the most widely used mixed dentition space
analysis method Tanaka-Johnston equtions and equations that developed for Turkish population by Arslan
et al are tested in the dental cast archieve of Erciyes
University,DepartmentofOrthodontics.Alldentalcasts
are digitized and meziodistal tooth measurements are
performedonbothdigitalandstonemodels.Alsodentalcastanddigitalmodelmeasurementsarecompared.
Hekimliğ iFakü ltesiOrtodontiBö lü mü arşivindekidahil
olmakriterlerinisağ layanhastamodellerinintaranmasıyla, elde edilen dijital modeller ü zerinde yapılan ö lçü mlerilegenişbirhastagrubundatestedilmiştir.Ayrıca aynıö lçü mler alçı modellerdede gerçekleştirilmiş
olup,alçımodelvedijitalmodelö lçü mlerikarşılaştırılmıştır.
Dijital ve alçı model ö lçü mlerinin karşılaştırılmasında
literatü rle uyumlu olarak klinik ö nemi yok denecek
kadar kü çü k (ortalama 0,07mm) ancak istatistiksel
olarak anlamlı, dijital ö lçü mlerin daha kü çü k olduğ u
saptanmıştır. Tanaka-Johnston denklemi bizim ö rnek
grubumuzdadişboyutlarınıistatistikselolarakanlamlı
olacak derecede bü yü k olduğ u tahmin etmiştir. Arslan
ve arkadaşlarının denklemi ö rnek grubumuzda gerçek
değ erlerin altında tahminde bulunmuştur ve bu farklılık istatistiksel olarak ileri derecede anlamlı çıkmıştır.
Dolayısıyla ö rnek grubumuz kullanılarak yeni regresyondenklemlerigeliştirilmiştir.GeliştirilenyeniregresyondenklemleriileTü rktoplumuiçinMoyerstablosununbenzeritablolaroluşturulmuştur.
Anahtarkelimeler:Karmadentisyon,dijitalmodel,yeranalizi,dişboyututahmini,Tü rkpopü lâ syonu
34
thanthestonecastmodelmeasurements,butthediffe-
naka-Johnston equations predicted the posterior me-
values. In contrast Arslan et al’s equations predicted
widths. All of the tested methods were not reliable in
this study group. Therefore new regression equations
forTurkishpopulationaredeveloped.Byusingthenew
regressionequations,alsotableswhicharesimilarwith
theMoyers’spredictiontablesarecreatedtomakethe
spaceanalysiseasier.
Keywords:Mixeddentition,digitalmodel,spaceanalysis,
toothsizeprediction,Turkishpopulation
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
TEZÖZETLERİ
ÇOCUKLARDASINUSMAXILLARIS’İNYAŞABAĞLIOLARAKGELİŞİMİ
THEAGE-RELATEDDEVELOPMENTOFSINUSMAXILLARISINCHILDREN
MuhammetDEĞERMENCİ
ErciyesÜniversitesiSağlıkBilimleriEnstitüsü
AnatomiAnabilimDalı
YüksekLisansTezi,Nisan2014
Danışman:Doç.Dr.TolgaERTEKİN
ErciyesUniversity,GraduateSchoolofHealthScience
DepartmentofAnatomy
MSc.Thesis,April2014
Supervisor:AssociateProfessorDr.TolgaERTEKİN
ÖZET
ABSTRACT
Paranazal sinuslar, cavitas nasi ile bağ lantılı olan kemiklerin içinde yer alan ve hava içeren boşluklardır.
Paranazal sinusların gelişimive havalanması hakkında
daha fazla bilginin elde edilmesi sinus hastalıklarının
değ erlendirilmesi ve daha iyi tedavilerin ö nerilmesi
içinö nemlidir.BuçalışmadaparanazalsinusBTgö rü ntü leri ü zerinde, stereolojik metotla ve morfometrik
veriler kullanılarak eliptik formü lle sinus maxillaris
hacim hesaplaması yapıldı. Çalışmanın amacı ise sinus
maxillaris’inyaşabağ lıolarakgelişiminiortayakoymak
ve metotlar arasındaki farklılıkları tespit etmektir. Bu
Paranasalsinusesareairedwithinthebonesandconnectedtonasalcavity.Obtaining more data on growth of paranasal sinuses and
pneumatizationofsinusesisimportantinordertoevaluate sinus related illnesses and provide much better
treatments.Inthisstudy,thevolumeofmaxillarysinuses was calculated on sinus BT images by stereological
method andelliptic formula using morphometric data.
The aim of this study is to reveal both the age-related
development of maxillary sinus and the differences
between methods applied. In this study, axial, coronal
andsagittalBTimagesof361individuals(180females,
181males)wereselectedfromPACSsystemofErciyes
University Faculty of Medicine. Stereological volume
calculationsonBTimagesofmaxillarysinuswereperformed on the basis of Cavalieri principle and elliptic
volumecalculationswereperformedbyusingmorphometricdata.Whetherthereisadifferencebetweenthe
two methods were determined by comparing the volumedatathatwereobtainedbytwodifferentmethods.
Themeanvolumeofmaxillarysinuswascalculatedas
7.99±4.92cm3forrightsideand8.15±4.99cm3forthe
left side by using stereological method while bilateral
mean volumes of maxillary sinus were calculated as
7.95±4.90cm3and8.28±5.15cm3forrightandleftside
respectivelywithellipticformula.Whenthemeanbilateral volume results calculated by both methods were
minden alınan 361 bireyin aksiyal, koronal ve sagittal
BT gö rü ntü leri (180 kız, 181 erkek) kullanıldı. Sinus
maxillaris’in BT gö rü ntü leri ü zerinde Cavalieri prensibi’ne dayanarak stereolojik hacim ö lçü mleri ve morfometrikverilerileeliptikhacimhesaplamasıyapıldı.Her
ikimetotlaeldeedilenhacimdeğ erlerikarşılaştırılarak
aralarındaistatistikselbirfarkınolupolmadığ ıbelirlendi. Çalışmamızda ortalama sinus maxillaris hacmi tü m
bireylerelealındığ ında8.11±5.02cm3olarakhesaplandı.Stereolojikmetotlaortalamasinusmaxillarishacmi
sağ da 7.96±4.92 cm3, solda ise 8.15±4.99 cm3 olarak
hesaplanırken,eliptikformü llesağ vesolsinusmaxillaris ortalama hacmi sırasıyla 7.95±4.90 cm3 ve
8.28±5.15 cm3 olarak belirlendi. Ortalama bilateral
hacimö lçü mleribirbirleriilekarşılaştırıldığ ındaheriki
metot içinde sonuçlar arasında istatistiksel olarak anlamlı bir fark belirlendi (p<0.05). Her iki metotla elde
edilen hacim değ erleri birbirleriyle karşılaştırıldığ ında
metotlar arasında sağ sinus maxillaris için istatistiksel
olarakanlamlıbirfarkbelirlenmezkensolsinusmaxillaris için istatistiksel olarak anlamlı bir fark belirlendi
(p<0.05). Bu sonuçlar istatistiksel farkın anlamlı olduğ unufakateldeedilenverilerarasındayü ksekderecede
pozitif yö nde bir korelasyonolmasındandolayı sonuçların birbirleri ile uyumlu olduğ unu gö stermektedir. 3
farklı planda stereolojik metotla belirlenen hacim değ erleri birbirleriyle karşılaştırıldığ ında istatistiksel
olarakanlamlıbirfarkbelirlenmedi.
Sonuç olarak, çalışmamızın sinus maxillaris hakkında
yapılacak olan diğ er araştırmalarla katkı sağ layacağ ını
dü şü nmekteyiz.
Anahtarkelimeler:Paranazalsinus,CavalieriPrensibi,sinus
maxillaris,stereoloji,eliptik
mined between right and left maxillary sinus volumes
(p<0.05). When maxillary sinus volumes’ results obtained by using both methods were compared, no staillarysinusesbetweentwomethodswhereasastatisti-
illarysinuses.Theseresultsshowedthatthestatistical
correlationamongdata,theresultswerecompatiblefor
eachother.Whentheresultswhichwerecalculatedby
stereologicalmethodinthreedifferentplanswerecommined.
As a result, we think that the results of this study will
behelpfulforotherstudiesaboutmaxillarysinuses.
Key words: Paranazal sinus, Cavalieri Principle, maxillary
sinus,stereology,elliptic
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
35
TEZÖZETLERİ
BUZAĞILARDALİTYUMUMCANLIPERFORMANSVEBAZIKANPARAMETRELERİNEETKİSİ
THEEFFECTSOFLITHIUMONLIVEPERFORMANCEANDSOMEBLOODPARAMETERSINCALVES
İbrahimONURSOY
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
HayvanBeslemeveBeslenmeHastalıkları
AnabilimDalı
YüksekLisansTezi,Nisan2014
Danışman:Prof.Dr.OsmanKÜÇÜK
ErciyesUniversity,GraduateSchoolofHealthSciences
AnimalNutritionandNutritionalDiseasesDepartment
MSc.Thesis,April2014
Supervisor:Prof.Dr.OsmanKÜÇÜK
ABSTRACT
ÖZET
Buçalışmanınamacı,buzağ ımamasıilebeslenenbuzağ ıların mamalarına ilave edilen lityumun buzağ ıların
canlı performanslarına ve kimi kan parametrelerine
nasıl etki ettiğ inin araştırılmasıdır. Kırk adet 1 gü nlü k
yaşta,Holsteinırkıbuzağ ılar4gü nlü kyaştan10haftalıkyaşakadar(sü ttenkesim)eşitsayıda2grubaayrılmış ve bir gruptaki buzağ ı mamalarına bir şey ilave
edilmeziken(kontrol)diğ ergruptakibuzağ ılarıniçtiklerimamalaragü nlü k42mgLi/mlçö zeltiden1mlilave
edilmiştir. Mamaya ilave edilen Li, canlı ağ ırlık (P ≥
0,30),cidagoyü kseklikleri(P≥0,15)vegö ğ ü sö lçü lerini(P≥0,50)etkilememiştir.Lityumiçerenbuzağ ımamasıtü ketenbuzağ ılardaplazmaCa(P=0,04)veMg(P
=0,08)değ erlerikontrolgrubunaoranladü şü kbulunmuştur. Ancak, mamalarda lityumun varlığ ı plazma P
dü zeyinietkilememiştir (P = 0,89).Plazma K, Nave Cl
konsantrasyonları lityumlu mama tü keten buzağ ılarda
ö nemli derecede dü şü k bulunmuştur (P≥ 0,0001). Lityum ilave edilen mama tü keten buzağ ılarda plazma Li
konsantrasyonu yü ksek dü zeyde bulunmuş (0,22 ye
karşı 0,29 ppm) ancak bu değ erler ö nemli dü zeyde
olmamıştır(P=0,42).Lityumilaveedilenmamatü ketenbuzağ ılardaplazmaNikonsantrasyonuyü ksek(P=
0,02)ancakCrdü zeyidü şü k(P=0,03)dü zeydebulunmuştur. Mamalarda lityum varlığ ı buzağ ı gruplarında
plazma Al, Mn, Fe, Cu, Zn ve Co konsantrasyonlarını,
glikoz, trigliserit, kolesterol, total protein konsantrasyonlarınıveALTenzimaktivitesinietkilememiştir(P≥
0,40). Plazma Se konsantrasyonu mama ile birlikte
lityum tü keten buzağ ılarda dü şü k dü zeyde (P = 0,03)
bulunmuştur.Çalışmasonuçlarınagö rebuzağ ımamalarına lityum katılmasının canlı performansa pozitif bir
etkisiyoktur.
Theobjectiveofthisstudywastoinvestigatetheeffects
of lithium (Li) added to milk replacer on calf live performanceandsomebloodparameters.Atotalof403day-oldcalvesweredividedinto2equalgroupsreceivingeitheronlyamilkreplacerormilkreplacerwith42
mgLi/head/day(1mlofsolutionof42mg/mlLi)until
weaned (10 weeks). Lithium in milk replacer did not
causeanychangesinliveweights(P≥0.30),heartgirth
(P≥0.50)orwithersheight(P≥0.15).CalvesconsumingmilkreplacersupplementedwithLihadlowerplasmaCa(P=0.04)andMg(P=0.08)concentrationsbut
similarplasmaconcentrationsofP(P=0.89).Presence
ofLiinmilkreplacersresultedinalowerplasmaK,Na,
and Cl concentrations (P ≥ 0.0001). Calves consuming
milk replacer had a greater plasma Li concentrations
(0.22 vs. 0.29 ppm
P =
0.42). Plasma Ni concentrations increased (P = 0.02)
whileplasmaCrconcentrationsdecreased(P=0.03)in
calves drank milk replacer with supplemented Li. The
presenceofLiinmilkreplacersdidnothaveanychangesinplasmaconcentrationsofAl,Mn,Fe,Cu,ZnandCo
as well as glucose, triglyceride, total protein, and ALT
enzymeactivities(P≥0.40).PlasmaSeconcentrations
decreased with Li supplementations in calves (P =
0.03). The results of the present work revealed that
lithium addition to the milk replacers in calves has no
positiveeffectsonliveperformance.
Anahtarkelimeler:Lityum,buzağ ı,performans,buzağ ı
maması
Keywords:Lithium,calf,performance,milkreplacer
36
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
TEZÖZETLERİ
KAYSERİİLİNDETÜKETİMESUNULANTAVUKETLERİNDESTAPHYLOCOCCUSAUREUSENTEROTOKSİN
VARLIĞININARAŞTIRILMASI
DETECTIONOFSTAPHYLOCOCCUSAUREUSENTEROTOXINSFROMPOULTRYMEATSCONSUMEDINKAYSERI
HüseyinKAYA
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
VeterinerBesinHijyeniveTeknolojisiAnabilimDalı
YüksekLisans,Nisan,2014
Danışman:Doç.Dr.NurhanERTAŞ
ErciyesUniversity,GraduateSchoolofHealthSciences
DepartmentofVeterinaryFoodHygieneandTechnology
MSc.Thesis,April,2014
Supervisor:Assoc.Prof.Dr.NurhanERTAŞ
ÖZET
ABSTRACT
Bu çalışmanın amacı Kayseri ilinde satışa sunulan tavuk etlerinde Staphylococcus aureus (S. aureus) ve
enterotoksinlerinin varlığ ını incelemekti. Çalışmada
toplam 100 adet tavuk karkas ö rneğ i materyal olarak
kullanıldı. Çalışmada incelenen 100 tavuk karkasının
30’unun(%30)S.aureusilekontamineolduğ uvekontaminasyon dü zeyinin 2x101 kob/g ile 1x108 kob/g
arasında olduğ u belirlendi. S. aureus ile kontamine tavuketiö rneğ inden3’ü nü n(%10)Tü rkGıdaKodeksiEt
Theaimofthisstudywastodeterminethepresenceof
Staphylococcusaureus (S.aureus)anditsenterotoxins
from the poultry meat consumed in Kayseri. Total of
100chickencarcasswereusedasamaterial.Thirtyout
of 100 chicken carcass sampled (30%), found to be
contaminated with S. aureus with the contamination
level ranging from 2x101 kob/g to 1x108 kob/g. Three
of the contaminated poultry meat samples (10%), foundtobecontaminatedwiththispathogenatthelevels
exceeding the microbiological limits laid down in TurkishFoodCodexregardingmeatandmeatproducts.In
this study, none of the staphylococcal enterıotoxins
did not found from S. aureus isolates were obtained
from chicken carcasses with ELISA. As a consequence,
thepresenceofS.aureuswereeffectiveinchickencarcassesretailedinKayseriandvicinityanditwasconcludedthatshouldnotbeignoredforpublichealth.
ü zerinde olduğ u tespit edildi. Çalışmada, incelenen
tavukkarkasıö rneklerindeneldeedilenS.aureuskolonilerine uygulanan ELISA testi sonucunda izolatların
Buçalışmadaeldeedilenverileregö re,Kayseri’desatışasunulantavukkarkasetindeS.aureuskontaminasyonu olabileceğ i ve bu durumun halk sağ lığ ı açısından
gö zardıedilmemesigerekenbirtehlikeolduğ usonucunavarıldı.
Anahtarkelimeler: Enterotoksin, Kayseri, S. aureus, tavuk
eti
Keywords:Enterotoksin,Kayseri,S.aureus,tavuketi
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
37
TEZÖZETLERİ
PSİKODRAMATEMELLİPSİKOLOJİKGÜÇLENDİRMEPROGRAMININONKOLOJİHEMŞİRELERİNİNGÜÇLENME
ALGILARIVETÜKENMİŞLİKDÜZEYLERİÜZERİNEETKİSİ
THEEFFECTOFAPSYCHOLOGICALEMPOWERMENTPROGRAMME,BASEDONPSYCHODRAMA,ONEMPOWERMENTPERCEPTIONANDBURNOUTLEVELSINONCOLOYNURSES
AzizeATLIÖZBAŞ
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
HemşirelikAnabilimDalı
DoktoraTezi,Nisan2014
Danışman:Doç.Dr.HavvaTEL
ErciyesUniversity,GraduateSchoolofHealthSciences
DepartmentofNursing,
PhD.Thesis,April2014
Supervisor:Assoc.Prof.Dr.HavvaTEL
ÖZET
ABSTRACT
Bu araştırma,
“psikodrama temelli psikolojik gü çlendirme programı” nın onkoloji hemşirelerinin
gü çlenme algıları ve tü kenmişlik dü zeylerine etkisini
belirlemek amacıyla yapılmış bir mü dahale çalışmasıdır.
Araştırma ö rneklemini 82 hemşire oluşturmuştur.
Araştırmada,kişiselbilgiformu,Beckdepresyon,Psikolojik gü çlendirme, Hemşirelikte işyeri gü çlendirme ve
This study is an intervention study whıch was performed to determine the effects of a psychodramabased psychological empowerment programme on
empowermentperceptionandburnoutlevelsinoncologynurses.
Thesampleconsistedof82nurses.Researchdatawere
obtained by personal information form, Beck Depression, Psychological Empowerment, The Conditions for
WorkEffectivenessandMaslachBurnoutscales.Measurement tools of the study were applied to the intervention and control groups at the beginning and the
end of the programme. The “Psychodrama based psychological empowerment programme” took 10 weeks
to complete. Analyses of data were evaluated by independent samples t test, one-way analysis of variance,
andPearsoncorrelationanalysis.
After implementation of the programme, it was determined that the scores of psychological empowerment
and workplace empowerment increased more for the
intervention group than the control group. Burnout
scoresfortheinterventiongroupdecreasedmorethat
the controlgroup.
The results of the study revealed that a psychodrama
based psychological empowerment programme increased psychological empowerment, workplace empowerment perception, and decreased the burnout
araçlarıçalışmavekontrolgrubuna programınbaşlangıcındaveprogramtamamlandıktansonrauygulanmıştır.
“Psikodrama
Temelli
Psikolojik Gü çlendirme Programı”10hafta sü rmü ştü r. Verilerindeğ erlendirilmesindebağ ımsızgruplardattesti,tek
yö nlü varyansanalizi,Pearsonkorelasyonanalizikullanılmıştır.
Uygulanan program sonrası, çalışma grubunun psikolojik gü çlendirme ve iş yeri gü çlendirme puanlarının
arttığ ı, bu ikiö lçeklebelirlenenpuanların karşılaştırma
grubununpuanlarındanyü ksekolduğ u, çalışmagrubunun tü kenmişlik puanlarının azaldığ ı ve karşılaştırma
grubunun puanlarından daha dü şü k olduğ u belirlenmiştir.
Çalışmada uygulanan programının onkoloji hemşirelerinin psikolojik gü çlenme ve işyeri gü çlenme algılarını
artırdığ ı,tü kenmişlikdü zeyleriniazalttığ ısaptanmıştır.
Bunedenle,onkolojikliniklerindeçalışanhemşirelerin
gü çlenme
Algısınıartırmakvetü kenmişliğ iö nlemekiçin bireysel
farkındalığı
destekleyen psikodrama yö ntemlerinden yararlanılması ö nerilmektedir.
Anahtar kelimeler: psikodrama, psikolojik gü çlendirme, onkolojihemşiresi,tü kenmişlik, işyeri gü çlendirme
38
increase empowerment perception and to decrease
burnoutinnursesworkingintheoncologyclinic.
Key words: psychodrama, psychological empowerment, oncologynurse,burnoutworkplaceempowerment
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
TEZÖZETLERİ
OKSİDATİFSTRESİNOVARYUMFOLLİKÜLLERİÜZERİNEETKİSİVEANTİMÜLLERİANHORMONEKSPRESYONU
THEEFFECTOFOXIDATIVESTRESSONOVARIANFOLLICLESANDANTIMULLERIANHORMONEEXPRESSION
EsraBALCIOĞLU
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
HistolojiveEmbriyolojiAnabilimDalı
DoktoraProgramı
DoktoraTezi,Nisan2014
Danışman:Prof.Dr.SaimÖZDAMAR
ErciyesUniversity,FacultyofMedicine
DepartmentofHistologyandEmbryology,
DoctoralProgram
PhD.Thesis,April2014
Supervisor:Prof.Dr.SaimÖZDAMAR
ÖZET
ABSTRACT
Oosit ü retimi ve follikü l olgunlaşmasından sorumlu
birincil fonksiyonel organ ovaryumdur. Anti-Mü llerian
hormon (AMH) hem primordial follikü l gelişiminde
hemdedominantfollikü lseçimindeö nemliroloynayan
transforming growth faktö r β ailesinin ü yesi olan, dimerik bir glikoproteindir. Organik klorü rlü bir pestisit
olan metoksiklor (MXC) ü reme sistemi için toksik olarak bilinir. Bu çalışmanın amacı erken ergenlikte
MXC’yemaruzkalmanınovaryummorfolojisiveağ ırlığ ı, follikü l çapı ve hacmi, AMH ekspresyonu ü zerine
etkileriniincelemektir.
Araştırmanınamaçlarıdoğ rultusunda,36adetdişiWistaralbinotü rü sıçan4grubaayrıldıvedeneygrubuna
20 gü n sü reyle farklı dozlarda MXC (8 mg/kg, 16 mg/
kg, 32 mg/kg) verildi. Ovaryumlar toplandıktan sonra
bloklar hazırlandı ve 5μm kalınlığ ında kesitler alındı.
Genel yapı ve ö zelliklerini belirlemek için Masson’s
trikrom, Hematoksilen-Eozin ve immü nohistokimyasal
boyamauygulandı.
Normal sıçan ovaryumları ile karşılaştırıldığ ında MXC
uygulanan gruplar dü şü k ovaryum ağ ırlığ ına sahipti.
Kontrol ve deney grupları arasında follikü l çapları ve
alanlarıaçısındananlamlıbirfarkyoktu.Fakatyü ksek
ve orta doz MXC verilen gruplarda epitel ve tunika albugineadakalınlaşmabelirlendi.
BusonuçlarMXC’ninovaryumgelişiminiinhibeettiğ ini
ve sıçan ovaryumunda doğ rudan AMH ü retimini uyar-
The ovary is the primary responsible functional organ
for oocyte production and follicle maturation. AntiMullerian hormone(AMH) is a dimeric glycoprotein, a
member of transforming growth factor β superfamily,
whichplaysanimportantroleonbothovarianprimordialfolliclerecruitmentanddominantfollicleselection,
the organochlorine pesticide methoxychlor (MXC) is
knownasareproductivetoxicant.Theaimofthisstudy
is to examine the effects of juvenile MXC exposure on
morphology, weight, follicle diameters and volumes of
ovarianandAMHexpression.
Forthepurposesofthestudy,thirtysixfemaleWistar
albino rats were divided into four groups and experimentalgroupsweregivenMXC(8mg/kg,16mg/kg,32
mg/kg) at different doses for 20 days. After collecting
ovaries, blocks were prepared and 5μm thick sections
werecut.Todeterminetheoverallstructureandproperties, Masson's trichrome, hematoxylin-eosin and immunohistochemicalstainingwereperformed.
MXC treated groups had the reduced ovarian weights
compared to the ovaries of normal rats. There was no
Anahtar kelimeler: Metoksiklor, oksidatif stres, ovaryum,
Anti-Mü llerianhormon
Keywords:Mexhoxcychlor,oxidativestress,ovary,AntiMullerianhormone
dekiAMHü retiminiteşvikettiğ ibelirlendi.
mental groups in terms of follicle diameter and area
measurements. But the thickening of the epithelium
and tunica albuginea was determined in the groups
ings indicated that MXC inhibit ovarian development
andinduceAMHproductiondirectly.Moreover,itwas
shown that MXC stimulate AMH production in granulosacells.
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
39
TEZÖZETLERİ
KOYUNÇİÇEĞİVEBULAŞICIEKTİMA(ORF)ENFEKSİYONUTANISIKONULMUŞKOYUNLARAAİTDERİ
LEZYONLARINDAMATRİKSMETALLOPROTEİNAZVEVASKÜLERENDOTELİYALGELİŞMEFAKTÖRÜNÜNİMMUNOHİSTOKİMYASALTEKNİKLESAPTANMASI
DETERMINATIONOFMATRIXMETALLOPROTEINASEANDVASCULARENDOTHELIALGROWTHFACTORWİTHIMMUNOHISTOCHEMICALTECHNIQUEINSHEEPPOXANDCONTAGIOUSECTHYMA(ORF)INFECTIONDIAGNOSEDIN
SKINLESIONS
OkaySAĞNAK
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
VeterinerPatolojiAnabilimDalı
YüksekLisansTezi,Nisan2014
Danışman:Doç.Dr.LatifeÇAKIR
ErciyesUniversity,GraduateSchoolofHealthSciences
DepartmentofVeterinaryPathology
MSc.Thesis,April2014
Supervisor:Doç.Dr.LatifeÇAKIR
ÖZET
ABSTRACT
Buçalışmaileaynıfamilyaiçerisindeikifarklıtü rolan
KoyunÇiçegiveOrfenfeksiyonundaoluşanderilezyonlarında matriks metalloproteinazların (MMP-1), ve
Vaskü ler Endoteliyal Gelişme Faktö rü nü n (VEGF) aktivasyonlarınınetkisininbelirlenmesivebö ylecebuhastalıkların patogenezisinin araştırılması amaçlandı. Bu
amaçla Kayseri’ nin değ işik bö lgelerinde eş zamanlı
ortayaçıkanOrfveKoyunÇiçeğ ivakalarıklinikvepatolojik olarak değ erlendirildi. Çalışmada pox virus ve
parapoxvirü santijenleriimmunohistokimyasalteknikle deride dejenere epitel hü crelerinin sitoplazmasında,
koyun çiçeğ i hü crelerinin sitoplazmasında ve çekirdeğ indesaptandı.Koyunçiçeğ ivirü sü infektedokukesitlerine(akciğ er,deri)matriksmetalloproteinaz(MMP),
In this study, the same family includes two different
types of SheepPox and Orf infection occurs in the skin
lesions of matrix metalloproteinases (MMP-1), and
VEGF activation effect of the determination and thus
the disease pathogenesis, we aimed to investigate.
ThesepurposesofKayseriindifferentregionssimultaneously occurring Orf (ORFV) and Sheep pox (SPV)
cases of clinically and pathologically evaluated.
Sheeppox viral antigen was detected in the cytoplasm
ofsheeppoxcellsanddegeneratedepithelialcellsofthe
skin.Nuclearstainingwasalsoobservedinsometypically deformed nuclei of sheeppox cells.Sheep pox to
virus-infectedtissuesections(lung,skin)matrixmetal-
(TIMP) ekspresyonları araştırıldı. Makroskobik ve histopatolojikbulgularderidevedahaazşiddetteeklentilerinde gö rü ldü . Koyun çiçeğ i infekte deri dokusunda
epitelialhiperkeratoz,akantoz,dejenerasyonvenekroz
sayıdakoyunçiçeğ ihü cresi(cellulesclaveleuses)gö rü ldü . Orf vakalarında ise kahverengimsi-gri rente kabuk
oluşumu belirgindi. Histopatolojik olarak retikuler dejenerasyon (çekirdek piknozu ve hidropik değ işiklik),
epidermal proliferasyon, intradermal mikroapseler
belirgindi. Normal dokulara gö re pox enfekte dokularda MMP-1, immunoreaktivitesi ö nemli dü zeyde azalmıştı. Ancak TIMP immunoreaktivitesi infekte koyun
çiçeğ i virü sü ile enfekte deri ve akciğ er dokularında
daha çok belirgindi. Koyun çiçeğ i virusunun ekstrasellü lermatriksiyıkılmayarakepidermalvedermaletkilerenedenolduğ uhipotezedildi.Orfvirü senfektedokularda damarlarda VEGF ekspresyonu gö rü lmedi. Bu
loproteinase ( TIMP) expression were investigated.
and adnexa were seen in less severe. Epithelial hyperkeratosis, acanthosis, degeneration, necrosis was seen
sheep pox infected skin tissue, Eosinophilic intracytoplasmic, inclusion of the large number of sheep pox
cells(cellulesclaveleuses)wereseen.Orfisabrownish
-grayinthecaseofrentcrustformationwascharacterized. Histopathologically reticular degeneration
(pyknosis and hydropic changes in the nuclei, epidermal proliferation, intradermalabscesses were evident.
Pox infected tissue in comparison to normal tissue of
MMPHowever, TIMP-1, immunoreactivity with infected
sheep pox virus in infected skin and lung tissue was
muchmorepronounced.Vesselswalldidnotrevealany
positiveimmunostaining.
nuçlaralınabileceğ işeklindeyorumlandı.
Anahtarkelimeler:
munohistokimya,MatriksMetalloproteinaz,Metalloproteinaz-
40
Key words: Sheep pox, Orf (Contagious Ectyma), Immunohistochemistry, Matrix Metalloproteinase, Tissue inhibitor of
Metalloproteinase-1,VascularEndothelialGrowthFactor
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
TEZÖZETLERİ
KAYSERİ’DESATIŞASUNULANSUCUKLARDALİSTERİASPP.VARLIĞININKLASİKKÜLTÜRYÖNTEMİİLE
BELİRLENMESİ
DETECTIONOFLISTERIASPP.BYCULTURALMETHODFROMTHESOUJOUK SAMPLESSOLDINKAYSERI
KoralDUYGULU
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
VeterinerBesinHijyeniveTeknolojisiAnabilimDalı
YüksekLisans,Nisan,2014
Danışman:Doç.Dr.NurhanERTAŞ
ErciyesUniversity,InstitueofHealthSciences
DepartmentofVeterinaryFoodHygieneandTechnology
MasterThesis,December,2013
Supervisor:AssociateProf.Dr.NurhanERTAŞ
ÖZET
ABSTRACT
Bu çalışmanın amacı Kayseri ilinde satışa sunulan sucuklarda Listeria spp. varlığ ını incelemekti. Çalışmada
This study was designed to detect Listeria spp. from
soujouk samples sold in Kayseri. Total of 100 sucuk
samples were analysed in this study. Samples were
tested according to the Listeria isolation procedure as
recommended by ISO 11290-1/A1-2004. Among 100
samplesanalysed,29samples(29%)werepositivefor
Listeria spp. and only 6 samples (6%) were found to
harbour L. monocytogenes. The present study shows
thatthesucuksamplessoldinKayseri mustnotbeunderestimatedasahazardforpublichealth.
Anahtar kelimeler: L. monocytogenes, sucuk, izolasyon, Kayseri
Keywords:L.monocytogenes,sucuk,isolation,Kayseri
-1/A1-2004’daö nerilenListeriaizolasyonprosedü rü ne
gö re analiz edildi. Çalışma kapsamında, analiz edilen
100 ö rneğ inin 29 ö rnek (%29) Listeria spp. açısından
pozitif bulunurken ö rneklerden altısının (%6) L. monocytogenes ile kontamine olduğ u belirlendi. Bu çalışmadaeldeedilenverileregö re,Kayseri’desatışasunulan sucukların halk sağ lığ ı açısından gö z ardı edilmemesigerekenbirtehlikeolduğ usonucunavarıldı.
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
41
TEZÖZETLERİ
SÜTSIĞIRLARINDAMAGNEZYUMOKSİTKULLANIMI
USEOFMAGNESIUMOXIDEINDAIRYCATTLE
İsmailÜLGER
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
HayvanBeslemeveBeslenmeHastalıkları
AnabilimDalı
DoktoraTezi,Nisan2014
Danışman:Prof.Dr.OsmanKÜÇÜK
ErciyesUniversity,InstituteofHealthSciences
DepartmentofAnimalNutritionandNutritionalDiseases
PhD.Thesis,April2014
Supervisor:Prof.Dr.OsmanKÜÇÜK
ÖZET
ABSTRACT
Bu çalışmanın amacı, erken laktasyon peryodundaki sağ mal
ineklerinrasyonlarınakatılanmagnezyumoksit(MgO)’insü t
verimveyağ oranıilebirliktesü t,idrar,dışkıverumenpH’ları
ile bazı kan parametreleri ü zerine etkisini değ erlendirmekti.
Çalışma iki aşamadan oluşmuştur. Birinci aşamada, doğ um
yaptıkları gü nden başlamak ü zere 10 hafta sü re ile (70 gü n)
Holsteinırkısü tineklerirasyonlarınaMgOkatılmıştır.Toplam
60adetsü tsığ ırıhergruptaeşitsayıdahayvanolmakü zere3
gruba ayrıldı. I. grubun, normal rasyon(kontrol),II. grubun-
normal rasyonuna 50 gram/baş/gü n MgO ilaveli rasyon (50
grMgO),veIII.grubun-normalrasyonuna100gram/baş/gü n
MgOilaveli rasyon (100grMgO) tü ketmelerisağ landı.Çalışmanın ikinci aşamasında, laktasyonlarının ilk 70 gü nü nde
bulunan60adetsü tsığ ırıhergruptaeşitsayıdahayvanolmak
-
normal rasyon(kontrol), 2- normal rasyona 100 gr/baş/gü n
MgOve 40 gr dikalsiyum fosfat(DCP)/baş/gü n(100grMgO
ve40grDCP),ve3-normalrasyona100gr/baş/gü nMgOve
80 gr/baş/gü n DCP (100grMgOve80grDCP) ilave edilen
rasyonlarıtü ketmelerisağ lanmıştır.
Çalışmanınbirinciaşamasındalaktasyondakisü tsığ ırrasyonlarına ilave edilen 50 ve 100 gr/baş/gü n MgO uygulaması,
rasyonlarına MgO katılmayan ineklere oranla sü t verimini ve
yemden yararlanmayı artırmıştır (P< 0.0001), rumen, dışkı,
idrarvesü tpH’sınıyü kseltmiş(P<0.0001)ancaksü tyağ ının
dü şmesine neden olmuştur (P< 0.0001). Rasyonlarına MgO
ilaveedilensü tineklerindeneldeedilenplazmaö rneklerindekiMg(P<0.0001),Ca(P=0.0167)vePkonsantrasyonları(P
=0.2678)MgOdozunabağ lıolmaksızınartmıştır.Sü tinekleri
rasyonlarınailaveedilenMgOplazmaCu,Se,Na,Mn,NiveCo
konsantrasyonlarınaetkietmemiştir(P≥0.3419).PlazmaCr,
FeveZnkonsantrasyonurasyonakatılanMgOvarlığ ıilebirliktedozabağ lıolmaksızınartmıştır(P≥0.0004).Plazmaglikoz
vetrigliseritkonsantrasyonlarırasyonailaveedilen50grMgO
dozundan etkilenmemiş ancak 100 gr MgO uygulaması ile
birlikteartmıştır(P=0.0473veP=0.0432,sırasıyla).
Çalışmanınikinciaşamasındasü tverimiveyemdenyararlanmarasyondaki100grMgO’yaDCPilavesiilebirlikteartmış(P
< 0.0001) sü t yağ ı ise azalmıştır (P < 0.0001). Rasyona ilave
edilenMgOrumenpH’sınıyü kseltmiştir.AncakMgOilebirlikte40gryerine80grDCPilavesisonucurumenpH’sıazalmıştır(P<0.0001).RasyonailaveedilenMgOveDCP,dışkıvesü t
pH’sınıyü kseltmiş(P<0.0001)ancakidrarverumenpH’sını
100grMgOve40grDCPuygulamasıdahaçokartırmıştır(P<
0.0001).
Çalışmasonuçlarınagö re,laktasyonunilk70gü nü ndebulunan
sü t inek rasyonlarına ilave edilen100 gram MgO ve 80 gram
DCP sü t verimini ve yemden yararlanma oranını artırmış ancak sü t yağ ını dü şü rmü ştü r. Laktasyonun ilk 70 gü nü nde sü t
ineklerine normal rasyon Ca (%0.93), P (%0.46) ve Mg (%
0.33) dü zeyine ilave olarak, 100 gram MgO ve 80 gram DCP
katılmasıö nerilmektedir.
Theobjectiveofthepresentworkwastoinvestigatetheeffect
ofdietarymagnesiumoxide(MgO)onmilkyieldmilkfatpercentage, and pH of rumen, urine, feces, and milk as well as
some blood parameters in lactating dairy cattle. The study
Anahtarkelimeler:
Keywords:Cow,magnesium,DCP,milkyield,pH
42
groups, 20 each, and were fed either a control ration
(control), a control ration with 50 gr/head/day MgO (50gr
MgO), or 100 gr MgO gr/head/day of control diet (100 gr
MgO).Atthesecondstageoftheworkwascontainedatotalof
edinto3groups,20each,andwerefedeitheracontrolration
(control),acontrolrationwith100gr/head/dayMgOplus40
gr/head/daydicalciumphosphate(DCP)(100grMgOand40
grDCP) or 100gr/head/dayMgOplus 80 gr of DCP(100gr
MgOand80grDCP)supplementedtothecontroldiet.
SupplementingMgOtothedietoflactatingcowsincreasedthe
milk yield and feed conversion rates (P< 0.0001), pH of rumen, feces, urine and milk (P< 0.0001), but decreased the
milk fat (P< 0.0001). Cows consumed the diet supplemented
with MgO had greater plasma concentrations of Mg (P <
0.0001), Ca (P = 0,0167), and P (P = 0.2678) with increasing
doze of MgO in the diet. However, there were no effects of
dietaryMgOinplasmaconcentrationsofCu,Se,Na,NiandCo
(P≥0.3419).PlasmaCr,FeandZnconcentrationsincreasedin
cowsfedadietsupplementedwithMgO(P≥0.0004)withno
increasingdoseeffectsbutwiththepresenceofMgO.Plasma
glucose and triglycieride concentrations increased only in
cows fed a diet supplemented with 100 gr MgO (P = 0.0473
andP=0.0432,respectively).
Atthesecondstageofthestudy,feedingcowswith100grof
MgO and DCP resulted in an increase in milk yield and feed
conversion rate (P < 0.0001) but a decrease in milk fat (P <
0.0001).RumenpHdecreasedonlyincowsfedadietsupplemented with 100 gr of MgO and 80 gr of DCP (P < 0.0001).
SupplementingbothMgOandDCPtothedietoflactatingcows
resultedinanincreaseinfecesandmilkpH(P<0.0001)buta
urineandrumenpH100gMgOandincreasedmorethan40g
DCPapplication(P<0.0001).
Results of the present work indicated that cows fed a ration
70daysoflactationincreasedmilkyieldandfeedconversion
with a decrease in milk fat. Therefore, it is recommended to
supplement100grofMgOand80grofDCPinadditiontothe
regular Ca (0.93%), P (0.46%) and Mg (0.33%) levels of the
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
TEZÖZETLERİ
KRONİKALÜMİNYUMİNTOKSİKASYONUOLUŞTURULANSIÇANLARDADOĞALBALINBEYİNDOKUSU
ÜZERİNEETKİSİ
EFFECTOFNATURALHONEYONBRAINTISSUEOFRATSWITHCHRONICALUMINIUMINTOXICATION
KenanÇALIŞKAN
ErciyesÜniversitesiSağlıkBilimleriEnstitüsü
FarmakolojiAnabilimDalı
YüksekLisansTezi,Mayıs2014
Danışman:Doç.Dr.HasanBasriULUSOY
ErciyesUniversity,GraduateSchoolofHealthSciences
PharmacologyDepartment
MSc.Thesis,May2014
Supervisor:AssortProf.HasanBasriULUSOY
ÖZET
ABSTRACT
Diyetilemaruzkalınanalü minyumunAlzheimerhastalığ ıileilişkiliolduğ unadairbulgularolsadaaksiyö nde
bulgular ortaya koyan çalışmalar az değ ildir. Sunulan
buçalışmada,birinsanınyaklaşıkolarakbirö mü rboyu
diyet ile maruz kalabileceğ i miktarda ve kronik olarak
uygulanan alü minyumun oluşturacağ ı muhtemel nö rolojikhasarakarşıkoruyucuolmasıbeklenendoğ albalın
beyindokusuü zerindekietkisiaraştırılmıştır.
ÇalışmadaWistarAlbinotü rü dişiyetişkinsıçanlarkullanılmıştır. Sıçanlar 5 gruba ayrılmıştır. Birinci grup
Even though there are conclusions about connection
betweenaluminumduetodietaryexposureandAlzhei-
suçıkarılmışveimmü nohistokimyasalvediğ erhistolojikyö ntemlerleincelenmiştir.
Hematoksilen eozin ile boyamada kontrol grubuna ait
beyindokularınormalolarakgö zlenmiş,deneygruplarına ait beyin dokularında da herhangi bir patolojiye
rastlanmamıştır. Beyin dokusundaki amiloid plakları
endofthreemonthstheratswerekilledandtheirbrain
tissueremovedwasexaminedwithimmunohistochemicalandhistologicalmethods.
In the staining process with hematoxylin eosin, brain
tissue of the control group was observed as normal.
Anypathologyinthebraintissuesoftheexperimental
groups was not found. InBielschowsky’s the brain tissues stained with silver nitratethat can show Amyloid
rü r (4,2 mg/kg), ü çü ncü gruba alü minyum klorü r ve
doğ al bal (0,1 g/kg), dö rdü ncü gruba alü minyum (4,2
mg/kg) klorü r ve doğ al bal (1 g/kg) ve beşinci gruba
alü minyum klorü r ve doğ al bal (10 g/kg) uygulanmış-
elschowsky’nin gü mü ş nitrat boyası ile boyanan beyin
histokimyasalçalışmalardahemkontrolhemdedeney
gruplarında β-amiloid ve p-Tau proteinleri için pozitif
boyanmayarastlanmamıştır.
Bu çalışmanın bulguları, diyet ile maruz kalınabilecek
miktarlardaki alü minyumun Alzheimer hastalığ ına yol
açamayacağ ı yö nü ndeki gö rü şleri desteklemektedir.
Literatü rdeki diğ er çalışmaların aksine, herhangi bir
nö rolojik hasara rastlanılmaması genetik farklılıklara
bağ lanabilir. Ayrıca bulgular doğ al balın çok yü ksek
miktarlarda bile ö nemli bir toksisitesinin olmadığ ına
işaretetmektedir.
Anahtarkelimeler:Alzheimerhastalığ ı,alü minyumintoksikasyonu,doğ albal,beyindokusu
ingsarenotless.Inthisstudy,theeffectsofthenatural
honey inanamountofapersonmaybeexposeddueto
dietthroughoutitslifeandthatisexpecttoproductive
against neurological damage of the aluminum caused
bychronicallyadministeredwereinvestigated.
In the study femaleand adult Albino Wistar rats were
group is the control group. Only aluminum chloride
(4,2 mg/kg) for the second group, aluminum chloride
andnaturalhoney(0.1g/kg)forthethirdgroup,aluminum chloride and natural honey (1 g / kg) for the
fourthgroupandaluminumchlorideandnaturalhoney
tive staining was not observed. In immunohistochemical studies in both control and experimental groups,
positive staining has been found for β-amyloid and pTauproteins.
amount of thealuminum due to dietaryexposure cannot leadtoAlzheimer'sdisease.Unlikeotherstudiesin
theliterature,absenceofanyneurologicaldamagecan
indicate that even large quantities of natural honey
Keywords:Alzheimerdiseases,aluminumintoxication,naturelhoney,braintissue
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
43
TEZÖZETLERİ
BESİTİPİBILDIRCINCİVCİVYEMLERİNEKATILANSELENYUMVEKROMUNCANLIPERFORMANSVEBAZIKAN
PARAMETRELERİNEETKİSİ
EFFECTSOFSELENIUMANDCHROMIUMSUPPLEMENTATIONINTHEDIETOFQUAILSONLIVEPERFORMANCEANDSOMEBLOODPARAMETERS
KerimKILINÇ
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
HayvanBeslemeveBeslenmeHastalıkları
AnabilimDalı
YüksekLisansTezi,Mayıs2014
Danışman:Prof.Dr.OsmanKÜÇÜK
ErciyesUniversity,GraduateSchoolofHealthSciences
AnimalNutritionandNutritionalDiseasesDepartment
MSc.Thesis,May2014
Supervisor:Prof.Dr.OsmanKÜÇÜK
ÖZET
ABSTRACT
Buçalışmanınamacıbıldırcınyeminekatılanselenyum
(Se)vekromun(Cr)canlıperformansvekanparametrelerine etkisini araştırmak idi. Çalışmada 10 gü nlü k
yaştatoplam90bıldırcın(Coturnix coturnix Japonica)
kullanılmış ve çalışma toplamda 30 gü n sü rmü ştü r.
Çalışma, her grupta 30 bıldırcın olacak şekilde dizayn
edilmiştir. Bıldırcınların, sırasıyla 1-kontrol karma yemi, 2-kontrol karma yemine 0,2 ppm Se (SeO2) ilaveli
rasyonve3-kontrolkarmayemine0,2ppmSeve500
ppm Cr (Na2Cr2O7.2H2O) ilaveli rasyon tü ketmeleri
sağ lanmıştır. Selenyum ve Se+Cr uygulamasına tabi
tutulan bıldırcın gruplarında CA dü şü şleri yaşanmıştır
(P ≥ 0,0238). Bıldırcın yemlerine ilave edilen Se, CA
artışını yavaşlatmıştır ancak Se’ye ilave olarak yeme
Theobjectiveofthisworkwastoinvestigatetheeffects
of supplemental selenium (Se) and chromium (Cr) on
liveperformanceandsomebloodparametersinquails.
Atotalof9010-day-oldquails(Coturnix coturnix Japonica) were used, and the workwas terminated after 30
days. The birds were randomly assigned to caging
units, 30 birds each. Water and the diets were consumed by the birds ad libitum throughout the experiment.Thequailswerefedeither1-abasaldiet,2-the
basaldietsupplementedwitheither0.2ppmSe(SeO2)
or3-thebasaldietsupplementedwith0.2ppmSeplus
500 ppm Cr (Na2Cr2O7.2H2O).Supplemental Se and
Se+Cr resulted in a decrease in live weight gains (P ≥
0.0238). Supplemental Se decreased the live weight
gain but a combination of Se+Cr caused alleviation on
thisdecrease.Feedconsumptionincreasedinquailsfed
a diet supplemented with Se; however, supplementing
SeandCrtogetherdecreasedthefeedconsumptionbut
stillgreaterthanthatofcontrol(P<0.0001).Feedconversion ratio did not change among treatments (P =
0.3220). Selenium supplementation alone did not
change the serum concentrations of glucose or total
protein whereas Se+Cr treatment resulted in an increase in glucose (P = 0.0036) but a decrease in total
proteinconcentrations(P=0.0189).Serumcholesterol
or triglycerides concentrations remained similar
among treatments (P = 0.2026). Serum AST enzyme
activity decreased with Se supplementation but more
withSe+Crtreatments(P=0.0587).SupplementingSe
andSe+Crtothedietofquailsresultedinadecreasein
serumconcentrationsofCa(P=0.0009),P(P=0.0720)
andNa(P<0.0001)butnochangesinMgorClconcentrations (P ≥ 0.2442). Supplementing Se and Se+Cr to
thedietofquailsresultedinanincreaseinserumconcentrations of Fe, Cu, Al and Mn. Selenium treatment
caused an increase in serum concentration of Zn but
Se+CrtreatmentresultedinadecreaseinZnconcentrations (P = 0.0027). As expected, supplementing quail
dietswithbothSeandCrresultedinincreasesinserum
concentrationsofSeandCr;however,asacombination
of Se and Cr resulted in greater increases in the both
serum concentrations (P < 0.0001). In conclusion, Se
alone or asa combination with Cr supplementation to
the diet of quails resulted in a depressed live performancethusarenotrecommendedinthediet.
Anahtarkelimeler:Bıldırcın,krom,selenyum,performans
Keywords:Quails,chromium,selenium,performance
yemeilaveedilenSeilebirlikteyü kselmişancakyeme
katılanSe+Crdurumundabuyü kselişdahaazolmuştur
(P<0,0001).Bıldırcıngruplarıarasındayemdenyararlanmaoranıdeğ işmemiştir(P=0,3220).BıldırcınyemlerineilaveedilenSeserumglikozvetotalproteinkonsantrasyonlarını değ iştirmez iken, Se ile birlikte yeme
ilaveedilenCrserumglikozkonsantrasyonlarındayü kselmeye(P=0,0036)totalproteinkonsantrasyonlarında ise dü şü şlere (P = 0,0189) neden olmuştur. Serum
kolesterol ve trigliserit konsantrasyonları bıldırcın
yemlerine ilave edilen Se veya Cr’dan etkilenmemiştir
(P=0,2026).SerumASTenzimaktivitesiSeuygulaması
ile ancak ö zellikle Se+Cr uygulamaları ile birlikte dü şmü ştü r (P = 0,0587). Serum Ca (P = 0,0009), P (P =
0,0720)veNa(P<0,0001)konsantrasyonlarıbıldırcın
yemlerineSeveCrilavesiilebirliktedü şmü ştü r.Ancak
serum Mg ve Cl konsantrasyonları uygulamalardan
etkilenmemiştir (P ≥ 0,2442). Serum Fe, Cu, Al ve Mn
konsantrasyonlarıuygulamalarilebirliktebü yü koranda yü kselmiştir (P ≥ 0,0002). Bıldırcın rasyonlarına
ilave edilen Se, serum Zn konsantrasyonlarını yü kseltmişancakyemeilaveedilenSe+CrilebirlikteserumZn
konsantrasyonları ö nemli dü zeyde dü şmü ştü r (P =
0,0027). Beklendiğ i ü zere, bıldırcın yemlerine ilave
edilen Se ve Cr serum Se ve Cr konsantrasyonlarını
artırmışancakyemSeilebirlikteilaveedilenCrisebu
artışlarının daha fazla olmasını temin etmiştir (P <
0,0001).Sonuçolarak,SeveCrtekbaşınaveyakombine olarak bıldırcın yemlerine katıldığ ında performansı
olumsuz etkilediğ inden bıldırcın yemlerine fazladan
katılmasıtavsiyeedilmemektedir.
44
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
TEZÖZETLERİ
RATLARDAKARBONTETRAKLORÜRİLEOLUŞTURULANKRONİKKARACİĞERHASARIÜZERİNEZERDEÇAL
(CURCUMALONGA)VEMERYEMANADİKENİNİN(SİLYBUMMARİANUM)ETKİSİ
THEEFFECTSOFCURCUMALONGAANDSILYBUMMARIANUMONCARBONTETRACHLORIDEINDUCEDCHRONICHEPATICDAMAGEINRATS
OktayBARAN
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
VeterinerPatolojiAnabilimDalı
YüksekLisansTezi,Nisan,2014
Danışman:Prof.Dr.AyhanATASEVER
ErciyesUniversity,GraduateSchoolofHealthSciences
DepartmentofVeterinaryPathology
MSc.Thesis,April,2014
Supervisor:Prof.Dr.AyhanATASEVER
ÖZET
ABSTRACT
Bu çalışmada ratlarda karbon tetraklorü r (CCl4) ile oluşturulankaraciğ erhasarınakarşızerdaçalvemeryemanadikeninin
lipidperoksidasyonuvebazıbiyokimyasalparametrelerü zerinekoruyucuetkinliğ inindeğ erlendirilmesiamaçlandı.
Çalışmada4-5aylık,60adet(200-250gr)Wistaralbinocinsi
rat kullanıldı. Kontrol grubuna tedavi uygulaması ü ç grup
altında yapıldı. Birinci gruba bir hafta boyunca iki kere mısır
yağ ı(GrupI),5.gruba100mg/kgdozundameryemanadikeni
(GrupV),6.gruba80mg/kgdozundazerdaçal12haftaboyuncagavajyö ntemiileverildi(GrupVI).Deneygrubundahaftada
iki kere 0,5 ml/kg CCl4 intraperitoneal olarak enjekte edildi
(Grup II). Tedavi gruplarında ise, tedavi uygulaması 12 hafta
boyuncaikigrupaltındayapıldı.CCl4+meryemanadikenigrubunda, CCl4enjeksiyonunu takiben eş zamanlı 100 mg/kg
dozunda meryemana dikeni gavaj ile verilirken (Grup III),
CCl4+zerdaçal grubunda CCl4enjeksiyonunutakibeneşzamanlı80mg/kgdozundazerdaçalgavajileverildi(GrupIV).Deney
sonunda karaciğ er dokularının hem histopatolojik hem de
serumbiyokimyasalparametreleriincelendi.
Kontrol ve deney gruplarının histopatolojik muayenelerinde
kontrol gruplarında normal doku yapısı gö zlenirken, karbon
tetraklorü rverilengrupta(GrupII)hepatositlerdeyağ dejenerasyonu,remark kordonlarının yapısındabozulma, hepatositlerdedejenerasyon,portalbö lgedeveparankimdeçoğ unluğ u-
Curcumalongaand Silybummarianumon lipid peroxidation
and some serum biochemical parameters in liver damage
inducedwithcarbontetrachloride(CCl4)inrats.
Inthestudy,60Wistaralbinoratswith4-5monthsold(200250g)wereused.Applicationoftreatmentinthecontrolgroups were performed withthree groups. The group1 wasadministratedcornoiltwiceforoneweek(GroupI),group5was
administrated 100 mg/kg silymarin (Group V) and group 6
was administrated 80 mg/kg turmeric (Group VI) for 12 weeksbyoralgavage.Intheexperimentalgroupwasintraperitoneallyinjected0,5ml/kgCCl4twiceinaweek(GroupII).The
aplication of treatment was performed two groups for 12
weeksinthetreatmentgroups.Whilethe100mg/kgsilymarin was given in the CCl4+silymarin group by gavage (Group
III), the 80 mg/kg turmeric was given in the CCl4+turmeric
group following of the injection of 0,5 ml/kg CCl4(Group IV).
Intheendofstudy,alllivertissueswereexaminedbothhistopathologicalandserumbiochemicalparameters.
Whilethenormaltissuestructurewasobservedinthecontrol
groupinthehistopathologicalexaminationoftheexperimentalandcontrolgroups,itwasshownthatfattydegenerationin
the hepatocytes, deterioration in the structure of remark
alanları, ö zellikle portal bö lgede daha belirgin olmak ü zere
parankimeyayılmışbağ dokusuartışıileilgililobulasyonoluşumu gö zlendi. CCl4+meryemana dikeni (Grup III) ve
CCl4+zerdaçal (Grup IV) gruplarında Grup II’dekine benzer
şekildekaraciğ erlezyonlarınarastlanıldı.
Kontrol (Grup I), meryemana dikeni (Grup V) ve zerdaçal
(GrupVI)verilengruplaragö re,CCl4uygulanantü mgruplarda
(Grup II, Grup III, Grup IV) serum alanin aminotransferaz
(ALT), Aspartat aminotransferaz (AST) ve dü şü k dansiteli
lipoprotein(LDL)dü zeylerindeartış;yü ksekdansitelilipoprotein (HDL)ve albü min değ erlerinde ise dü şü ş gö rü ldü . CCl4
verilengruba(GrupII)gö reCCl4+meryemanadikeni(GrupIII)
ve CCl4+zerdaçal (Grup IV) verilen grupların serum değ erlerindeanlamlıbirdeğ işimgö zlenmedi.Kontrolgrubu(Grup1)
ile meryemana dikeni (Grup V) ve zerdaçal (Grup VI) verilen
grupların değ erleri karşılaştırıldığ ında serum biyokimya değ erlerindeanlamlıbirdeğ işmeolmadığ ıgö zlendi.
CCl4verilengruplarda(GrupII,GrupIII,GrupIV)kontrolgrubunagö re(Grup1)malondialdehit(MDA)venitrikoksit(NO)
değ erlerinde artış gö rü ldü . CCl4 grubuna (Grup 2) gö re
CCl4+meryemanadikeni(GrupIII)veCCl4+zerdaçal(GrupIV)
verilen grupta karaciğ er MDA veNO dü zeylerinde ö nemlibir
değ işimtespitedilmedi.
Sonuç olarak, bu çalışmada, oluşan karaciğ er hasarının geri
dö ndü rü lmesiamacıyla,zerdaçalvemeryemanadikeniverilerek yapılacak yeni araştırmalarda değ işik dozlarının kullanılması ve etkilerinin belirlenmesine ihtiyaç olduğ u sonucuna
varılmıştır.
Anahtar kelimeler: Karbon tetraklorü r, karaciğ er hasarı,
meryemanadikeni,zerdaçal,rat
areas composed of majority lymphocytes in the portal area
andparenchyma,especiallyatportalareaincreasingconnectivetissuespreadtoparenchymarelatedtoformationoflobulation in the carbon tetrachloride (CCl4)-treated group (Group
II).TheliverlesionswerefoundintheCCl4+silymarin(Group
III)andCCl4+turmeric(GroupIV)groupsliketheGroupII.
While the CCl4-treated groups (Group II, Group III, GroupIV)
wereincreasedserumalanineaminotransferase(ALT),aspartate aminotransferase (AST) and low density lipoprotein
(LDL) levels, high-density lipoprotein (HDL) and albumin
valuesweredecreasedcomparedtoControl(GroupI),silymarin-treated (Group III), turmeric-treated (Group IV). The
CCl4+silymarin(GroupIII),CCl4+turmeric(GroupIV)werenot
CCl4-treatedgroup(GroupII).Itwasobservedthattheserum
silymarin (Group V) and turmeric (Group VI) groups comparedwithcontrolgroup(GroupI).
Themalondialdehyde(MDA)andnitricoxide(NO)levelswere
increased in the CCl4-treated groups (Group II, Group III,
GroupIV)comparedtocontrolgroup(GroupI).Inthesilymarin-treated (Group III) and turmeric-treated (Group IV) groupswerenodetected
NOlevelscomparedtoCCl4-treatedgroup(GroupII).
As a results, in this study it has been concluted that need to
usevariousdosesanddetectoftheeffectsinthefuturestudies
treated silymarin and turmeric, in order to reverse the liver
damage.
Key words: Carbon tetrachloride, curcuma longa, hepatotoxicity,silybummarianum,rat
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
45
TEZÖZETLERİ
KOYUNLARDAHAEMONCHUSCONTORTUS'UNMOLEKÜLERKARAKTERİZASYONUVEBENZİMİDAZOL
DİRENÇLİLİĞİNİNMOLEKÜLEROLARAKARAŞTIRILMASI
MOLECULARCHARACTERIZATIONOFHAEMONCHUSCONTORTUSINSHEEPANDMOLECULAR
INVESTIGATIONOFBENZIMIDAZOLERESISTANCE
ZuhalÖNDER
T.C.ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
VeterinerParazitolojiAnabilimDalı
DoktoraTezi,Mayıs2014
Danışman:Prof.Dr.AlparslanYILDIRIM
ErciyesUniversity,GraduateSchoolofHealthSciences,
DepartmentofVeterinaryParasitology
PhD.Thesis,May2014
Supervisor:Prof.Dr.AlparslanYILDIRIM
ÖZET
ABSTRACT
Buçalışma,Kayseriyö resindekoyunlardaHaemonchuscontortus'unmolekü ler prevalansı ve karakterizasyonu ile benzimidazol dirençliliğ inin
molekü ler olarak araştırılması amacıyla planlanmıştır. Bu amaçla 2012-
This study was conducted to investigate the molecular prevalence and
characterization of Haemonchuscontortus and as well as benzimidazole
resistance in H.contortuspopulations in sheep from Kayseri and vicinity.
For this aim between 2012 and 2013 feces samples were techniqually
collectedfromtotally300Akkaramansheepraisedinseveralsheepfarms
ookistleri yö nü nden incelenmiştir. Konvansiyonel dışkı muayenesi sonucunda,incelemesiyapılankoyunların244’ü (%73,2)çeşitliparazityumurta ve/veya ookistleri yö nü nden pozitif bulunmuştur. En yaygın tü rler %
48,3ileTrichostrongylidtipetkenlerbelirlenmişbunusırasıyla%36,7ile
Marshallagiasp.,%28,3ileEimeriasp.,%14,3ileNematodirussp.,%4,3ile
Monieziasp.ve%1.7ileTrichurisovisizlemiştir.Trichostrongylidtü rlerle
enfekte koyunlarda gram dışkıdaki yumurta sayısı (EPG) ortalama
120,3±53,5olarakbelirlenmiştir.EPGdü zeylerinin2yaşü zerikoyunlarda
iki yaş altına gö re yaklaşık 2 kat yü ksek olduğ u saptanmıştır (p<0,05).
Trcihostrongylid yumurtalar yö nü nden pozitif belirlenen 145 ö rneğ in
dışkılarından genomik DNA ekstraksiyonunu takiben elde edilen DNA’lar
H.contortus
(ITS-
the parasite eggs/oocysts under light microscope. 244 (73.2%) out of
examinedsheepwerefoundtobepositivewithseveralparasiteeggsand/
oroocysts.Trichostrongylidswerefoundtobethemostprevalentspecies
with the raito of 48.3% and this ratio was followed by Marshallagia sp.,
Eimeriasp.,Nematodirussp.,Monieziasp.andTrichurisoviswiththeratios
36.7%, 28.3%, 14.3%, 4.3% and 1.7%, respectively. The mean egg per
gram of feces (EPG) value in sheep infected with trichostrongylids was
determinedas120.3±53.5.TheEPGlevelsinsheep>2yearsagegroupwas
determinedtwicehigherthan≤2yearsagegroup(p<0.05).GenomicDNA
extractionswereperformedon145sampleswhichwerefoundpositivefor
trichostrongylid eggs and TaqMan Probe based Real Time PCR analyses
çeşitli koyunculuk işletmelerinde toplam 300 baş akkaraman ırkı koyundan tekniğ ine uygun olarak dışkı ö rneğ i toplanmıştır. Toplanan dışkılar
H.contortus yö nü nden pozitif belirlenmiş olup ortalama Ct (dR) değ eri
30,9±3,38 bulunmuştur. Belirlenen Ct (dR) değ erlerine gö re >2 yaş grubundaparaziteminin≤2yaşgrubunaoranladahayü ksekolduğ ubelirlenmiştir (p<0,05). Real Time PCR analizleri sonucu H.contortus pozitif
-2rDNAvemitokondriyalcytochromeoxidasesubunit1(mt-
yonundansonrasekansanalizlerigerçekleştirilmiştir.Eldeedilenizolatların GenBank kayıtları yapılmış ve dü nyadaki benzer izolatlar ile çoklu
-2
nü kleotidsekanslarıortayakonan4H.contortusizolatının(TrERUHcon04,
TrERUHcon05, TrERUHcon06, TrERUHcon07) pairwise analizleri sonucu
%100,0identikoldukları,Dü nyanınfarklıbö lgelerindenGenBank’akayıtlı
benzer izolatlarla ise ortalama %0,1 genetik farklılık gö sterdikleri tespit
edilmiştir.Mt-COIgenbö lgesinegö reincelenenizolatların(TrERUHcon01,
TrERUHcon02, TrERUHcon03) pairwise analizleri sonucu %96,3-%100,0
identik oldukları, dü nyada GenBank’a kayıtlı az sayıdaki izolatlarla ise %
5,3±0,6 genetik farklılık gö sterdikleri belirlenmiştir. Çalışmada H.contortus
amacıyla β tubulin izotip-1 gen bö lgesindeki duyarlı ve dirençli allellere
leştirilmiştir. Real time PCR analizleri sonucu H.contortus popü lasyonlarında benzimidazol dirençliliğ i açısından duyarlı allel sıklığ ı %
87,12±16,19, dirençli allel sıklığ ı ise %12,88±16,19 olarak belirlenmiş ve
bu farklılık istatistiksel açıdan ö nemli (p<0,05) bulunmuştur. Çalışmada
ayrıcaduyarlıvedirençliallelsıklıklarınagö rebelirlenenbazıizolatlardaβ
tubulin izotip-1 gen bö lgesinin sekansları belirlenmiş ve benzimidazol
-2) gen
region. 36 (24.8%) out of 145 samples were determined positive for H.
contortuswithameanCt(dR)valueof30.9±3.38.Parasitemiawasdeterminedhigherin>2yearsagegroupthan≤2yearsagegroupbasedonthe
obtained Ct (dR) values (p<0.05). In order to phylogenetic analyses of H.
contortusin positive samples, PCR analyses were performed with the
-2rDNAandmitokondriyalcytochromeoxidase
subunit 1 gene regions (mt-COI). Sequence analyses of the isolates were
tions.TheobtainedisolatesweredepositedtotheGenBankandphylogeneticanalyseswerecarriedoutbymultiplealignmentsoftheisolateswith
the similar ones available in GenBank in the world. The 4 H.contortus
isolates (TrERUHcon04, TrERUHcon05, TrERUHcon06, TrERUHcon07)
whichtheITS-2nucleotidesequencesdetermined,showed100.0%identitytoeachotherand0.1%geneticdifferencewiththeisolatesfromdifferent parts of the world in the GenBank. The pairwise analyses of the isolates(TrERUHcon01,TrERUHcon02,TrERUHcon03)characterizedbyMtCOIsequencesshowed96.3%-100.0%identitytoeachotherandalsothey
exhibited 5.3±0.6% genetic difference with the few isolates from the
World in GenBank. TaqMan based Real Time PCR analyses were performed on totally 36 H.contortuspositive samples with the primers and
βtubulinisotipe-1generegionofsensitiveandresistant
alleles in order to investigate benzimidazole resistance. Sensitive and
resistant allele frequencies by means of benzimidazole resistance in H.
contortus populations were determined as 87.12%±16.19 and 12.88%
±16.19,respectivelyinRealTimePCRassaysandthedifferencebetween
asitine (TAC) dö nü ştü ğ ü saptanmıştır. Duyarlı ve dirençli allellere ait
izolatlarınGenBankkayıtlarıgerçekleştirilmiştir.
Sonuç olarak bu çalışma ile Tü rkiye’de ilk kez koyunlarda H.contortus’un
molekü lerprevalansıbelirlenmişvegenetikkarakterizasyonuyapılmıştır.
Çalışma ile araştırma yö resinde H.contortus popü lasyonlarında benzimidazoldirençliliğ imolekü lerolarakortayakonmuş,duyarlıvedirençliallel
sıklıkları belirlenerek risk faktö rleri saptanmıştır. Elde edilen sonuçlar,
dirençliH.contortuspopü lasyonudinamikleriaçısındantedaviveilaçlama
yö ntemleriningö zdengeçirilmesivealternatifstratejilerinoluşturulmasınınzorunluolduğ unuortayaçıkarmıştır.
(p<0.05).βtubulinisotipe-1genesequencesofsomeisolateswhichwere
selected by means of sensitive and resistant allele frequencies were also
determinedandsinglenucleotidepolymorphisms(SNPs)wereinvestigatedaccordingtothebenzimidazoleresistance.Nopolymorphismwasseen
inalltheisolatesbelongtosensitiveallelewhereasSNPsweredetectedin
the codon 200 of the two isolates belong to resistant allele and transformationofphenylalanine(TTC)totyrosine(TAC)atthiscodonwasdeterminedinbothisolates.Theisolatesbelongtosensitiveandresistantalleles
werealsodepositedtotheGenBank.
In conclusion, molecular prevalence and genetic characterization of H.
contortus
study. Benzimidazole resistance was molecularly detected in H.contortus
populationsintheresearchareaandalsoriskfactorsweredeterminedby
revealing the sensitive and resistant allele frequencies. The obtained
resultsfromthisstudy revealedthatrevisingthetreatmentanddisinfection methods in terms of resistant H.contortus population dynamics and
alsoproducingnewalternativestrategiesareessential.
Anahtar kelimeler: Benzimidazol dirençliliğ i, Haemonchus
contortus,koyun,molekü lerkarakterizasyon,realtimePCR
Keywords:Benzimidazoleresistance, Haemonchuscontortus,
sheep,molecularcharacterization,realtimePCR
ikiizolatınβtubulinizotip-1genbö lgesinin200.kodonundateknü kleotid
46
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
TEZÖZETLERİ
KARNOZİNİNFARKLIDOZLARININANKSİYETEÜZERİNEETKİLERİNİNSEMPATİKDERİCEVABIVE
TLABİRENTLEARAŞTIRILMASI
INVESTIGATIONOFDOSE-RELATEDEFFECTSOFCARNOSINEONANXIETYWITHSYMPATHETICSKIN
RESPONSEANDT-MAZE
HaleACER
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
FizyolojiAnabilimDalı
YüksekLisansTezi,Mayıs2014
Danışman:Prof.Dr.NazanDOLU
ErciyesUniversity,GraduateSchoolofHealthSciences
DepartmentofPhysiology
MSc.Thesis,May2014
Supervisor:Assistant.Prof.Dr.NazanDOLU
ÖZET
ABSTRACT
-alanin ve L-histidin amino asitlerinin
sinir sistemini de kapsayan memeli dokularında bulunur. Antioksidan, anti-aging ve iskemik reperfü zyon
ü zerine etkileri gö sterilmiştir. Sempatik aktivite ü zerineetkileriileilgilisınırlıçalışmavardır.Buçalışmanın
amacı, karnozinin sempatik aktivite ve anksiyeteye
etkisinielektrodermalaktivite(EDA)veyü kseltilmişT
labirentilearaştırmaktır.EDA, terbezleriniaktiveeden
sempatik deri cevabını ö lçmektedir. Deri iletkenlik
artma,artmışsempatikcevabıveanksiyeteyigö sterir.
Çalışma40sıçandagerçekleştirildi.Karnozindozları10
(dü şü k doz, n=10), 100 (orta doz, n=10) ve 1000
(yü ksekdoz,n=10)mg/kgolarakipyollaü çgrupsıçayolojik enjekte edildi. Enjeksiyondan 20 dakika sonra
sıçanlarınanksiyeteskorlarıyü kseltilmişT labirentile
sayısı ile açık kolda harcanan zaman yü zdesinin
naişareteder.
Yü ksek doz grubunda (p<0,000) açık kolda harcanan
zamanınyü zdesiveaçıkkolagirişsayısı,diğ ergruplara
grubunagö re,yü ksekdozgrubunda(t:z=-2,19,p=0,02;
f: z=-2,04, p=0,04) daha yü ksekti. Orta doz karnozin
grubunda (t: z=-2,49p=0,013; f: z=shamgrubuveyü ksekdozkarnozingrubunagö redaha
dü şü k bulundu. Gruplar arası karşılaştırmada Kruskal
Wallistesti,post-hocolarakMannWhitneyUtestikullanıldı.
EDA ve T labirent yö ntemleriyle elde edilen sonuçlara
gö re yü ksek doz karnozin (1000 mg/kg/ip), anksiyete
benzerietkileri artırmıştır.Ortadozkarnozin(100mg/
kg/ip) ise anksiyolitik etki gö stermiştir. Karnozinin
anksiyeteye ilişkin yanıtlarının, doza bağ lı etkilerine
gö redeğ iştiğ isonucunavarılmıştır.
Anahtarkelimeler: Karnozin,sempatik deri cevabı,anksiyete,sıçan,Tlabirent
Carnosineisadipeptideformedoftheaminoacidsbeta
-alanine and histidine. It is located in mammalian tissuesincludingthoseinthecentralnervoussystemand
skeletal muscles. The effects of carnosine were shown
on ischemia reperfusion injury, antioxidant and anti
aging. There are limited studies about with effects on
sympathetic activity. The purpose of this study, the
effectsofcarnosineistoinvestigateonthesympathetic
activity and anxiety with electrodermal activity (EDA)
andelevatedTlabirent.EDAmeasurestheskinconductance level (SCL) which innervating of sweat glands.
SCL is a parameter of the EDA. Increased SCL shows
thatwasraisedofsympatheticresponseandanxiety.
Thisstudywascarriedoutwith40rats.Carnosinewas
injected to three groups of rat with doses at 10 (low
dose,n=10),100(mediumdose,n=10)and1000(high
dose,n=10)mg/kg I.p.Physiologicalsalinewasinjectedtotheshamgroup(n=10).Theanxietyscoreofthe
rat were measured with elevated T maze 20 minutes
afterinjection.Then,SCLwasmeasured.Decreased the
numberoftheentryintoopenarm,percentageoftime
spent in the open arm and higher SCL indicate higher
anxiety.
Thenumberoftheentryintoopenarmandpercentage
of time spent in the open arm were lower in the high
dose group (p<0,000) than other groups. SCL was
lower in medium dose (t: z=-2,49p=0,013; f: z=-2,26,
p=0,02) of carnosine than high dose of carnosine and
shamgroup.SCLwashigherinhighdosegroup(t:z=2,19,p=0,02;f:z=-2,04,p=0,04)thanmediumdoseand
sham group. Comparisons between groups, Kruskal
Wallistest,MannWhitneyUtestwasusedforpost-hoc
analysis.
High dose carnosine (1000 mg/kg/ip) increases anxiety-likeeffectsforassessedintheSCLandTmazeparadigms.Mediumdosecarnosine(100mg/kg/ip)showed
anxiolytic effect. The anxiety related responses of carnosine is deduced that depend on its dose-related effect.
Key words: Carnosine, sympathetic skin response, anxiety, rat, Tmaze
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
47
TEZÖZETLERİ
TAVŞANLARDAANTİGLOKOMATÖZİLAÇLARINGÖZİÇİBASINCIVEORBİTALKANAKIMIÜZERİNE
ETKİLERİNİNARAŞTIRILMASI
EFFECTSOFTOPICALANTIGLAUCOMATOUSDRUGSONINTRAOCULARPRESSUREANDOCULARBLOOD
FLOWINRABBİTS
ZaferDOĞAN
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
VeterinerCerrahiAnabilimDalı
DoktoraTezi,Mayıs2014
Danışman:Doç.Dr.MuratKİBAR
ErciyesUniversity,GraduateSchoolofHealthSciences,
DepartmentofVeterinarySurger
PhD.Thesis,May2014
Supervisor:Assoc.Prof.Dr.MuratKİBAR
ÖZET
ABSTRACT
Bu çalışmanını amacı sağ lıklı tavşanlarda topikal olarak
uygulanantravoprost/timololkombinasyonuvebukombinasyonda yer alan travoprost ile timololü n gö z içi ba-
To purpose of this study was to compare the effects of
değ erleriuygulama ö ncesi3gü nveilaçkesildiktenson-
was mesaured in both eyes using a colour Doppler imaging(CDI)1weekpriortothetreatmentandlastdayof
the treatment. Peak systolic velocitities (PSV), enddiastolicvelocities(EDV),resistiveindices(RI),pulsatile
indices(PI)andmeanvelocities(Vmean)werealsomeasuredandrecorded.
maktı.
Çalışmada,kırkikiadetYeniZellandaırkıtavşankullanıldı.Butavşanlarü çgrubaayrıldı.Grup1’detravoprost(%
0,004),grup2’detimolol(%0.5)vegrup3’detravoprost/
timolol kombinasyonu topikal olarak uygulandı. Tü m
gruplarda sağ gö zlere ilaç, sol gö zlere ise %0.09 NaCl
(kontrol) damlatıldı. Travoprost ve travoprost/timolol
gruplarındagü nde1defasaat08:00’de,timololgrubunda
ise gü nde iki defa 08:00 ve 20:00’de olmak ü zere 6 gü n
boyuncailaçuygulandı.Gö ziçibasıncıö lçü mlerirebound
tonometre kullanılarak 08:00, 10:00, 14:00 ve 20:00’de
maya başlamadan 1 hafta ö nce ve uygulamanın 6. gü nü ter’den pik sistolik hız (PSH), diyastol sonu hız (DSH),
rezistif indeks (RI), pulsatil indeks (PI) ve ortalama hız
(Vort)değ erlerialındı.
Travoprost, timolol ve travoprost/timolol gruplarının
istatistiksel olarak anlamlı fark gö zlenmedi (p>0.05).
Ancak timololü n diğ er iki ilaca gö re daha hızlı bir dü şü ş
sağ ladığ ı (p<0.05) gö rü ldü . Travoprost ve travoprost/
timololgruplarınınisetimololekıyasladahauzunsü reve
tedavi sonrası ö lçü len PSH, DSH, RI, PI ve Vort değ erlerinin gruplararsı değ erlendirilmesinde fark gö rü lmedi
uygulama ö ncesi, uygulama sonrası ve kontrol grupları
ilekarşılaştırıldığ ındasadecetravoprostgrubununRIve
PI değ erlerinde istatistiksel olarak anlamlı bir artış saptandı(p<0.05).
Sonuç olarak travoprost, timolol ve travoprost/timolol
dü şü şü sağ ladığ ı(p<0.05)tespitedildi.Akutglokomlarda
dakullanılabileceğ ikanısınavarıldı.Tavşanlardakullanılan antiglokomatö z ilaçlardan timolol ve travoprost/
timolol kombinasyonunun siliyer arter RI değ eri ü zerinde, istatistiksel olarak anlamlı bir artış oluşturmadıklarından sağ altımda gü venle kullanılabileceğ i kanaatine
varıldı.
Anahtarkelimeler:
tavşan,timolol,travoprost
48
nationontheintraocularpressure(IOP)andocularblood
Fourty two New Zealand white rabbits were randomly
dividedintothreegroupstoreceive:travoprost(0.004%)
(group 1), timolol (0.5%) (group 2), and combination of
travoprost/timolol (group 3). All drugs were instilled to
therighteyeoftherabbitswhile,thelefteyeswereadministrated %0.09 NaCl (control). Travoprost and travoprost/timolol was applied topically once a day at 8 AM
whilst,timololwasgiventwiceadayat8 AMand8PMfor6
days. The IOP measurements were performed by using
reboundtonomterat8 AM,10AM,14PMand8PMduringthe
5 days of the treatment, 3 days before and 3 days after
of travoprost, timolol and travoprost/timolol combinationonIOP(p>0,05).However,theeffectoftimololdecreased more rapidly than the other two drugs (p<0.05).
On the other hand, travoprost and travoprost/timolol
groups provided longer and more permanent IOP drop
compared to timolol. No differences were obtanined for
themeanPSV,EDV,RI,PIandVmeanmeasuredbeforeand
aftertreatmentamongthegroups.Whencomparedwith
thetravoprostgroup(p<0.05).
Asaresult,theeffectsoftravoprost,timololandtravoprost/timolol combination were similar in all groups;
however, timolol exhibited a more rapid IOP drop than
theotherdrugs.Itcanbeconcludedthat,inanacutecase
ofglaucoma,timololcanbeusedforarapidIOPdropin
rabbits.As,thetopicaltreatmentwithtimololandtravoprost/timolol combination in rabbits does not alter the
felyinthetreatmentofglaucoma.
Key words: Colour doppler imaging, glaucoma, rabbit, timolol,travoprost
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
TEZÖZETLERİ
ERCİYESDAĞIAKARSULARINDASİMULİUMTÜRLERİNİNARAŞTIRILMASIVEMOLEKÜLERKLASİFİKASYONU
INVESTIGATIONANDMOLECULARCLASIFICATIONOFSIMULIUMSPECIESINTHESTREAMSOFERCIYES
MOUNTAIN
AhmetDEMİRCİOĞLU
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
VeterinerParazitolojiAnabilimDalı
YüksekLisansTezi,Haziran2014
Danışman:Prof.Dr.AbdullahİNCİ
ErciyesUniversity,GraduateSchoolofHealthSciences
DepartmentofVeterinaryParasitology
MSc.Thesis,June2014
Supervisor:Prof.Dr.AbdullahİNCİ
ÖZET
ABSTRACT
Bu çalışma, Erciyes dağ ı akarsularında simuliid tü rlerinin
molekü ler karakterizasyonunun yapılması amacıyla planlanmıştır.BuamaçlaMayıs-Eylü l2012tarihleriarasındaErciyes
dağ ı akarsularında ü ç istasyondan toplam 100 adet simuliid
larva ö rneklemesi yapılmıştır. Toplanan larvaların ö nce morfolojik ve kromozomal incelemeleri yapılmış daha sonra
molekü leranalizegeçilmiştir.Morfolojikvekromozomalanalizlerilearaştırmayö resindentoplanan100larvanın20’sinin
S. bezzi sitoform (Cyt) 2, 20’sinin S. bezzi Cyt 3, 50’sinin S.
ornatum grup ve 10’unun ise S. velutinum olduğ u tespit
edilmiştir. Molekü ler analizler için ö rnekleme istasyonlarından seçilmiş toplam 4 larvadan genomik DNA ekstraksiyonu
yapılmış ve elde edilen DNA’lar parsiyel mitokondriyal cytochrome oxidase subunit 1 ve ribosomal parsiyel 5.8S, complete internal transcript spacer 2 ve parsiyel 28S gen bö lge-
Thisstudywascarriedouttodeterminethemolecularcharacterization of simuliid species in Strems of Erciyes Mountain.
ForthisaimbetweenMay-September2012,totally100simuliid larvae collected from three collection sites. Morphological
andchromosomalexaminationwasperformedbeforemolecular analyzes in collected larvae. 20 Simuliumbezzi cytoform
(Cyt)2,20 S.bezziCyt3,50S.ornatumgroupand10S.velutinumfromtotally100larvaeweredeterminedbymorphologicalandchromosomalexamination.Formolecularanalysesthe
genomic DNA extractions were utilized on 4 larvae selected
fromsampledareaandPCRanalyseswereperformedwiththe
oxidase subunit 1and ribosomal partial 5.8S,complete internaltranscriptspacer2andpartial28Sgeneregions.Sequence
analyses of the isolates were done with PCR primers after
MtS.bezziicytoform 2 ve cytoform 3 izolatları arasında %0,8 farklılık
saptanmıştır.S.bezziiveS.ornatumgrupizolatlarıarasında%
9,6±1,2, S. bezzii ve S. velutinum arasında 13,9±1,4 ve S. ornatum grup ve S. velutinum izolatları arasında ise %13,5±1,4
genetikfarklılıktespitedilmiştir.Ribozomal5.8S,ITS-2ve28S
gen bö lgelerinin nü kleotid sekansları sonucunda S. bezzii
(TrERUSimbe3) Dü nyada ilk kez karakterize edilmiştir. TrERUSimbe3 izolatı GenBank’ta ilgili gen bö lgesi yö nü nden
kayıtlıSimulium
%96,2 ile S. ornatum grubuna dâ hil izolatlarla gö stermiştir.
Araştırma yö resinde karakterize edilen S. ornatum grup TrERUSimorizolatıiseenyü ksekidentikliğ i%99,7ileaynıgrupta
yer alan S. trifasciatum ve S. ornatum izolatları ile
gö stermiştir. S. bezzii TrERUSimbe3 ve S. ornatum grup TrERUSimor izolatları arasında ise %3,7±1,0 genetik farklılık
belirlenmiştir. Sonuç olarak bu çalışma ile Tü rkiye’de ilk kez
Erciyes dağ ı akarsularında Simulium tü rlerinin morfolojik,
kromozomalvemolekü lerkarakterizasyonlarıyapılmıştır.Bu
çalışmaylaTü rkiye’deilkkez S.bezzicyt2,S.bezzicyt3,S.velutinum ve S. ornatum izolatlarının mitokondriyal gen bö lge-
were done and performing multiple alignments between the
obtained isolates and other similar isolates from the world
completed phylogenetic analyses. The pairwise analyses betweentheS.bezziCyt2andCyt3isolatescharacterizedbyMtCOI sequences showed 5.3±0.6% genetic difference. The genetic difference between S. bezzii and S. ornatum group, S.
bezzii and S. velutinum, S. ornatum group and S. velutinum
isolates were determined as 9,6±1,2%, 13,9±1,4% and
13,5±1,4%, respectively. S.bezzii (TrERUSimbe3) isolate was
-2
and25Sgeneregion.Themaximumidentityratesbetweenthe
TrERUSimbe3 isolate and S.ornatum group isolates within
Simuliumisolatesfromtheworldweredeterminedas96,2%
accordingtothephylogeneticanalysesofribosomal5.8S,ITS2and28Sgeneregions.S.ornatumgroupTrERUSimorisolate
showed 99,7% identitity with S.trifasciatum and S.ornatum
by phylogenetic analyses of ribosomal 5.8S, ITS-2 and 28S
gene regions. Also genetic difference between the S.bezzii
TrERUSimbe3 and S. ornatum group TrERUSimor isolates
establishedas3,7±1,0%.
In conclusion, morphological, chromosomal and molecular
characterizationofSimuliumsp.inErciyesMountainStremsin
S.
bezzi cyt2, S.bezzi cyt3, S.velutinum and S.ornatumisolates
weredonemolecularcharacterizationandexhibitedphylogenyaccordingtomt-COIgeneregionandwerealsodepositedto
the GenBank. While molecular characterization S.bezziiCyt 2
(TrERUSimbe2) and S.ornatum group (TrERUSimor) isolates
were detected according to ribosomal 5.8S, ITS-2 and 28S
generegionanddepositedtotheGenBank. S.bezziiCyt2isolatewasinitiallyrecordedtotheGenBankintheWorld.
Anahtarkelimeler:Simulidae,ErciyesDağ ı,larva,molekü lerkarakterizasyon
Key words:
tion,simuliidae
gerçekleştirilmiştir. Elde edilen izolatların GenBank kayıtları
yapılmış ve dü nyadaki benzer izolatlar ile Multiple align-
konmuşveGenBankkayıtlarıgerçekleştirilmiştir.Aynızamanda araştırma yö resinden izole edilen S. bezzii Cyt 2
(TrERUSimbe2) ve S. ornatum grup (TrERUSimor) izolatlarının ribozomal gen bö lgesine gö re molekü ler analizleri
sonucunda karakterizasyonları yapılarak GenBank kayıtları
gerçekleştirilmiş ve S. bezzii Cyt 2 izolatının ribozomal ITS-2
gen bö lgesi Dü nya’da GenBank’a kayıdı gerçekleştirilen ilk
izolatolmuştur.
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
49
TEZÖZETLERİ
AVANOSYÖRESİSOKAKKÖPEKLERİNDE
’inPCRİLEARAŞTIRILMASI
INVESTIGATIONOF
INSTRAYDOGSBYPCRTECHNIQUEINAVANOSPROVINCE
FerayYABANERİ
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
VeterinerParazitolojiAnabilimDalı
YüksekLisansTezi,Haziran2014
Danışman:Prof.Dr.AbdullahİNCİ
ErciyesUniversity,GraduateSchoolofHealthSciences,
DepartmentofVeterineryParasitology
MSc.Thesis,June2014
Supervisor:Prof.Dr.AbdullahİNCİ
ÖZET
ABSTRACT
enfeksiyonlarınyayılışınıtespitetmekamacıylaMayısEylü l2013tarihleriarasındatoplam138kö pekteyapılmıştır.Buamaçlaalınanherkanö rneğ iö nceliklenatif,
sonraPolimerazZincirReaksiyonu(PCR)’natabiitutu-
miştir. Kan ö rneğ i alınan kö peklerin yaş, cinsiyet ve
ırkları kayıt altına alınmıştır. Yapılan analizler sonucu
Avanos yö resindeki 138 kö peğ in 3’ü (%2.17)
ria immitis
todenfeksiyonlarınarastlanmamıştır.Pozitifbulunan3
ö rneğ in 2’si natif yö ntem, modiye knott yö ntemi ve
Konvansiyonelyö ntemlerlepozitifbulunan2ö rnekde
dahilolmakü zeretoplam3ö rnekPCRtekniğ iilepozitif
bulunmuştur.D. immitis
de yavaş ve yılanvari hareket edip mikroskop sahası
yö ntemlerindekılıfsız,ö nkısmınınkonikbiçimdesivrilerek sonlanıp kuyruklarının dü z olduğ u saptanmıştır.
5.8S-ITS2-28S ve cytochrome oxidase subunit 1 (COI)
primerler ile yapılan PCR sonucu pozitif belirlenen ve
edilerekherikigenbö lgesiiçinçiftyö nlü sekansanalizlerine tabii tutulmuştur. Elde edilen sekans dizilimleri
ilgiligenbö lgeleriyö nü ndenblastnkıyaslamasıyapılan
GenBankveritabanındakayıtlıDü nya'dakidiğ erbazıD.
immitis
lizleri ve pairwise kıyaslamaları yapılmıştır. Yapılan
analizlersonucuAvanosyö resindeneldeedilen D. immitis izolatının 5.8S-ITS2-28S gen bö lgesinin pairwise
kıyaslamalarınagö redü nyadanalignmentadahiledilen
diğ erizolatlarla%99.5-%100oranlarında,parsiyelCOI
genbö lgesininpairwisekıyaslamalarınagö reise%94.3
-%100oranlarındaidentiklikgö sterdiğ ibelirlenmiştir.
Sonuç olarak, bu çalışma ile Avanos yö resi sokak kö peklerindeilkkezD. immitisenfeksiyonlarınınmolekü ler prevalansı belirlenmiş ve elde edilen izolatın 5.8SITS2-28S ve COI gen bö lgelerinin molekü ler karakteri-
Anahtar kelimeler:
prevalans,molekü lerkarakterizasyon,Avanos
50
This study was carried out between May-September
blood samples were examined by wet mount (direct
ase Chain Reaction techniques in order to detect the
sex and breed of dogs were recorded. Three (%2.17)
outof138dogbloodsampleswerefoundtobe
laria immitis
were foundin Avanos and vicinity. Two out of 3 positive samples were found by wet mount (direct microfoundpositivebyonlyusingPCRtechnique.ThemicroD.immitis observed to exhibit sluggish and
laries determined to be unsheathed, tapered conically
from the anterior extremity and straight tailed. GenomicDNAsfrombloodsampleswereanalyzedbyPCR
nit1(COI)and5.8S-ITS2-28Sgeneregions.Theampli-
the same primers. Pairwise analyses of the obtained
DNA sequences and multiple alignments with some
otherD. immitisstrainsfromdifferentgroupsavailable
intheGenBankweredoneandphylogenieswereinvestigated.TheidentityratesbetweentheobtainedD. immitisisolateandotherisolatesformtheworldwasdetermined as 99.5%-100% and 94.3%-100% according
to the phylogenetic analyses of 5.8S-ITS2-28S and COI
generegions,respectively.
In conclusion, the molecular prevalence of D. immitis
and the molecular characterization and phylogenetic
analyses of 5.8S-ITS2-28S and COI gene regions of the
obtainedisolatewereinvestigatedwiththisstudy.
Key words:
molecularcharacterization,Avanos
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
TEZÖZETLERİ
KAYSERİYÖRESİNDEKİSIĞIRLARDANTOPLANMIŞKENETÜRLERİNDEBABESIABOVISVEBABESIABIGEMINA’NINREALTİMEPCRYÖNTEMİİLEARAŞTIRILMASI
INVESTIGATIONOFBABESIABOVISANDBABESIABIGEMINAINTICKSPECIESCOLLECTEDFROMCATTLEIN
KAYSERIPROVINCEBYREALTIMEPCR
TugbaMEYILLI
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
VeterinerParazitolojiAnabilimDalı
YüksekLisansTezi,Haziran2014
Danışman:Yrd.Doç.Dr.ÖnderDÜZLÜ
ErciyesUniversity,GraduateSchoolofHealthSciences
DepartmentofVeterinaryParasitology
MSc.Thesis,June2014
Supervisor:Assist.Prof.Dr.OnderDUZLU
ÖZET
ABSTRACT
Bu çalışma, Kayseri yö resindeki sığ ırlardan toplanmış ergin
ixodid kenelerden oluşturulan DNA havuzlarında Babesia
bovisve B.bigemina’nın Real Time PCR ile araştırılması ve
saptanan izolatların molekü ler karakterizasyonlarının belirlenmesi amacıyla yapılmıştır. Bu amaçla, daha ö nce Erciyes
Thisstudywascarriedouttoinvestigate BabesiabovisandB.
bigemina in genomic DNA pools consisted from adult ixodid
tickscollectedfromcattleinKayseriregionbyRealTimePCR
and to determine the molecular characterization of the isolates. For this aim, the concentrations of the obtained DNA
pools consisted fromtotally 1115adultixodid ticks collected
from cattlewitha previous project called “MolecularBiologicalDiagnosisofCattleTheileriaandBabesiaspeciesinVector
“Sığ ırlarda Gö rü len Theileria ve Babesia Tü rlerinin Vektö r
Kenelerde Molekü ler Biyolojik Teşhisi” isim ve 2824 koduyla
desteklenmiş araştırma projesi kapsamında sığ ırlardan toplanmıştoplam1115erginixodidkenedenoluşturulmuşgenomik DNA havuzlarının nanodrop spektrofotometre ile konsantrasyonlarıbelirlenmişvemolekü leranalizleriçinoptimal
konsantrasyonlar hazırlanmıştır. Genomik DNA ekstraktlarının B.bovisveB.bigemina için sırasıyla msa2c ve rap-1 gen
TaqManprobbazlıRealTimePCRanalizlerigerçekleştirilmişde (%21,0) B.bigemina,2’sinde (%5,2) B.bovis
mıştır. B. bigemina pozitif ö rneklerin 4’ü Rhipicephalus
(Boophilus)annulatus, 1’i Hyalommamarginatummarginatum,
2’si Rhipicephalusturanicus ve 1’i H.anatolicumanatolicum
havuzlarında saptanırken, B.bovis pozitif ö rneklerin her ikisi
de H.m.marginatum havuzunda tespit edilmiştir. Ct (dR) değ erleriB.bovispozitifö rneklerdeortalama37,71,B.bigemina
pozitifö rneklerdeise35,75saptanmıştır.Molekü lerkarakterizasyon amacıyla pozitif belirlenen ö rneklerde B.bovis ve B.
bigeminaiçinsırasıylamsa2cverap-1agenbö lgeleriniampliPCR analizleriyapılmıştır. B.bovispozitif izolatlarda parazite-
belirlenemezken, B.bigemina pozitif 8 ö rnekten ise sadece
2’sinin agaroz jel ü zerinde sekans analizleri için uygun DNA
ler için sekanslanmıştır. B. bigemina izolatlarının
(BbigrapKys1-BbigrapKys2)rapanalizi sonucunda kendi aralarında %100 identiklik, dü nyadan alignmenta dahil edilen diğ er izolatlarla aralarında %
1,0±0,5veTü rkiye’dendahaö ncegirilmişizolatlarlaaralarında%0,7±0,4genetikfarklılıkbelirlenmiştir.
Sonuçolarakbu çalışmaile Kayseri yö resindeki sığ ırlarından
toplanmışkenelerdenoluşturulmuşgenomikDNAhavuzlarında B.bovisve B.bigemina’nın varlığ ı ve yaygınlığ ı, diğ er moleoldukçayü ksekolanRealTimePCRtekniğ iileortayakonmuştur.EldeedilenCt(dR)değ erlerinegö reenfektesığ ırlardaher
ikitü rü ndedü şü kparazitemiyesahipolduğ ugö rü lmü ştü r.Bu
açıdan ö zellikle rezervuar hayvanların ortaya konmasında
Real Time PCR’ın oldukça avantajlı ve gü venilir bir yö ntem
olduğ udikkatiçekmiştir.Ayrıcabuçalışma,Tü rkiyevedü nyada B.bovisve B.bigemina’nın kenelerde Real Time PCR ile
araştırıldığ ıilkçalışmadır.
Anahtar kelimeler: Babesia bovis, Babesia bigemina, kene,
RealTimePCR,molekü lerkarakterizasyon,Kayseri
Fund (EUBAP-Project Number 2824) were analyzed by
nanodrop spectrophotometry and optimal concentrations
were prepared for the molecular analyses. Sybergreen and
TaqManprobebasedrealtimePCRanalyseswerecarriedout
withB.bovisandB.bigemina
plify msa-2c and rap-1a gene regions, respectively. Totally 8
(21.0%) and 2 (5.2%) of the 38 genomic DNA pools were
foundtobeinfectedwithB.bigeminaandB.bovis,respectively.Nomixinfectionwasdetectedintheexaminedsamples.Of
theB.bigeminapositivesamplesfour,one,twoandonewere
determinedinRhipicephalus(Boophilus)annulatus,Hyalomma
marginatum marginatum, Rh. turanicus and H. anatolicum
anatolicum pools whereas both two positive B. bovis samples
were detectedin H.m.marginatum pools. The Ct(dR) values
weredeterminedasaverage37.71and35.75inB.bovisandB.
bigemina positive samples, respectively. For the molecular
analyses, conventional and nested PCR analyses were performed with B. bovis and B. bigemina
whichamplifymsa-2candrap-1generegionsinpositivesamples.Itwasdetectedthat2of8for B.bigeminapositivesamforsequenceanalysesandnoB.bovispositivesamplesshowed
suitable DNA bands because of the weak parasitemia level.
These isolates were sequenced with respect to rap-1a gene
cordingtothephylogeneticanalysesofrap-1ageneregionof
B. bigemina isolates (BbigrapKys1-BbigrapKys2), 100.0%
identitywitheachotherandaverage1,0±0,5%,and0,7±0,4%
geneticdistanceweredetectedwithsomeotherisolatesinthe
worldandinTurkey,respectively.
In conclusion, the presence and prevalence of B. bovis and B.
bigeminaingenomicDNApoolsconsistedfromtickscollected
from cattle from Kayseri province were exhibited by Real
other molecular based diagnostic techniques, in this study.
AccordingtotheCt(dR)values,itwasseenthatboth B.bovis
and B. bigemina species have low parasitemia in cattle. Real
TimePCRtechniquewasfoundtobequiteadvantageousand
reliableinthediagnosisofreservoiranimals.Inaddition,this
lecularinvestigationofB.bovisandB.bigeminainticksbyReal
TimePCR.
Key words: Babesia bovis, Babesia bigemina, tick, Real Time
PCR,molecularcharacterization,Kayseri
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
51
TEZÖZETLERİ
KAYSERİYÖRESİNDENTOPLANMIŞCULEXPIPIENS(DIPTERA:CULICIDAE)TÜRLERİNİNBESLENME
EĞİLİMLERİNİNMOLEKÜLERYÖNTEMLERLESAPTANMASI
BLOODMEALIDENTIFICATIONOFCX.PIPIENS(DIPTERA:CULICIDAE)COLLECTEDFROMKAYSERİPROVINCE
BYMOLECULARTECHNIQUES
SevalKORKMAZ
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
VeterinerParazitolojiAnabilimDalı
YüksekLisansTezi,Haziran2014
Danışman:Prof.Dr.AlparslanYILDIRIM
ErciyesUniversity,GraduateSchoolofHealthSciences,
DepartmentofVeterineryParasitology
MSc.Thesis,June2014
Supervisor:Prof.Dr.AlparslanYILDIRIM
ÖZET
ABSTRACT
Molekü lerBiyolojikTanısıveKayseriYö resindeVektö rSivri-
tırma projesi kapsamında Kayseri yö resinden toplanmış ve
uygun şartlarda muhafaza edilmiş olan sivrisinekler ü zerinde yü rü tü lmü ş olup çalışmada Cx.pipiens tü r kompleksinin
molekü lerkarakterizasyonuveergindişilerinkanbeslenmesinde konak tercihleri ile konak spekturumlarının ortaya
konması amacıyla planlanmıştır. Bu amaçla toplam 1284
ergin dişi sivrisinek morfolojik olarak incelenmiş ve 376’sı
(%28,4) Cx.pipiens olarak teşhis edilmiştir. Ergin dişi Cx.
pipiens ö rneklerinden genomik DNA ekstraksiyonu yapılmış
ve mitokondrial cytochrome oxidase I (mt-COI) gen bö lgesi
amacıylasekanslanmıştır.Parsiyelmt-COInü kleotidsekansları ortaya konan TrERUCxpip01 (GenBank aksesyon:
KJ858517) ve TrERUCxpip02 (GenBank aksesyon:
KJ858518) izolatlarının pairwise analizleri sonucu %100,0
identikolduklarıbelirlenmiş,Dü nyanınfarklıbö lgelerinden
GenBank’a kayıtlı diğ er Cx.pipiens izolatlarıyla ise ortalama
%0,3±0,1 genetik farklılık gö sterdiğ i tespit edilmiştir. Ergin
dişi Cx. pipiens ö rneklerinden bireysel olarak elde edilen
genomik DNA’lar kanatlı ve memeli mitokondrial cyt b gen
analizleri gerçekleştirilmiş ve toplam 376 ö rneğ in 148’i (%
39,4) kanatlı ve/veya memeli kanı yö nü nden pozitif bulunmuştur. Pozitif belirlenen ö rneklerin toplam 43’ü yalnızca
memeli, 98’i yalnızca kanatlı, 7’si ise hem kanatlı hem de
memeli kanı yö nü nden pozitif belirlenmiştir. Beslenme eğ ilimlerininistatistikselanalizindeCx.pipiensiçinkanatlıtercihiö nemlibulunmuştur(p<0,05).Konakkanıyö nü ndenpozitifbelirlenenö rneklerdenkanatlı için15,memeliiçinde15
izolatklonlandıktansonrakonaktü rü tayiniiçineldeedilen
plasmidlersekansanalizinetabiitutulmuştur.Plasmidlerden
elde edilenmt-cyt bsekanslarınınGenBank’ta blastn analiz-
konak kanı pozitif 15 izolattan 9’unun Passeriformes takımında, 3’ü nü n Accipitriformes, 2’sinin Columbiformes ve
birinin de Strigiformes takımında yer alan kanatlı tü rlerindenkanemdiğ ibelirlenmiştir.Memelikonakkanıpozitif15
izolattanise6’sıinsan,4’ü sığ ır,3’ü koyun,2’sidekö pekkanı
pozitifsaptanmıştır.
Sonuçolarakbuçalışmaile Tü rkiye’deilkkez Cx.pipienstü r
kompleksi ü zerine morofolojik ve molekü ler analizler bir
mesinde konak tercihi ve spekturumunun belirlenmesine
yö nelikbilimselverilereldeedilmiştir.
Anahtar kelimeler: Cx. pipiens, vektö r, ekoloji, molekü ler
teşhis,Kayseri
52
Thisstudywasconductedonthemosquitospecimenswhich
were collected within the scope of the TUBITAK research
project titled “Molecular Biological Diagnosis of
immitis in Vector Mosquitoes and The Ecology of Vector
MosquitoesinKayseriProvince”withprojectcode107O533
andpreservedsuitableconditions.Thestudywasperformed
todeterminethemolecularcharacterizationand,blood-meal
analyses and host spectrum of the Cx.pipiensspecies complexcollectedfromKayseriregion.Forthisaimtotally1284
female adult mosquito specimen were morphologically anaCx.pipiens. Genomic DNAs were extracted from the individual Cx.pipiens
specimensandmithocondrialcytochromeoxidaseI(mt-COI)
lar characterization and phylogenetic analyses. The isolates
TrERUCxpip01 (GenBank accession: KJ858517) and TrERUCxpip02(GenBankaccession:KJ858518)whichthenucleotide sequences were determined showed 100.0% identity
toeachotherand0.3±0.1geneticdifferencewasfoundwith
the other Cx. pipiens isolates from several regions in the
worldavailableintheGenBank.ThegenomicDNAsobtained
from individual Cx.pipiensspecimens were also PCR ana-
malian mithocondrial cyt b gen region. 148 (39.4%) out of
376 specimens were found to be positive for avian and/or
mammalian blood-meal. 43, 98 and 7 of the positive specimens were found as only mammalian, only avian and both
avianandmammalianblood-meal.Thestatisticalanalysesof
host tendency in blood-meal revealed that avian preference
was more important for the Cx.pipiens (p<0.05). Each 15
blood-meal positive specimens for avian and mammalian
hosts were selected and cloned, and the obtained plasmids
weresequencedinordertodeterminethehostspecies.The
mt-cytb sequences obtained from the plasmids were analyzedbyblastnintheGenBankandhostspeciesweredetermined.9,3,2and1outofthe15avianblood-mealpositive
isolates were found to blood feed from the avian species in
the Passeriformes, Accipitriformes, Columbiformes and
Strigiformes orders, respectively. 6, 4, 3 and 2 out of mammalian blood-meal positive isolates were determined to
bloodfeedfromhumans,cattle,sheepanddogs,respectively.
phylogeny, host preference and spectrum in blood-meal of
the Cx.pipiens
timeinTurkeywiththisstudy.
Keywords:Cx.pipiens,vector,ecology,moleculardiagnosis,
Kayseri
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
TEZÖZETLERİ
ORTAÖĞRETİMÖĞRENCİLERİNİNFİZİKSELAKTİVİTEVEFİZİKSELUYGUNLUKDÜZEYLERİNİNİNCELENMESİ
THEEVALUATIONOFSECONDARYSCHOOLSTUDENTSPHYSICALACTIVITYANDPHYSICALFITNESSLEVEL
KenanKOÇ
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
BedenEğitimiVeSporBilimleriAnabilimDalı
YüksekLisansTezi,Mayıs2014
Danışman:Doç.Dr.YahyaPOLAT
ErciyesUniversity,GraduateSchoolofHealthSciences
DepartmentofPhysicialEducationandSport
M.Sc.Thesis,May2014
Supervisor:Doç.Dr.YahyaPOLAT
ÖZET
ABSTRACT
mesi amaçlanmıştır. Araştırmaya 15 yaş grubunda 30,
16yaşgrubunda37ve17yaşgrubunda33olmakü zere toplam 100 erkek ö ğ renci, 15 yaş grubunda 34, 16
yaş grubunda 35 ve 17 yaş grubunda 31 olmak ü zere
toplam 100 bayan ö ğ renci, gö nü llü olarak katılmıştır.
Gö nü llü lerin ağ ırlık, boy, dikey sıçrama, 30 m. sprint,
max. VO2, esneklik ve toplam enerji kaybı, beden kitle
indeksi,esneklik,aktivitedü zeyleri,vü cutyağ yü zdesi,
sağ ve sol pençe kuvveti parametreleri ö lçü lmü ştü r.
Gö nü llü lerinö lçü lendeğ erleriSPSSadlıpaketprogram
aracılığ ı ile bağ ımsız ‘t’ ve One Way ANOVA testleri
uygulanarakhesaplanmıştır.
Erkek gö nü llü lere ait beden kitle indeksi, max.VO2, 30
aktivitedü zeyi,sağ vesolpençekuvvetleriparametrelerinde gruplar arası anlamlı farklılıklara rastlanmamıştır (p>0.05). Erkek gö nü llü lerinağ ırlık, boy,esneklik ve toplam kalori kaybı parametrelerinde gruplar
arasıanlamlıfarklılıklararastlanmıştır(p<0.05,p<0.01
vep<0.001).Toplamenerjikaybı,ağ ırlıkveboydeğ erlerininyaşartışınaparalelolarakartışgö sterdiğ igö rü lmektedir. Esneklik değ erlerinde ise yaş artışına bağ lı
olarakö nemliazalmalarbulunmuştur.Erkekgö nü llü lerin aktivite dü zeylerinin incelendiğ inde anlamlı farklılıklar bulunamazken, yaş artışına bağ lı olarak kalori
kaybınınarttığ ıgö rü lmektedir.
Kızgö nü llü lereaitağ ırlık,bedenkitleindeksi,esneklik,
aktivitedü zeylerivevü cutyağ yü zdesiparametrelerinde gruplar arası anlamlı farklılıklara rastlanmamıştır
(p>0.05).Kızgö nü llü lerinboy,esneklikvetoplamenerji
kaybı parametrelerinde gruplar arası anlamlı farklılıklara rastlanmıştır (p<0,05, p<0,01 ve p<0,001). Dikey
sıçrama, 30 m. Sprint, boy, Max.VO2, sağ ve sol pençe
kuvveti parametrelerinde bü yü meye paralel lineer bir
artışgö zü kmektedir.Kızgö nü llü lerinfarklıyaşgruplarında aktivite dü zeyleri ve toplam kalori kayıplarının
incelenmesi sonucunda ö nemli farklılıklar bulunamamıştır(p<0.05).Sonuçolarak;Erkekçocuklarınesneklik
değ erleri bü yü me arttıkça azalma eğ iliminde iken, diğ er parametrelerde artış gö zlenmektedir. Kız çocukların ö lçü len parametrelerinde ise doğ rusal bir artış ya
daazalışgö rü lmemektedir.
Anahtarkelimeler:
ö ğ retim
This research aims to investigate the level of physical
convenience and the level of physical activity of the
students in secondary school.100 schoolboys and 100
schoolgirls have participated in the research voluntarily. Among 100 schoolboys, there are 30 boys at the
age of 15,37 boysat the age of16 and 33 boys at the
ageof17.Among100schoolgirls,thereare34girlsat
theageof15,35attheageof16and31attheageof17.
Volunteersweights,heights,verticaljump,30msprint,
levels, the parameters of right and left pounce power
have been measured. Free “t” and One Way ANOVA
testshavebeenappliedbySPSSprogramforthemeasured values of volunteers.According to male volunteers’ body mass index ,body fat percentage , max. Vo2,
30metressprint,verticaljump,physicalactivitylevel,
rightandleftpouncepowerparameters,therewereno
However, according to malevolunteers’ parametersof
and p<0.001). It has been seen that the values of the
loss of total energy, weight and height have increased
inparaleltotheincreaseintheage.Ontheotherhand;
withage.Analyzingtheactivitylevelsofmalevolunte-
theincreaseinagehasincreasedenergyloss.According
tofemalevolunteers’parametersofweight,bodymass
groups (p>0.05). However; according to female volun(p<0,05,p<0.01andp<0.001).Ontheotherhand,there
has been seen a paralel linear increase to growing in
the parameters of vertical jump, 30 m. sprint, height,
max VO2, right and left pounce power. Girls activity
levels in different age groupsof volunteers and examinot be detected (p<0.05).In conclusion, regarding the
tend to decrease, other parameters tend to increase.
Therehasn’tbeenseenalinearincreaseordecreasein
themeasuredparametersoftheschoolgirls.
Key words:
school
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
53
TEZÖZETLERİ
DİYABETLİYAŞLILARDAAYAKBAKIMINIGELİŞTİRMEDEEĞİTİMVEİZLEMİNETKİSİ
EFFECTOFEDUCATIONANDMONITORINGONDEVELOPINGFOOTCAREOFELDERLYWITH
DIABETESMELLITUS
SaadetCANÇİÇEK
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
HemşirelikAnabilimDalı
DoktoraTezi,Mayıs2014
Danışman:Prof.Dr.FerayGÖKDOĞAN
ErciyesUniversity,GraduateSchoolofSciences,
DepartmentofNursing
PhD.Thesis,May2014
Supervisor:Prof.Dr.FerayGÖKDOĞAN
ÖZET
ABSTRACT
Diyabetikayakmortalitevemorbiditeyiarttıran,yaşam
kalitesinidü şü ren,ağ ırişgü cü veorgankayıplarınayol
açan, iyileşme sü reci uzun olan ö nemli komplikasyonlardan biridir. Diyabetli yaşlılarda periferik nö ropati,
ayakdeformiteleriveperiferikarteryalhastalıklarbaşta olmak ü zere yaşa bağ lı gö rme yetersizliğ i, yü rü me
anormallikleri, hareket azlığ ı ve tıbbi hastalıklar ayak
sorunları için risk faktö rlerini oluşturmaktadır. Kontrollü deneysel nitelikteki bu araştırma, diyabetli yaşlılardaayakbakımınıgeliştirmedeeğ itimveizleminetkisini belirlemek amacıyla yapılmıştır. Araştırma Eylü l
2012 –Eylü l 2013 tarihleri arasında Bolu Valiliğ i Yaşlı
Diabetic foot is one of the important complications
increasing morbidity and mortality, deteriorating the
quality of life, leading to losses of heavy work power
ma kriterlerine uyan 45 mü dahale, 45 kontrol grubu
olmak ü zere toplam 90 diyabetli yaşlı ile yapılmıştır.
Araştırma ö ncesi hastalardan bilgilendirilmiş gö nü llü olur, kurumdan ve etik kuruldan yazılı izin alınmıştır.
Araştırma verilerinin toplanmasında “Hasta Tanıtım
Formu”, “AyakMuayeneFormu”,“DiyabetikAyakBilgi
Mü dahale grubundaki diyabetli yaşlılara başlangıçta,
birinci, ü çü ncü ve altıncı ayda ayak muayenesi yapılarakayakbakımıkonusundaeğ itimveizlemgerçekleştirilmiştir.Kontrolgrubundakidiyabetliyaşlılaraiseaynı
sıklıkta ayak muayenesi yapılmış ancak eğ itim gerçekleştirilmemiştir. Verilerin değ erlendirilmesinde t testi,
ki-kare veya Fisher kesin ki-kare testi, tekrarlı ö lçü mlerde varyans analizi ve pearson korelasyon analizi
kullanılmıştır. Ayak muayenesi yapılarak eğ itim ve
izlem yapılan diyabetli yaşlılarda izlemin başlangıcındanitibarenherö lçü mdediyabetikayakbilgi(p<0.05)
ve ayak bakımı davranış puanları (p<0.001) mü dahale
grubundaanlamlıderecededahafazlaartışgö stermiştir.Ayakmuayenetoplampuanındaisegruplararasındaanlamlıfark(p<0.05)vezamaniçinde(p<0.001),her
ikigruptabenzerdeğ işim(p>0.05)olduğ ubelirlenmiştir. Araştırmanın sonuçları, diyabetli yaşlılarda ayak
bakımınıgeliştirmedeeğ itimveizleminetkiliolduğ unu
gö stermiştir. Bu nedenle ayak bakımını geliştirmede
hemşirelik girişimleri arasında eğ itim ve izlem ö nerilmektedir.
Anahtar kelimeler: Yaşlı, diyabetes mellitus, ayak bakımı,
izlem,eğ itim,hemşire
54
cess.Beingmainlydiabeticperipheralneuropathy,foot
deformitiesandperipheralarterialdisease,age-related
visual impairment, abnormalities of walking, lack of
movementandmedicalillnessesconstituteriskfactors
for foot problems in elderly with diabetes mellitus
(DM). This controlled experimental research was conducted todetermine theeffectof educationand monitoringondevelopingfootcareinelderlywithDM.The
study was performed with 90 elderly with DM composed of 45 in control group and 45 in intervention
group who met inclusion criteria for the study within
registered elderly with DM in Governorship of Bolu
Centre of Elderly and Monitoring Unit and Diabetes
Education of Izzet Baysal State Hospital between the
dates of September 2012 - September 2013. Informed
consentfromthepatientandwrittenpermissionsfrom
organization and ethics committee were taken before
spection Form”, “Diabetic Foot Information Questionnaire (DFIQ)” and “Foot Care Behaviour Scale (FCBS)”
wereusedfordatacollection.Intheinterventiongroup,
education and monitoring were carried out about foot
carebyfootexaminationatbaseline,inthe1 st,3rdand
6thmonths.Footexaminationwasconductedtocontrol
group with the same frequency without performing
education and monitoring. T test, chi-square test or
Fisher’s exact chi-square test, variance analysis in repeated measures and Pearson correlation analysis
were used for data analysis. DFIQ (p=0.006)and FCBS
(p
intervention group compared to controls for each
measurement from the beginning of monitoring in elderlywhowereappliededucationandmonitoringafter
examination score was determined between groups
(p<0.05) and in time (p<0.001) while similar change
was seen in both groups (p>0.005). The results of the
studyhaveshownthateducationandmonitoringwere
effective on developing foot care in elderly with DM.
Therefore,itisrecommendedthateducationandmonitoring should fall within nursing interventions in the
developmentoffootcare.
Keywords:Elderly,diabetesmellitus,footcare,monitoring,
education,nursing
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
TEZÖZETLERİ
DENEYSELPER ODONT T S OLUŞTURULANRATLARDAS STEM K V TAM NK2VEV TAM N D3
UYGULAMASININALVEOLERKEM KVED ŞET NFLAMASYONUÜZER NEETK LER N N
DE ERLEND R LMES
THERAPEUTICEFFECTSOFSYSTEMICVITAMINK2ANDVITAMIND3ONGINGIVALINFLAMMATIONANDALVEOLARBONEINRATSWITHEXPERIMENTALLYINDUCEDPERIODONTITIS
KübraTARHAN
ErciyesÜniversitesi,Sağ lıkBilimleriEnstitüsü
PeriodontolojiAnabilimDalı
DoktoraTezi,Haziran2014
Danışman:Doç.Dr.BanuArzuALKAN
ErciyesUniversity,GraduateSchoolofHealthSciences,
DepartmentofPeriodontology
PhD.Thesis,June2014
Supervisors:
Supervisor:Assoc.Prof.Dr.BanuArzuALKAN
ÖZET
ABSTRACT
Periodontitis sıklıkla kemik kaybıyla sonuçlanan
kronik in lamatuar bir hastalıktır. Vitamin D3'ü n
kemik kalsi ikasyonunu artırdığ ı, vitamin K2’nin de
kemik kaybı ü zerinde inhibitö r etkisinin olduğ u gö sterilmiştir.VitaminD3veK2’ninkemikkaybınınö nlenmesinde sinerjistik etkileri olduğ u bildirilmiştir. Bu
çalışmanın amacı deneysel periodontitis oluşturulmuş
ratlarda geleneksel periodontal tedaviye (DYT;Diş Yü zeyi Temizliğ i+KYD; Kö k Yü zeyi Dü zleştirmesi) ilave
olarakvitaminK2 veD3 uygulamasınındişetiIL-1β ve
IL-10, serum B-ALP ve TRAP-5b dü zeyleri ve alveoler
kemikseviyesiü zerineetkileriniincelemektir.
Çalışmamızda72 adetWistarAlbinocinsierkek
ratSağ lıklı(S);Periodontitis(P);(DYT+KYD)(PT);
(DYT+KYD) + D vitamini (D); (DYT+KYD) + K vitamini
(K),(DYT+KYD) + D+K vitamini (DK) olmakü zere
eşit sayıda 6 deney grubuna ayrıldı. Hayvanların
maksiller 1.molar dişlerine ligatü r yerleştirilmesiyle
deneysel periodontitis oluşturuldu. Yedi gü n sonra
ligatü rleruzaklaştırıldı,(S),(P)ve(PT)hariçdiğ ertü m
gruplardaperiodontal tedaviyi takiben vitamin K2 (30
mg/kgvü cut ağ ırlığ ı/gü n) ve/veya vitaminD3 (2
µg /kg vü cut ağ ırlığ ı/gü n) 10 gü n boyunca gü nde 1
kez oral gavaj ile verildi. Hayvanlar 18.gü ndesakri iye edildi ve dişetinde IL-1β ve IL-10, serumda ise BALP ve TRAP-5b dü zeyleri ELISA analizi ile incelendi.
Mine sement hududu- alveoler kemik tepesi (MSHAKT)mesafesihistomorfometrikanalizileincelendi.
MSH-AKT arası mesafe P grubunda S, PT, D, K ve DK
gruplarına gö re anlamlı derecede daha fazladır
(p<0.05).VitaminKuygulanangruptaB-ALPdü zeyleri P grubundakine gö re istatistiksel olarak anlamlı
derecede yü ksektir (p<0.05). D ve K grubundaki dişeti
IL-10dü zeyleri, P grubundakinegö reanlamlıderecede
yü ksekbulunmuştur(p<0.05).
Çalışmamızın sonuçları tek başınageleneksel periodontal tedavinin dişeti IL-10 ve B-ALP dü zeylerini
artırmada etkili olmadığ ını, bunun için vitamin D ve/
veya K takviyesinin gerekli olduğ unu ortaya koymuştur.
Periodontitis is a chronic in lammatory disease which
often results in loss of bone. It has been shown that,
vitaminD3increasesbonecalci icationandvitaminK2
has inhibitory effects on bone loss. It has been reported that, vitamin D3 and K2 have synergistic
effectsinthepreventionof bone loss. Thepurposeof
this study is to evaluate the effects of vitamin D3 and
K2 supplement administered in addition to conventionalperiodontaltherapy(SRP;ScalingandRootPlaning)
ongingivallevelsofIL-1βandIL-10, serumlevelsofBALP and TRAP-5b and alveolar bonelevel inrats with
experimentallyinducedperiodontitis.
Seventy-twoWistar Albinomaleratsweredividedinto
6 experimental groups; Healthy (S); Periodontitis (P);
SRP (PT); SRP + vitamin D (D); SRP + vitamin K (K);
SRP+ vitaminK andD (DK). Experimentalperiodontitis was induced by ligature placement around maxillary irstmolarteeth.After7daysthe ligatureswere removed. Vitamin K2 (30 mg/kg/day) and/or
Vitamin D3 (2 µg/kg/day) were administered via oral
gavage in all groups except in groups Sand P. At the
day 18, the animals were sacri iced, B-ALP and
TRAP-5b were examined inserum, andgingiva specimensaroundtheligaturedteethwereextractedfor IL1β and IL-10 analysis via ELISA. Distance between cemento-enamel junction and alveolar bone crest (CEJ-
ABC)wasevaluatedbyhistomorphometricanalysis.
DistancebetweenCEJ-ABC ingroup Pwassigni icantly
greater comparedtothoseingroup S,PT,D,K,DK(p<
0.05).B-ALPlevelsinKgroupweresigni icantlyhigher
thanthat ofgroup P(p < 0.05). Gingival levels of IL10 were signi icantly higher in group D and K compared tothatofgroupP(p<0.05).
Our study showed that conventional periodontal therapyalonewasnoteffectiveinincreasinggingivalIL-10
andserumB-ALPlevelsbutnecessitatesvitaminDand/
orKsupplement.
Anahtar kelimeler: Periodontitis; alveoler kemik seviyesi;
sitokin; Vitamin D3; VitaminK2;B-ALP,TRAP-5b
Keywords:Periodontitis; alveolar bone level; cytokine;
Vitamin D3;Vitamin K2; B-ALP,TRAP-5b
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
55
TEZÖZETLERİ
GENTERAPİ,FOTOBİYOMODULASYONVEULTRASONUYGULAMALARININORTODONTİKNEDENLİKÖKREZORPSİYONUÜZERİNEETKİLERİNİNDEĞERLENDİRİLMESİ
EVALUATIONOFTHEEFFECTSOFGENETHERAPY,PHOTOBIOMODULATIONANDULTRASOUNDAPPLICATIONSONORTHODONTICALLYINDUCEDROOTRESORPTION
NisaGÜL
ErciyesÜniversitesiSağlıkBilimleriEnstitüsü
OrtodontiAnabilimDalı
DoktoraTezi,Haziran2014
Danışman:Doç.Dr.GökmenKurt
ErciyesUniversityGraduateSchoolofHealthSciences
DepartmentofOrthodontics
PhDThesis,June2014
Supervisor:AssociateProfessorGökmenKURT
ÖZET
ABSTRACT
Buçalışmanınamacı,sıçanlardadeneyselolarakoluşturulan ortodontik nedenli iltihabi kö k rezorpsiyonunun
Thepurposeofthisstudywastoevaluateandtocomparetheinhibitionandrepaireffectsofphotobiomodulation (PBM), low intensity- pulsed ultrasound (LPU),
mesenchymal stem cell (MSC) and cell mediated gene
therapy (GT) applications on orthodontically induced
rootresorption(OIRR),thatwasexperimentallycreated on rats. 71 Wistar albino rats were used for this
study.OIRRwascreatedfor14daysexperimentallyon
rats with applying 100 grams of force using a closed
coil spring between central incisor and 1. molar teeth
and at the same time, therapeutic approaches were
performed. LED mediated low level laser was applied
to the PBM group rats 10 minutes daily and LPU was
administered 15 minutes every day to the ultrasound
grouprats.MSCinjectionswasperformedat1.,6.,and
11. days of experiment to the MSC and GT group rats.
nan, fotobiyomodulasyon (FBM), dü şü k yoğ unlukta
kesik atımlı ultrason (DYKUS), mezenkimal kö k hü cre
(MKH) ve MKH aracılı gen terapi (GT) yaklaşımlarının
etkilerini değ erlendirmek ve karşılaştırmaktır. Bu
amaçlatoplam71adetwistaralbinosıçankullanılmıştır. Sıçanlarda14 gü n boyunca deneysel olarak ü st keserve1.molardişlerarasında100gr.kuvvetuygulayavi gruplarında eş zamanlı terapatik uygulamalar gerçekleştirilmiştir.FBMgrubudeneklerine,gü nde10dk.
LEDaracılıdü şü kdozlazer,ultrasongrubudeneklerine
gü nde15dk.DYKUS,MKHveGTgrubudeneklerine1.,
6. ve 11. gü nlerde hü cre enjeksiyonları uygulanmıştır.
H&E,TRAPhistolojikboyamaları,SEMgö rü ntü lemeve
mRNA gen ekspresyon tayini analizleri için hazırlan-
tistiksel değ erlendirmeler sonucunda THS (p<0.001),
OsS (p=0.004), OsO (p=0.002), RAO, SRAO ve LS (p<0
001) değ işkenlerinde FBM, DYKUS, MKH gruplarında
kontrol grubuna gö re benzer oranlarda, GT grubunda
iseenyü ksekorandafarklılıklaazalmatespitedilmiştir.
RANKL dü zeyleri tü m tedavi gruplarında kontrol grubuna gö re anlamlı biçimde dü şü k bulunurken
(p<0.001); OPG mRNA ekspresyon dü zeyleri anlamlı
şekilde yü ksektir (p<0.001). GT uygulaması ile diğ er
tedavi gruplarından anlamlı olarak yü ksek OPG mRNA
ekspresyonu elde edilmiştir. Tü m tedavi yaklaşımları
Cox-2 mRNA ekspresyonunu kontrol grubuna gö re
azaltarakağ rıazaltımısağ lamıştır(p=0.039).FBM,DY-
upper1.molarteethofratswerepreparedforthehistological, genetical and SEM analysis. Number of total
cells (NTC), number and ratio of osteoclastic cells
(NOsC- ROsC), numbers of lacunas (NL), resorption
area ratio (RAR), SEM resorption ratio (SRAR), OPG,
RANKL,Cox-2mRNAgeneexpressionlevelsattheperiodontal tissue of teeth were determined. According to
the statistically evaluations, NTC (p<0.001), NOsC
(p=0.004),ROsC(p=0.002),RAR,SRARveNL(p<0001)
were decreased at the PBM, LPU, MSC and GT groups
compared to the positive control group, and the GT
group showed the lowest resorption values among
groups. RANKL mRNA gene expression levels were
lower(p<0.001)andOPGlevelswerehigher(p<0.001)
at all experiment groups than control group. OPG results in GT group were higher from other experiment
p<0.001).All therapeutic applications reduced pain with decreasing the Cox-2 mRNA
gene expression (p=0.039). PBM, LPU, MSC and GT
showed marked inhibition and repair effects on OIRR
Anahtar kelimeler: Kö k rezorpsiyonu; gen terapi; fotobiyomodulasyon;ultrason.
Key words: Root resorption; gene therapy; photobiomodulation;ultrasound.
sayısı (THS), osteoklast sayısı ve oranı (OsS-OsO), rezorpsiyon alanı oranı (RAO), SEM rezorpsiyon alanı
oranı(SRAO)velakü nsayısı(LS),OPG,RANKLveCox-
tamirinde belirgin tedavi etkileri gö stermiştir; aralarında en az rezorpsiyon varlığ ı tespiti ile gen terapi
grubuenbaşarılıyö ntemolarakdeğ erlendirilmiştir.
56
between other therapeutic applications in terms of
inhibitionandrepairofOIRR.
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
TEZÖZETLERİ
ZİHİNSELENGELLİVEYAUYUMSAĞLANAMAYANBİREYLERDEMAKSİLLOFASİYALBÖLGENİNSEDASYON
ALTINDABİLGİSAYARLIDENTALTOMOGRAFİKGÖRÜNTÜİLEDEĞERLENDİRİLMESİ
COMPUTEDTOMOGRAPHICASSESMENTOFTHEMAXILLOFACIALREGIONOFMENTALLYDISABLED
ORINADAPTABLEPATIENTSUNDERSEDATIONANESTHESİA
EMRAHSOYLU
ErciyesÜniversitesi,Sağ lıkBilimleriEnstitüsü
AğızDişveÇeneCerrahisiAnabilimDalı
DoktoraTezi,Haziran2014
Danısman:Prof.Dr.AlperALKAN
ErciyesUniversity,GraduateSchoolofHealthSciences
DepartmentofOralandMaxillofacialSurgery
PhDThesis,June2014
Supervisor:Prof.Dr.AlperALKAN
ÖZET
ABSTRACT
Zihinsel engelli ya da uyum sağ lanamayan bireylerin
tedavileri,bubireylerdegelenekselyö ntemlerleradyolojikincelemeyapılamamasınedeniyleeksikkalmaktadır. Bu çalışmanın amacı, zihinsel engelli bireylerde
genel anestezi altında gerçekleştirilecek dental tedaviler ö ncesinde radyolojik incelemenin gerekliliğ inin
The diagnosis and treatment of mentally handicapped
orinadaptablepatientswerelacked,duetocontraindicationofconventionalradiologicexamination.Thepurposeof this study was to evaluate thenecessity of the
radiologicalexaminationbeforethedentaltreatmentof
mentally handicapped patient under general anesthesia. Mentally handicapped or inadaptable patients
(n=98) whose cone-beam computer tomography
(CBCT) images were taken under sedation because of
the impossible conventional radiological or clinical
examinationinErciyesUniversityFacultyofDentistry,
Department of Oral and Maxillofacial Radiology were
Diş Hekimliğ i Fakü ltesi’ne başvuran, Ağ ız, Diş ve Çene
RadyolojisiAnabilim Dalı tarafından klinik ve radyolojikmuayenesiyapılamayanzihinselengelliyadauyum
sağ lanamayanbireylerdensedasyonaltındakonikışınlı
hastalardahiledildi(n=98).Dentaltedavilerininyapılmasıamacıylagenelanesteziveyasedasyonuygulanan
hastaların ağ ız içi muayene bulguları, ö nceden elde
edilen radyolojik gö rü ntü ler ü zerindeyapılan radyolojikmuayenebulgularıilekarşılaştırıldı.
Çocuk Diş Hekimliğ i Anabilim Dalı tarafından tedavi
edilen çocuk hastalarda radyolojik teşhis ile ağ ız içi
teşhisin%43,8oranındauyumluikenEndodontiAnabilim Dalı tarafından tedavi edilen yetişkin hastalarda
teşhisin %48oranında uyumlu olduğ u bulundu. Çocuk
hastalarda yapılan radyolojik muayene sonucunda 25
hastada (%50) şans eseri asemptomatik durumlar
(dentigerö zkist(%2,n=1);gö mü lü yirmiyaşdişi(%10,
n=5); doğ umsal 2. premolar diş eksikliğ i (%4, n=2) ;
gö mü lü alt2.premolardişvarlığ ı(%2,n=1)tespitedildi. Yetişkin hastalarda 32 hastada (%66,6) şans eseri
asemptomatik durumlar (gö mü lü yirmi yaş (%47,9,
n=23);doğ umsaleksikyirmiyaş(%13,9,n=14);gö mü lü solü stkö pekdişi(%4,2,n=2);gö mü lü solaltkö pek
dişi(%2,1,n=1);maksillersinü stelezyon(mukosel)(%
8,3,n=4);periapikallezyon(%12.5,n=6)tespitedildi.
Genelanestezialtındatedavisiplanlananzihinselengellibireylerinbeklenmediklezyongö rü lmeihtimalinden
dolayıişlemö ncesinderadyolojikdeğ erlendirmeyetabi
tutulmalarıtekrarlayangenelanesteziuygulamalarının
ö nü ne geçeceğ i dü şü nü lmektedir. Sedasyon altında
elde edilen KIBT gö rü ntü leri bu bireylerde radyolojik
değ erlendirilmenin yapılabilmesi için tek seçenektir.
patients who had undergone general anesthesia or
sedationfordentaltreatmentwerecomparedtoradio-
sonrası bakım içinderlenmeodasının ve bakımpersonelininbulunduğ umerkezlerinsayısınınartmasıgerekmektedir.
images.
The radiological diagnosis and oral diagnosis of patients were 43, 8% compatible who had treatment in
DepartmentofPediatricDentistryhowever;itwas48%
inDepartmentofEndodontics.Asaresultofradiologic
examination,thereweredetectedasymptomaticconditions (such as dentigerous cyst (2%, n=1); wisdom
tooth (10%, n=5); congenital agenesis of second premolars (4%, n=2); embedded second mandibular premolar (2%, n=1) in 25 of pediatric patients (50%).
There were detected asymptomatic conditions also in
adult patients (n=32, 66%) ; (such as embedded wisdomteeth(47,9%,n=23);missingthirdmolars(13,9%,
n=14); embedded maxillary canine tooth (4,2%, n=2);
embeddedmandibularcaninetooth(2,1%,n=1);maxillarysinuslesion(8.3%,n=4);periapicallesion(12.5%,
n=6).
Accordingtoourstudyresults,unexpectedlesionsmay
be detected in radiological examination that was performed before the dental treatment under general anesthesia of mentally handicapped patients. And radiologicalexaminationmaypreventthenecessityofrecurringgeneralanesthesia.Theonlyoptionforperforming
radiological examination is CBCT images that may be
taken under sedation for such of these patients. The
centers should be increased in point of numbers that
haveCBCTdevice,recoveryroomandanesthetist,and
healthcarestaff,inourcountry.
Anahtar kelimeler:
selengelli,sedasyon
Keywords: Conebeamcomputedtomography,mental retardation,sedation.
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
57
TEZÖZETLERİ
D-GALAKTOZVEALÜMİNYUMLAALZHEİMERHASTALIĞIMODELİOLUŞTURULANRATLARDAVİNPOSETİNİN
ÖĞRENMEÜZERİNEETKİLERİ
THEEFFECTOFVINPOCETINEONLEARNINGIND-GALACTOSEANDALUMINIUMINDUCEDALZHEIMER
DISEASEMODELINRATS
SedaGÜNDÜZ
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
FizyolojiAnabilimDalı
YüksekLisansTezi,Temmuz2014
Danışman:Prof.Dr.NazanDOLU
ErciyesUniversity,GraduateSchoolofHealthSciences
DepartmentofPhysiology
MasterThesis,July2014
Supervisor:Prof.Dr.NazanDOLU
ÖZET
ABSTRACT
Alzheimer hastalığ ı, bilişsel fonksiyonlarda ve davranışlardailerleyicibozuklukilekarakterizeyaygınnö rodejeneratif bir hastalıktır. Alzheimer hastalığ ına yö nelik radikal bir tedavi henü z bulunamadığ ından bu konuylailgilideneyselhayvanmodelleriyleyapılanbilimsel araştırmalar daha ö nemli hale gelmiştir. Çalışmamızda,nö roprotektifvevazodilatö retkileriolanvinposetinin,D-galaktozveAlCl3iledeneyselAlzheimermodeli oluşturulan sıçanlarda iyileştirici etkisinin olup
olmadığ ı Morris su tankında ö ğ renme deneyleri ile
araştırıldı.
Çalışmamızda44adet14aylıksıçanrastgelebö lü ştü rü lerek (Kontrol (K) = 10, Alzheimer hastalığ ı oluşturulan(AH)=20,Alzheimerhastalığ ıoluşturulan+Vinposetin uygulanan (AH+V) = 7 ve Vinposetin uygulanan
(V) = 7) 4 grup oluşturuldu. Kontrol grubuna serum
-galaktoz: 90 mg/kg/gü n ve
AlCl3:40mg/kg/gü ndozdaintraperitoneal(i.p)yolla6
haftauygulandı.AH+VgrubunaD-galaktoz:90mg/kg/
gü nveAlCl3:40mg/kg/gü n6haftauygulandıktansonra 17 gü n sü reyle5 mg/kg/gü n vinposetin, V grubuna
ise17gü n5mg/kg/gü ni.pyollavinposetinuygulandı.
Enjeksiyonsü resisonrasındasıçanlardaMorrissutankıdeneyleriileö ğ renmetestedildi.1.gü nalıştırma2-34.gü nö ğ renmeve5.gü ntestaşamasıolarakdeğ erlendirildi.
Azheimer'sdiseaseisadiseaseofwidespreadnurodegenerative characterized in cognitive functions and
behaviors with progressive disorder. For the reason
thataradicaltreatmentforAlzheimer'sdiseasecannot
delshavebecomemoreimportantonthisissue.Inour
study, vinpocetine which has neuroprotective andvasodilatoryeffectswasinvestigatedonratswithexperimental Alzheimer's model whether it has curative effectornotinMorriswatermazelearningexperiments
withD-galactoseandAlCl3.
Inourstudy,44of14monthratswerepartitionedrandomlyandgenerated4groups(Control(C)=10,Alzheimer'sdisease(AD)=20,Alzheimer'sdisease+Vinpocetine(AD+V)=7andVinpocetine(V)=7). PhysiologicalsalinewasinjectedtoCgroupandintraperitoneally(i.p)toADgroupwithD-galactose:90mg/kg/day
andAlCl3:40mg/kg/dayfor6weeks.5mg/kg/day
vinpocetine was injected V and AD+V groups for 17
days after injection of D-galactose: 90 mg / kg / day
andAlCl3:40mg/kg/dayfor6weeksasi.p.Thelearning of rats were tested with Morris water maze learning experiments end of the injection period. 1st day
was rated traning, 2nd,3th and 4th days learningand
5thdaytestphase.
bulmasü relerivehedefkadrandageçirilensü reistatikselolarakanalizedildiğ inde,ilk4gü ngruplararasında
anlamlı fark bulunamazken, hedef kadranda geçirilen
sü renintestedildiğ i5.gü ndeAH,AH+VveVgrubunun
hedef kadranda geçirdikleri sü re kontrol grubundan
anlamlı olarak dü şü k bulunmuştur (p<0.006, p<0.034,
p<0.043). AH+V ve V grupları arasında ö ğ renme parametrelerindeistatistikselfarklılıkgö zlenmedi.
Deney sonunda sıçanların beyin dokuları çıkarılarak
histolojikaçıdanincelendi.Deneygrubundasenilplakların gö rü lmesi kurulan modeli desteklemiştir. Sonuç
olarak, çalışmamızda kullanılan vinposetin dozunun
Alzheimerlısıçanlarınö ğ renmefonksiyonlarındaiyileştiricietkisininolmadığ ıvedahayü ksekvinposetindozlarında ileri çalışmalara ihtiyaç bulunduğ u sonucuna
varılmıştır.
ration and the time spent in the target quadrant was
analyzedstatisticallyontheevaluationoflearning.But,
thetimespentinthetargetquadrantofAD,AD+Vand
groups was discovered less than the control group
Anahtarkelimeler: Alzheimerhastalığ ı,Morrissutankı,vinposetin,sıçan
Key words: Alzheimer's disease, Morris water maze, vinpocetine,rat
58
onday5(p<0.006,p<0.034,p<0.043).Thestatistical
difference was observed on learning parameters
betweenAD+VandVgroups.
Ratsbraintissueswereextractedandexaminedhistologically at the end of experiment. The created model
was supported with senile plaques seen in the experimental group. In conclusion, dose of vinpocetine used
in the study there is no healing effect on the learning
function of the rats with Alzheimer's. Higher doses of
vinpocetineareneededinfurtherstudies.
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
TEZÖZETLERİ
KAYSERİEĞİTİMVEARAŞTIRMAHASTANESİENFEKSİYONHASTALIKLARIKLİNİĞİNEDİABETİKAYAK
NEDENİYLEBAŞVURANHASTALARINEPİDEMİYOLOJİKÖZELLİKLERİ
EPIDEMIOLOGICFEATURESOFPATIENTSWITHDIABETICFOOTWHICHAPPLICATEDTOKAYSERİTRAININGANDRESEARCHHOSPITALINFECTIOUSDISEASESCLINIC
AlpaslanŞEKER
ErciyesÜniversitesiSağlıkBilimleriEnstitüsü
HalkSağlığıAnabilimDalı
YüksekLisansTezi,Temmuz2014
Danışman:Doç.Dr.İskenderGÜN
ErciyesUniversity,GraduateSchoolofHealthSciences,
DepartmentofPublicHealth
MSc.Thesis,July2014
Supervisor:Assist.Prof.Dr.İskenderGÜN
ÖZET
ABSTRACT
Bu araştırma, Kayseri Eğ itim ve Araştırma Hastanesi
Enfeksiyon Hastalıkları Kliniğ inde diabetik ayak nedeniyle yatan hastaları, epidemiyolojik açıdan değ erlendirmekamacıylayapılmıştır.
Araştırmaya 01 Mart 2012-31 Temmuz 2012 tarihleri
arasında enfeksiyon hastalıkları kliniğ inde diabetik
ayak enfeksiyonu sebebiyle yatan hastaların tamamı
alınmıştır. Bu hastalarla yü z yü ze gö rü şü lü p anket uygulanarakverilertoplanmıştır.
Araştırma kapsamına 80 hasta alınmıştır. Araştırma
grubundaki bireylerin yaş ortalaması 59.1±10.0’dü r.
Araştırmagrubundakierkekvekadınlarınoranıeşitve
%95’ievlidir.Hastalarınçoğ unluğ uokuryazardeğ il(%
30)veilkokulmezunudur(%42).Araştırmagrubunun
%45’ievhanımıdır.Bunu%10’lukoranlaişçiizlemektedir.Hastaların%63.8’ininaylıkortalamagelirmiktarı
asgari ü cretten azdır. Katılımcıların %23.8’i 5 yıldan
dahaazsü redir,%6.3’ü de20yıldandahafazlasü redir
diabet hastasıdır. Ailesinde diabet hastası olanların
oranı %63.7’dir. Dü zenli olarak kontrole gidenlerin
oranı %76.3, ayda bir kontrole gidenlerin oranı ise %
47.5’dir.Kontroliçinensıkgidilenbirimlerdevlethastanesi ve aile hekimidir. Bireylerin %26.3’ü diabetle
ilgili eğ itim almıştır. Eğ itim veren kişiler doktor ve
hemşiredir. Araştırma grubundaki bireylerin %89.8’i
ayaklarınıhergü nkontroletmektedir.Ayaklarınıkontrol edenlerin %41.2’si sertleşme, %34.2’si çatlama, %
21.9’u enfeksiyon, %2.7’si ise renk değ işikliğ i yö nü nden kontrol etmektedir. Ayaklarını yıkadıktan sonra
kurulayanların oranı %83.8’dir. Bireylerin %67.5’i tırnaklarını dü z, %32.5’i ise yuvarlak kesmektedir. Ortopedik ayakkabı kullananların oranı %10, yü nlü çorap
kullananlarınoranı%80olarakbulunmuştur.
Sonuçolarak;diabetikayağ ıolanhastalarınayaksağ lığ ınailişkintutumvedavranışlarıyetersizbulunmuştur.
Thisresearch,wasperformedtoevaluatetheepidemiologicalaspectsofdiabeticfootpatientswhichhospitalized in the Infectious Diseases Clinic of Kayseri TrainingandResearchHospital.
All of the patients which hospitalized due to diabetic
foot infection between 1 March 2012 to 31 July 2012
were included to study. Data were collected for these
patientswithfacetoface.discussionandapplicationof
surveyquestionnaire.
Eighty patients were included in the study. The mean
ageofthestudygroupwas59.1±10.0years.Therate
ofmenandwomeninthestudygroupwereequaland
95%of married. The majorityof patients areilliterate
(30%) and primary school graduates (42%). Of the
study group 45% were housewives. This, followed by
workerswith10%.Theamountoftheaveragemonthly
income of 63.8% patients was less than the minimum
wage. Duration of diabetes were less than 5 years
23.8% and more than 20 years for 6.3% patients. The
proportionofpatientswithafamilyhistoryofdiabetes
63.7% percent. Of the patients 76.3% were going for
control regularly and 47.5% of them going for control
monthly.Themostfrequentlyvisitedcontrolunitswere state hospital and the family physician. Individuals
26.3% received training about diabetes. Training was
porvidedbythedoctorandnursemainly.oftheindividuals in the study group 's 89.8% were checked their
feeteveryday.Ofthosewhocontroltheirfeet,41.2%
cure,34.2%,cracking,21.9%infection,2.7%ofcontrols
intermsofachangeinthecolorofthefeet.Therateof
drying after washing the feet was 83.8%. Individuals
67.5% while cutting nails straight 32.5% cuts in the
round.While10%ofthepatientsuseorthopedicshoes,
woolsocksuseratewas80%.
As a result, attitudes and behaviors related to the he-
Anahtarkelimeler:Diabetikayak,enfeksiyon,tutum,hasta
Keywords:Diabeticfoot,infection,attitude,patient
ent.
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
59
TEZÖZETLERİ
YOZGATMERKEZİLÇEDEKOYUNCULUKYAPANİŞLETMELERİNSOSYO-EKONOMİKYAPISIVEÜRETİM
MALİYETLERİNİNARAŞTIRILMASI
ASTUDYONSOCIO-ECONOMICSTRUCTUREANDPRODUCTIONCOSTSOFSHEEPBREEDINGENTERPRISESIN
CENTRALDISTRICTOFYOZGATPROVINCE
BoraTAMER
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
ZootekniAnabilimDalı
YüksekLisansTezi,Haziran2014
Danışman:Doç.Dr.SavaşSARIÖZKAN
ErciyesUniversity,GraduateSchoolofHealthSciences
DepartmentofAnimal
MSc.Thesis,June2014
Supervisor:Assoc.Prof.Dr.SavaşSARIÖZKAN
ÖZET
ABSTRACT
Bu çalışmada, Yozgat Merkez ilçede koyunculuk yapan
işletmelerinsosyo-ekonomikyapısınınveü retimmaliyetlerininbelirlenmesiileyetiştiricilerinkarşılaştıkları
sorunlara çö zü m ö nerileri getirilmesi amaçlanmıştır.
Araştırma materyalini, Yozgat Merkez ilçe ve kö ylerde
The aim of this study is to determine the socioeconomicsituationandproductioncostsofsheepbreedingenterprisesandproposesomesuggestionstotheir
problems. The materials of the study are the data of
lentoplam63adetkoyunculukişletmesinin2012yılına
larınagö rekü çü k(50baştanaz;12işletme),orta(51100 baş; 20 işletme) ve bü yü k (101-250 baş; 31 işletme)şeklinde3altgrubaayrılmıştır.Yapılanincelemede,ü reticilerinyeterincetecrü beliolmasınakarşılık(%
70’i20yılınü zerindetecrü beyesahip),resmivemesleki eğ itim dü zeylerinin dü şü k olduğ u (%74.6’sı ilkokul
mezunu ve %1,6’sı mesleki eğ itim almış), ayrıca %
62’sinin de ö rgü tsü z olduğ u belirlenmiştir. Toplam
işletmelerde koyun başına dü şen satış gelirleri, ü retim
TLve59.2TLolarakhesaplanmıştır.Aynıdeğ erlerorta
ö lçekli işletmelerde 464.8 TL, 257.6 TL ve 207.2 TL;
bü yü k ö lçeklilerde ise 462,6 TL, 202 TL ve 260.6 TL
olarak hesaplanmıştır. Sonuç olarak, Yozgat Merkez
ilçede koyunculuk işletmeleri bü yü dü kçe birim maliyetlerin azalıp, satış geliri ve kâ rın artması, işletme
ö lçeklerinin bü yü tü lmesini gerekli kılmaktadır. Ayrıca,
ü reticilerineğ itimdü zeylerininiyileştirilmesiveö rgü tlenmenin teşvik edilmesinin koyunculuğ un gelişimine
katkısağ layacağ ıdü şü nü lmektedir.
Anahtar kelimeler: Yozgat, koyunculuk, ekonomik analiz,
maliyet,karlılık
60
domly selected63 sheep producers, located in Central
DistrictofYozgatProvincein2012year.Theenterprisesdividedinto3groups;assmallscale(≤50sheep;12
enterprises),mediumscale(51-100sheep;20enterprises) and large scale (101-250 sheep; 31 enterprises)
according to number of sheep. As a result, the producers has enough experiences about sheep breeding
(70% have got over 20 year experiences), however,
their formal and professional education level are low
(74% graduted only primary school and 1.6% has got
job training), furthermore 62% of them are unorganized.Thefeedwasthehighestcostitemwith59%and
costs in grand total was decreased with increasing of
thescale.Insmallscaleenterprises,thesalesrevenue,
337.5 TL/head, 278.3 TL/head and 59.2 TL/head respectively.Samevalueswere464.8TL/head,257.6TL/
head and 207.2 TL/head in medium scale and 462,6
TL/head,202TL/headve260.6TL/headinlargescale.
Consequently, the scale of enterprises need to enlarge
for decreasing the unit costs and increasing the sales
education and organization of producers could contributethedevelopmentofsheepbreeding.
Key words: Yozgat, sheep breeding, economic analysis, cost,
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
TEZÖZETLERİ
İZOKİNETİKEGZERSİZPROGRAMLARININSPORCULARINÜSTVEALTEKSTREMİTEKASGURUPLARI
ÜZERİNEETKİSİ
THEEFFECTOFISOKINETICEXERCISESPROGRAMSONATHLETES'UPPERANDLOWEREXTREMITY
MUSCLEGROUPS
ArmağanŞAHİNKAFKAS
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
BedenEğitimiveSporAnabilimDalı
DoktoraTezi,Haziran2014
Danışman:Prof.Dr.BekirÇOKSEVİM
ErciyesUniversity,GraduateSchoolofHealthSciences,
DepartmentofPhysicalEducationandSports
MSc.Thesis,June2014
Supervisor:Prof.Dr.BekirÇOKSEVİM
ÖZET
ABSTRACT
hemdesporculariçinkasperformansınınarttırılmasıve
aynı zamanda verimli, aktif bir yaşamı sağ ladığ ı hipotezi
ilebuçalışmaplanlandı.
Sportif performansın arttırılmasında, yaralanmaların ö nlenmesinde ve rehabilitasyonda yaklaşımının belirlenmesindealtekstremiteveü stekstremitekaslarıbelirleyicidir.
Bu araştırma, voleybol, basketbol ve hentbol branşı sporcularınahaftadaikigü nuygulanandü zenlidirençegzersizlerinin sporcuların ü st ve alt ekstremite kas guruplarının
(latissimus dorsi, pectoralis major, trapezius, abdominal,
hamstring-ekstensö r kas oranları
ü zerineetkisiniveegzersizlerboyuncasporcularınharcananenerji miktarınıve metabolik eşik değ erlerinibelirlemeyiamaçlamaktadır.
gö ren ve branşlarında aktif spor yapan, 12 basketbol, 12
hentbol ve 12 voleybol oyuncusu olmak ü zere ü ç grupta
toplam 36 yetişkin erkek gö nü llü den oluşmaktadır. Araştırmada 8 haftalık antrenman protokolü nü n sporcu grupları ü zerindeki etkisini değ erlendirmek amacıyla antrenman periyodunun başında ve sonunda bazı biyometrik
sel performans testleri (otur-eriş, dikey sıçrama ve 30 m
koşu), kuvvet parametreleri ö lçü mleri (izokinetik diz ve
gö vde kuvveti) ve armband kullanılarak metabolik hız
ö lçü mleriyapıldı.Araştırmasonundabasketbol,hentbolve
voleybolcularauygulananantrenmanprogramınınbaşlangıcındavesonundayapılanö lçü msonuçlarıkarşılaştırıldı.
Araştırma gruplarına ait otur-eriş, dikey sıçrama ve 30 m
koşu testi sonuçlarında, izokinetik diz ve gö vde kuvveti
zirve tork ve ortalama gü ç değ erlerinde, hamstringquadriseps oranında son testlerlehine anlamlı farklılıklar
tespit edildi (p<0.05). Ayrıca grupların metabolik eşitlik,
harcanankalorideğ erleriveaktivitesü relerindedeanlamlıfarklılıksaptandı(p<0.05).
Sonuçolarak,dü zenliolarakşiddetiartankuvvetegzersizlerininfarklısporbranşlarındauğ raşansporcularındominant,non-dominantdizvegö vdekuvvetdeğ erleriniarttırdığ ıbulunmuştur.Ayrıcagö nü llü lerinö zellikleH:Qoranlarında meydana gelen olumlu değ işim kasların endurans
ö zelliğ i ve muhtemel ekstremite yaralanmalarının ö nlenmesibakımındanoldukçaö nemlibirgelişmedir.Bunedenle antrenö rler, antrenman programlarını hazırlarken kuvvet antrenmanlarına en az haftada iki gü n uygulamaları
sporcuların gö vde ve diz kuvvetleri açısından gelişmeler
sağ layabilecektir.
Anahtar kelimeler:
metre
Inhealthypeoplebettermuscularfunctionandmorepowerful muscles mean a more active life. Upper and lower
extremity muscles are the determiners of increasing athletic performance, and the prevention of injuries and to
clearifytherehabilitationmethods.Thisresearchexposed
volleyball, basketball and handball athletes to strength
exercises for their upper and lower extremity muscle
groups (latissimus dorsi, pectoralis major, trapezius, abdominal, hamstring-quadriceps) two times a week to de-extensor muscle ratios, the
amount of energy spent by athletes during exercises and
metabolicthresholdvalues.
The research subjects were composed of 36 adult male
volunteerswhostudyatInonuUniversityareregularathletes. They were taken from 3 groups: 12 basketball, 12
volleyball and 12 handball players. Biometric measurements (height, body weight, body fat ratio, BMI), physical
performancetests(sitandreach,verticaljump,30mdash)
power parameter measurements (isokinetic knee and
torsopower),andmetabolicvelocitymeasuretakenwhile
exercising with an armband were taken at the beginning
andattheendofan8weektrainingperiod,withtheaimof
evaluating the differences of the training regime on the
athletegroups.Attheendoftheresearchtheresultstaken
at the beginning and at the end of the training program
appliedtobasketball,volleyballandhandballplayerswere
analysed.Whilecomparingsitandreach,verticaljumpand
30mdashresults,isokinetickneeandtorsostrength,peak
torque, and average strength values and hamstring(p<0.05). The groups' metabolic equalities, spent calorie
cantmeaningfuldifferences(p<0.05).
As a result, regular amplitude-increasing power exercises
were found to increase dominant knee, non-dominant
knee, and torso strength in athletes in different sports.
Also,thevolunteersespeciallypositivechangeinH:Qratio
isaratherimportantdevelopmentwithrespecttomuscle
endurance characteristics and the prevention of potential
extremity injuries. Because of this trainers should devote
at least two days a week to torso and kneestrengthening
exerciseswhenplanningtrainingprograms.
Key words: Isokinetic exercise, power, strength, dynamometer
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
61
TEZÖZETLERİ
DİABETESMELLİTUSLU40-60YAŞARASIHASTALARDAHASTALIKSÜRESİİLEGLİKOZİLLENMİŞ
HEMOGLOBİNDÜZEYLERİARASINDAKİİLİŞKİVEETKİLEYENFAKTÖRLER
THERELATIONSHIPBETWEENTHEDURATIONOFDISEASEOFPATIENTSAGEDBETWEEN40–60WITHDIABETESMELLITUSANDTHEIRLEVELSOFGLYCOSYLATEDHEMOGLOBIN,ANDTHEFACTORSAFFECTING
THEGLYCOSYLATEDHEMOGLOBIN
ÖzlemTEKTAŞ
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
FizyolojiAnabilimDalı
YüksekLisansTezi,Haziran2014
Danışman:Prof.Dr.MeralAŞÇIOĞLU
ErciyesUniversity,GraduateSchoolofHealthSciences,
DepartmentofPhysiology,
MSc.Thesis,June2014
Advisor:Prof.Dr.MeralAŞÇIOĞLU
ÖZET
ABSTRACT
Buaraştırma,diabetesmellituslu40-60yaşarasıhastalarda hastalık sü resi ile glikozillenmiş hemoglobin dü zeyleri arasındaki ilişki ve etkileyen faktö rleri saptamak amacıyla yapılmıştır. Araştırmanın ö rneklemini,
20/02/2012-20/12/2012tarihleriarasındaNiğ deDevletHastanesidiyabetveendokrinolojipolikliniklerinde
takip edilen ve dahiliye servislerinde diyabet tanısıyla
yatan 166 hasta oluşturmuştur. Veriler tanıtıcı ö zellikler bilgi formu kullanılarak tespit edilmiş, araştırma
kriterlerineuyanveçalışmayakatılmayıkabuledenher
bir hastanın ü çer aylık periyodlarla yaptırdığ ı rutin ü ç
kontrolü nde belirlenen glikozillenmiş hemoglobin ve
açlık kan glikozu değ erleri hasta dosyalarından veya
hastane laboratuvar kayıt sisteminden elde edilmiştir.
Verilerin değ erlendirilmesinde; tanımlayıcı istatistiklerden,Mann-WhitneyUveKruskall-Wallistestleriile
SpearmanKorelasyonanalizindenyararlanılmıştır.
Hastalıksü resi6-10yıl,yaşı51-60,bedenkitleindeksi
30.0kg/m2veü zeriolan,ilkokulmezunuvebekâ rhastalarda, yapılan tü m ö lçü mlerde glikozillenmiş hemoglobin dü zeyinin daha yü ksek olduğ u tespit edilmiştir
(p<0.05). Diyabetli bireylerin yapılan ö lçü mlerdeki
glikozillenmiş hemoglobin dü zeyi ile hastalık sü resi
arasındaki ilişkinin zayıf dü zeyde ve pozitif yö nde anlamlıbirilişkiolduğ ubelirlenmiştir(p<0.05).Açlıkkan
glikozudü zeyiilehastalıksü resiarasındadaistatistikselolarakanlamlıbirilişkisaptanmıştır(p<0.05).Araştırmanın sonucunda hastalık sü resinin artmasıyla glikozillenmiş hemoglobin dü zeylerinin yü kseldiğ inin
belirlenmesinedeniylemikrovemakrovaskü lerkomplikasyonların ö nlenmesi açısından glikozillenmiş hemoglobindü zeyininö zellikledediyabetsü resi6yılve
dahauzunolanhastalardadü zenliolaraktakipedilmesi, elde edilen sonuçlara gö re diyabet tedavisinin yenidendü zenlenmesigerektiğ idü şü nü lmü ştü r.
This study was conducted with the purposeof identifyingtherelationshipbetweenthedurationofdiseaseof
patients aged between 40–60 with diabetes mellitus
and their levels of glycosylated hemoglobin, and the
factors affecting this relationship. The sample of this
studywascomposedof166patientswhoweremonitored between February 20, 2012 and December 20,
2012 in the polyclinics of diabetes and endocrinology
in Niğ de State Hospital, and who were staying in the
wardofinternaldiseasesofthishospitalwiththediagnosisofdiabetes.Thedatawerecollectedutilizingthe
information form of descriptive characteristics; the
values of glycosylated hemoglobin and fasting blood
Anahtar kelimeler: Diabetes mellitus, glikozillenmiş hemoglobin,hastalıksü resi
Keywords:Diabetesmellitus,glycosylatedhemoglobin,durationofdisease
62
which were implemented once every three months by
eachofthosepatientswhometthecriteriaofthestudy
andgaveconsenttoparticipateinthestudy,wereobtained from the iles of patients or from the system of
hospital’slaboratoryrecords.descriptivestatistics,the
Mann-WhitneyUTest,theKruskall-WallisTest,andthe
Spearman Correlation were utilized to assess the data
obtained.
Thepatientswhosedurationofdiseasewasbetween610years,whoseageswerebetween51-60,whosebody
massindexwas30kg/m2orabove,whowereprimary
school graduates, and whose marital status was
cosylated hemoglobin in all of the measurements carried out (p<0.05). It was found that there was a poor
relationbetweentheglycosylatedhemoglobinlevelsof
individuals with diabetes—which was determined
through measurements—and the duration of disease,
veway(p<0.05).Itwasrevealedthattherewasastatis-
blood glucose and the duration of disease (p<0.05). It
was concluded from the study that the levels of glycosylated hemoglobin,especially of those whose durationofdiabetesextendsover6yearsormore,mustbe
monitoredperiodicallyintermsofpreventionofmicrovascular and macrovascular complications, due to the
factthatitwasdiscoveredthatthelevelsofglycosylated hemoglobin increase as the duration of disease
increases, and it was considered that the treatment of
diabetes must be reorganized in accordance with the
conclusionsreached.
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
TEZÖZETLERİ
HİBRİTHYRAXAPAREYİİLEYAPILANHIZLIVEYARIHIZLIÜSTÇENEGENİŞLETMESİNİNDENTOFASİYAL
YAPILARÜZERİNEETKİSİNİNİNCELENMESİ
THEINVESTIGATIONOFHYBRIDHYRAX’SEFFECTONDENTOFACIALSTRUCTUREWITHSEMIRAPIDAND
RAPIDEXPANSIONPROCEDURE
MelikeBüşraDUCAN
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
OrtodontiAnabilimDalı
DoktoraTezi,Mayıs2014
Danışman:Doç.Dr.SabriİlhanRAMOĞLU
ErciyesUniversity,GraduateSchoolofHealthSciences,
DepartmentofOrthodontics
Ph.DThesis,May2014
Supervisor:Assoc.Prof.SabriIlhanRAMOGLU
ÖZET
ABSTRACT
Buçalışmanınamacıhibrithyraxapreyiileyapılanhızlı
veyarıhızlıü stçenegenişletmesinindentofasiyalyapılarü zerineetkisininincelenmesidir.
Yarı hızlı genişletme grubu, yaş ortalamaları
13,26±1,36yılolan19bireyden,hızlıgenişletmegrubu
ise yaş ortalamaları 13,22±1,39 yıl olan 18 bireyden
oluşmaktadır.Tedavisü resiyarıhızlıgenişletmegrubu
için ortalama 60,95±23,68 gü n; hızlı genişletme grubu
için ortalama 22,27±4,41 gü ndü r. Yarı hızlı ü st çene
genişletme prosedü rü nde vida ilk hafta gü nde 2 ×1/4
turvedahasonra2gü nde1/4turçevrilirken,hızlıü st
çene genişletme prosedü rü nde vida gü nde 2×1/4 tur
çevrilmiştir. Bireylerden tedavi başında (T0) ve genişletmesonrasında(T1)dentalmodeller,lateralvefron-
The aim of this study was to compare hybrid hyrax’s
effects on dentofacial structure with semi rapid and
rapidexpansionprocedure.
The semi rapid expansion group is consist of 19 patientsatthemeanageof13,26±1,36yearsandtherapidexpansiongroupisconsistof18patientsatthemean
ageof13,22±1,39years.Thetreatmenttimeismeanly
60,95±23,68 days for semi rapid expansion group and
22,27±4,41 days for the rapid expansion group. The
patientswereinstructedtoactivatethescrew2×¼per
sel değ erlendirmede grup içi değ işimlerin karşılaştırılmasıiçin“Eşleştirilmiş-ttest”ve“Wilcoxontest”,gruplar arası değ işimlerin karşılaştırılması için ise
“Bağ ımsız-ttest”ve“Mann-WhitneyUtest”kullanılmıştır. p<0,05 için sonuçlar istatistiksel olarak anlamlı
kabuledilmiştir.
Grup içi değ erlendirmelerde, farklı verilerde istatistiksel olarak anlamlı değ erler bulunduğ u halde, gruplar
arasında hiçbir veride istatistiksel olarak anlamlı bir
farklılıkbulunmamıştır.Frontalsefalometrikö lçü mlerde benzer iskeletsel ve dentaldeğ işimler bulunmuştur
vegruplararasındaistatistikselolarakanlamlıfarklılık
gruptadaartarken,gruplararasındaanlamlıbirfarklılıkbulunmamıştır.
Sonuçolarak,herikiprosedü riledeü stçenegenişletmesi başarıyla gerçekleşmiştir. Aktif tedavi sü resi açısındandü şü nü ldü ğ ü ndehızlıü stçenegenişletmesinin,
yarı hızlı ü st çene genişletmesine gö re ü stü n olduğ u
sö ylenebilir. Kısa dö nemde her iki grup arasında anlamlı farklılık bulunmamasına rağ men, uzun dö nem
etkilerilerikiçalışmalarladeğ erlendirilmelidir.
Anahtarkelimeler:Hızlıü stçenegenişletmesi,kemikdestekligenişletme,yarıhızlıü stçenegenişletmesi
otherdayforsemirapidexpansiongroupand2×¼per
day throughout the treatment for rapid maxillary expansiongroup.Dentalcasts,lateralandfrontalcephalometricradiographsweretakenfromthepatientsatthe
beginning of treatment (T0) and at the end of expansion period (T1). Intragroup variances wereevaluated
with“Paired-ttest”and“Wilcoxontest”.“Independentt
test”and“Mann-WhitneyUtest”wereusedtocompare
the intergroup variances. A p value of less than 0,05
variancesinthegroups,therewerenostatisticallysig-
cephalometric measurements showed similar dental
differenceswerefoundbetweenthegroups.Intermolar
groups;howevernostatisticaldifferencesweredetectedbetweenthegroups.
In conclusion, maxillary expansion was carried out
successfully with both procedures. Rapid maxillary
expansionissuperiortosemirapidexpansionbecause
cant differences were found between the groups in
short term, long term effects should be evaluated by
furtherstudies.
Keywords:Boneboredexpansion,rapidmaxillaryexpansion,
semirapidmaxillaryexpansion
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
63
TEZÖZETLERİ
BROİLERKARKASLARINDANİZOLEEDİLENCAMPYLOBACTERJEJUNIİZOLATLARININMAKROLİD,KİNOLON
VETETRASİKLİNGRUBUANTİBİYOTİKLEREKARŞIDİRENÇDURUMU
THERESISTANCESTATEOFCAMPYLOBACTERJEJUNIISOLATEDFROMBROILERCARCASSESAGAINSTTO
MACROLIDE,QUINOLONEANDTETRACYCLINEGROUPSOFANTIBIOTICS
HarunHIZLISOY
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
VeterinerMikrobiyolojiAnabilimDalı
DoktoraTezi,Haziran2014
Danışman:Prof.Dr.HüseyinKILIÇ
ErciyesUniversity,GraduateSchoolofHealthSciences
DepartmentofPhysiology,
DepartmentofVeterinaryMicrobiology
PhDThesis,June2014
Supervisor:Prof.Dr.HüseyinKILIÇ
ÖZET
ABSTRACT
Bu çalışmada broiler karkaslarından Campylobacter jejuni izolasyonu,eldeedilenizolatlarınmakrolid,kinolonvetetrasiklinantibiyotiklerinekarşıdirençlerininortayakonulması,Minimuminhibi-
Inthisstudy,toisolateCampylobacterjejunifrombroilercarcasses,
to reveal the resistance to macrolide, quinolone and tetracycline
groups of antibiotics, to determine the MIC values, to demonstrate
the genomic and plasmid mediated genes played role in resistance
andtoevaluatetheseasonaldifferencesintheresistanceepidemiologyofobtainedisolateswereaimed.
FortheisolationofC.jejuni,atotalof200samplesincludingchicken
thigh,breast,wingsandcarcassespurchasedfromsupermarketsin
Kayseri province were examined as materials in June 2012 and
kaynaklıdirençgenleriningö sterilmesivedirençepidemiyolojilerindekimevsimselfarklılıklarınbelirlenmesiamaçlandı.
Campylobacterjejuni izolasyonu amacıyla, Haziran 2012 ve Ocak
2013 dö nemlerinde Kayseri ilindeki sü permarketlerden satın
alınan but, gö ğ ü s, kanat ve bü tü n tavuk olmak ü zere toplam 200
nu, fenotipik testler ve multipleks Polimeraz Zincir Reaksiyonu
(mPZR) ile gerçekleştirildi. C. jejuni’lerin antibiyotiklere direnç
saptandı. Aynı zamanda antibiyotiklere dirençlilikleri; PZR ve
sekansanalizigibimolekü leryö ntemlerletestedildi.
FenotipiktestlerleHaziran2012dö nemindetoplanan100ö rneğ in
81’i, Ocak 2013 dö neminde ise 100 ö rneğ in 77’si Campylobacter
spp.yö nü ndenpozitifbulundu.mPZRtestiileHaziran2012dö nemindeCampylobacterspp.izolatlarından,88;Ocak2013dö nemindeise68C.jejuni
rı bakımından dö nemler arasındaki fark istatistiksel yö nden (Ki
kare testi) ö nemli bulunmadı (P>0,05).Disk difü zyon testindeen
yü ksekdirençoranları,Haziran2012veOcak2013dö nemiizolatlarıiçinsırasıylanalidiksikasit(%78,467,1-%86,7)vetetrasikline(%55,6-%64,7)karşıgö zlenirken,en
dü şü koranlariseazitromisin(%1,1-%4,4),doksisiklin(%2,2-%
1,4)veeritromisine(%11,3-%4,4)karşıbulundu.Etestsonuçları
latlarıntestedilenantibiyotiklereduyarlılıklarındaherikidö nem
arasındaki fark istatistiksel olarak ö nemli bulunmadı (P>0,05).
Tetrasiklindirenciyö nü ndengenomiktetOgeni;Haziran2012ve
Ocak 2013 dö nemi izolatlarının sırasıyla % 88 ve % 85,7’inde
gö sterilirken; plazmid aracılı tetO geni izolatların % 93,7 ve %
85,7’sindetespitedildi.Makroliddirencinde23SrRNA’daA2074C
mutasyonuna izolatların hiçbirinde rastlanmazken; A2075G mutasyonunaHaziran2012veOcak2013dö nemlerindeizolatların%
18,4 ve % 14,8’inde rastlandı. Genomik kinolon direncinde gyrA
geniü zerindekimutasyonlar,Haziran2012veOcak2013dö nemlerinde,izolatların%83,5ve%81,8’indetespitedilirken;plazmid
aracılı kinolon direnci amacıyla incelenen qnr geni, izolatların
hiçbirinde bulunamadı. PZR ile saptanan kinolon ve makrolid
direnci,DNAsekansanaliziiledoğ rulandı.Sekansanaliziylekinolon dirençli izolatlarda Tre-86duyarlı izolatlarda bu mutasyona rastlanmadı. Sekans analizi ile
makrolid dirençli izolatlarda A2075G mutasyonu tespit edildi.
Ancak, hiçbir izolatta A2074C mutasyonuna rastlanmadı. Duyarlı
izolatlarınhiçbirindedebuikimutasyongö rü lmedi.
Sonuçolarak;tavuketindekiantibiyotikleredirençliC.jejunivarlığ ı nedeniyle koruyucu tedbirlerin alınması, tedavi edici amaçla
bilinçsiz antibiyotik kullanımının engellenmesi, dar spektrumlu
antibiyotik kullanımının tercih edilmesi ve antibiyotik uygulanan
hayvanlarda,kullanılanantibiyotiğ inorganizmadanatılmasü releri
tamamlanmadan hayvanların kesilip tü ketime sunulmaması gerektiğ i,Campylobacterspp.enfeksiyonlarınıntedavisindeilkseçenekolarakkullanılaneritromisineilavetenazitromisininvedoksisiklinindealternatifolarakkullanılabileceğ ikanısınavarıldı.
Anahtar kelimeler: Broiler, Campylobacter jejuni, kinolon,
makrolid,tetrasiklin
64
phenotypical tests and multiplex Polymerase Chain Reaction
(mPCR)method.TheantibioticresistanceandMICvaluesofC.jejuni
isolatesweredetectedwithdiskdiffusionandEtestmethod,respectively.Inaddition,theantibioticresistanceswereexaminedbyusing
PCRandsequencing.
Eightyoneof100samplescollectedinJuneand77of100samplesin
January were found to be positive in terms of Campylobacter spp.
withphenotypicaltests.ByusingofmPCR,88and68 C.jejuniisolates were detected from Campylobacter spp. isolates during June
2012 and January 2013 terms, respectively. According to isolation
periods were not statistically (Qhi(P>0,05). In disk diffusion test, while, the highest resistance rates
were observed as nalidixic acid (78,4% -
(67,1%-86,7%)andtetracycline(55,6%-64,7%),thelowestresistance rates as azithromycin (1,1% - 4,4%), doxycycline (2,2% -
1,4%) and erythromycin (11,3% - 4,4% ), for the period June and
January,respectivelyweredetermined.ItwasdeterminedthatEtest
results were compatible with disk diffusion test. The differences
betweenJuneandJanuaryperiodsintermsofthetestedantibiotics
werenotstatisticallyimportant(P>0,05).Whilst,chromosomaltetO
gene was shown in June and January isolates at 88 % and 85,7 %
rates, plasmid mediated tetO gene was found at 93,7% and 85,7%
rates,respectively.Inmacrolideresistance,whileA2075Gmutation
wasdetectedin23SrRNAatrates18,4%and14,8%ofJune2012
and January 2013 isolates, A2074C mutation was not observed at
anyofJune2012andJanuary2013isolates,respectively.When,in
chromosomalquinoloneresistance,themutationsingyrAgenewere
detected at rates of 83,5% and 81,8% in June 2012 and January
2013isolates,respectively,qnrgeneexaminedforplasmidmediated
quinoloneresistancewasfoundinnoneofC.jejuniisolates.QuinoloDNAsequencing.While,Tre-86-Ilemutationwasfoundinquinolone
resistant isolates with sequencing, but these mutations were not
detectedinsusceptibleisolates.Additionally,A2075Gmutationwas
detectedinmacrolideresistantisolates.However,A2074Cmutation
was not observed in any isolates by using sequencing. It was not
observedthatnoneofthemacrolidesusceptibleisolateshadanyof
thesetwomutations.
In conclusion, due to the presence of antibiotic resistant C.jejuni
detectedinchickenmeat,protectivemeasuresshouldbetaken,for
therapeuticpurposes,themisusingofantibioticsmaybeprohibited
and the using of narrow-spectrum antibiotics may be preferred, in
animals treated with antibiotics, before the completion of
withdrawal period of antibiotics from organisms, animals may not
becutandpresentedforconsumption.Besides,it isconsideredthat
in the treatment of Campylobacter infections, azythromycin and
doxycycline may be used as alternative to erythromycin is the
drugofchoice.
Key words: Broiler carcass, Campylobacter jejuni, macrolide,
quinolone,tetracycline
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
TEZÖZETLERİ
HAFİFŞİŞMANVEŞİŞMANERGENLEREYARATICIDRAMAİLEVERİLENBESLENMEVEEGZERSİZEĞİTİMİNİN
BİLGİ,TUTUMVEDAVRANIŞLARAETKİSİ
THEEFFECTOFNUTRITIONANDEXERCISETRAININGSPROVIDEDTOOVERWEIGHTANDOBESETEENAGERS
THROUGHCREATIVEDRAMAUPONTHEIRKNOWLEDGE,ATTITUDE,ANDBEHAVIORS
MukaddesDEMİRACAR
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
HemşirelikAnabilimDalı
DoktoraTezi,Haziran2014
Danışman:Doç.Dr.MeralBAYAT
ErciyesUniversity,GraduateSchoolofHealthSciences
DepartmentofNursing
Ph.D.Thesis,June2014
Supervisor:Assoc.Prof.Dr.MeralBAYAT
ÖZET
ABSTRACT
.
maileverilenbeslenmeveegzersizeğ itimininbilgi,tutum
ve davranışlara etkisini değ erlendirmek amacıyla, randomize,kontrollü ,zamanserilidesendedeneyselbirçalışma
olarak yapılmıştır. Çalışmayailkö ğ retim 6. ve 7. sınıfa de-
Thisexperimentalstudywasconductedasrandomizedand
controlledontimeseriespattern,inanefforttoevaluatethe
effect of trainings of nutrition and exercise provided to
overweight and obese teenagers through creative drama,
upon their knowledge, attitudes and behavior. Seventy-six
overweight/obese teenagers studying at 6th and 7thgrades
ofupper primarywereincludedinthestudy (38study,38
control group). The approval of ethical committee and the
institution, written approval of teenagers and deed of consent of the parents were provided for this study. Training
coursesthatweredesignedbasedonthemethodofcreative
kontrolgrubu)alınmıştır.Çalışmaiçinetikkurulvekurum
onayı, ergen ve annelerinin yazılı onamları alınmıştır. Yaratıcıdramayö nteminegö redü zenlenmişeğ itimler12-13
kişilik gruplar ile beş oturumda yapılmış ayrıca annelere
de bir oturumda eğ itim verilmiştir. Veriler Aileler için
Anket Formu, Ergenler için Bilgi Formu, Beslenmeiletoplanmıştır.Çalışmavekontrolgrubuna;vü cutağ ırlığ ı,
boyuzunluğ uvebelçevresiö lçü mü ,bilgiformuveö lçekler eğ itimin başında, bitimindeve 14. haftasında uygulanmıştır. Veriler, bilgisayar ortamında tanımlayıcı istatistikler,Cronbachα,ki-kare,tekrarlıö lçü mlerdeikiyö nlü varyans analizi, Bonferroni, Friedman, Wilcoxon, bağ ımsız
gruplardaikiö rneklemttestlerikullanılarakdeğ erlendirilmiştir.
Eğ itim ö ncesinde çalışma ve kontrol grubundaki ergenlerinbilgi,tutum,ö ğ ündü zenivesağ lıklıbeslenme-egzersiz
davranış puanları arasındaki farkın ö nemli olmadığ ı
(p>0.05),eğ itimsonrasındaçalışmagrubundakiergenlerin
puanlarının arttığ ı ve aralarındaki farkın ö nemli olduğ u
(p<0.05), grup-zaman etkileşiminin de anlamlı olduğ u
bulunmuştur(p<0.05).
vü cut ağ ırlığ ı ve bel/boy oranı çalışma sonrasında istatistiksel olarak ö nemli dü zeyde azalmış (p<0.05), kontrol
grubunda ise bel çevresi ve vü cut ağ ırlığ ı ö lçü mlerinde
vü cut ağ ırlığ ı, bel çevresi ve bel/boy oranı ö lçü mlerinde
çalışma grubundaki değ işimin kontrol grubuna gö re anlamlıolmadığ ı(p>0.05),grup-zamanetkileşimininanlamlı
olduğ ubulunmuştur(p<0.001).Çalışmagrubundaçalışma
başında%47.4ergeninşişmanolduğ u,çalışmasonrasında
bu oranın % 26.3’e dü ştü ğ ü (p<0.001), kontrol grubunda
ise ö lçü mler arasında değ işim olmadığ ı bulunmuştur
(p>0.05).
Bu sonuçlar doğ rultusunda gü nü mü zde ö nemli bir sorun
olan şişmanlığ ın azaltılmasına yö nelik hemşirelerin ve
ekip ü yelerinin ergenlere yaratıcı drama gibi interaktif
ö ğ retim yö ntemleri kullanarak sü rekli ve dü zenli eğ itim
vermeleriö nerilmektedir.
Anahtar kelimeler: Yaratıcı drama, eğ itim, şişmanlık, ergen,
hemşire.
teenagers(n=12-13)andmothersweretrainedinasession
inthisstudy,aswell.Thedatawerecollectedthroughquestionnaire for the families, through information form, nutrition-exerciseattitudescale,andnutrition-exercisebehavior
scale for the teenagers. Body weight, height, and waist circumference measurement, information form and scales
were performed at the beginning of training, at the end of
trainingandinthe14thweek.Thedatawereevaluatedusing
descriptivestatisticsinsoftware,Cronbach’sAlpha(α),chisquare, two-way variance analysis in reweighted measurements, Bonferroni, Friedman, Wilcoxon; and the two samplesinindependentgroupswereevaluatedusingt-tests.
Thedifferencebetweenknowledge,attitude,mealorderand
healthynutrition-exercisebehaviorscoresofthe teenagers
before the training (p>0.05); however, after training the
scores of teenagers in the study group increased and the
groupBodymassindex(BMI),bodyweight,waistcircumference/
determinedin waist circumferenceandbodyweightmeasurementsofthecontrolgroup(p<0.05).ThechangeinBMI,
body weight, waist circumference/height measurements in
group(p>0.05),howevergroupcant(p<0.001).Inthestudygroup,whereas47.4%teenagers were obese at the beginning of the study, this rate decreased to 26.3% (p<0.001); and no change was found betweenmeasurementsinthecontrolgroup(p>0.05).
Inaccordancewiththeseresults,ithasbeensuggestedthat
nurses and team members should provide permanent and
regulartrainingsusinginteractiveteachingmethodssuchas
creativedrama,fordecreasingtheadolescence-periodobesityasarecentimportantproblem.
Key words: Creative drama, education, obesity, teenager,
nurse.
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
65
TEZÖZETLERİ
ERCİYESÜNİVERSİTESİTIPFAKÜLTESİHASTANELERİNDEÇALIŞANHEKİMDIŞISAĞLIKPERSONELİNDE
UYKUKALİTESİVEİLİŞKİLİFAKTÖRLER
SLEEPQUALITYANDASSOCIATEDFACTORSAMONGNON-PHYSICIANHEALTHPERSONNELWORKINGINERCIYESUNIVERSITYMEDICALFACULTYHOSPITALS
CevriyeÖZDEMİR
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
HalkSağlığıAnabilimDalı
YüksekLisansTezi,Haziran2014
Danışman:Prof.Dr.AhmetÖZTÜRK
ErciyesUniversity,GraduateSchoolofHealthSciences
DepartmentofPublicHealth
MSc.Thesis,June2014
Supervisor:Prof.Dr.AhmetÖZTÜRK
ÖZET
ABSTRACT
ken temel gereksinimlerden biri de hiç şü phesiz ki
‘uyku’dur. Uykunun yetersiz olması ya da kalitesinin
hatsızlıklara neden olabilir. Sağ lık personeli zaman
zamanvardiyalıyadadü zensizçalışabilenvebunedenle uyku kalitelerinin bozulma ihtimali yü ksek olan bir
gruptur. Bu araştırma hekim dışı sağ lık personelinin
uyku kalitesi ve ilişkili faktö rleri saptamak amacıyla
Eylü l2012-Nisan2013tarihleriarasındayapılmışkesitselbirçalışmadır.
makta olan 745 hemşire, 22 eczacı, 15 diyetisyen, 87
biyolog, 324 sağ lık teknikeri/teknisyeni, 130 laboratuar personeli olmak ü zere toplam 933 sağ lık çalışanı
araştırmanın evrenini oluşturmuştur. Verilerin toplankullanılmıştır.Verilerin analizinde ki-kare testi kullanılmış olup, p<0,05
değ erleriistatistikselolarakanlamlıkabuledilmiştir
puanortalamaları7.96±3.57olup,beşvedahayü ksek
puanalanlarınyaniuykukalitesikö tü olanlarınoranı%
72.6olarakbulunmuştur.
Uyku kalitesi; 35 yaş ve altında olanlarda, kadınlarda,
evli olmayanlarda, hemşirelerde, dâ hili ve cerrahi bö lü mler, acil servis ve yoğ un bakımlarda çalışanlarda,5
yılvealtıçalışmayılınasahipolanlarda,gecevegü ndü z
değ işenvardiyasistemiileçalışanlarda,haftada41saat
veü stü çalışanlarda,gecenö betitutanlarda,evdebakımamuhtaçbiryakınıolanlarda,genelsağ lıkdurumunu
kö tü olarak değ erlendirenlerde, gece 3 bardak ve ü stü çay tü ketimi olanlarda, kahve tü ketenlerde, dü zenli
egzersiz alışkanlığ ı olmayanlarda, gü ndü z uyuma alışkanlığ ı olanlarda ve yatmadan bir şeyler yeme- içme
alışkanlığ ıolanbireylerdedahakö tü olduğ usaptanmıştır(p<0.05).Uykukalitesikö tü olanbireylerdegü ndü z
uykululukdurumunundahafazlaolduğ utespitedilmiştir.
Hekim dışı sağ lık personelinde uyku kalitesinin kö tü olma oranları oldukça yü ksek olup, riski daha yü ksek
saptanan gruplara yö nelik eğ itimlerle ve ö zellikle vardiyalı çalışanlarda ya da çalışılan birimlerde yö netimlerce yapılacak dü zenlemelerle daha iyi uyku kalitesininsağ lanabileceğ idü şü nü lmektedir.
Anahtar kelimeler: Sağ lık çalışanları, uyku kalitesi, Pittsburghuykukaliteö lçeğ i,Epworthuykululukö lçeğ i
66
One of the basic needs which need to be met in order
anindividualtocontinueitsexistenceissleep,without
anydoubt. Lack of sleep or deterioration of its quality
might result in various physical or emotionalailments
in individuals. Healthcare personnel is a group which
sometimes might work in shifts or on irregular basis,
andthereforehasahighprobabilityofdeteriorationof
sleep.
Atotalof933healthcarepersonnelworkingattheHospitals of Erciyes University Medical School including
745nurses,22pharmacists,15dietitians,87biologists,
324paramedics/healthcaretechnicians,and130laboratorypersonnelconstitutetheuniverseoftheresearch.
In the data collection, Pittsburgh Sleep Quality Index
(PSQI)andEpworthSleepinessScale(ESS)wereused.
In analyzing the data, chi-square test was used, and p
ThePittsburghSleepQualityIndexpointmeanofthose
whohaveparticipatedinthestudywas7.96±3.57,and
more,inotherwordswhohavepoorsleepqualitywas
foundtobe72.6%.
who are 35 years and under, women, the unmarried,
nurses, those working at internal and surgical departments, emergency services and intensive care units,
who work on changing day and night shift system,
working 41 hours or more per week, having night duties,whohaveadependantrelativeathomeinneedof
care,whoassestheiroverallhealthstatusaspoor,who
have the habit of having tea 3 cups or more at night,
consume coffee, who lack the habit of a regular exercise,whohavethehabitofdaytimesleeping,andthose
whohavethehabitofeatinganddrinkingbeforebedtime(p<0.05).Inindividualswithpoorsleepquality,it
has been established that the situation of daytime
sleepinessismorecommon.
The percentage of poor sleep quality of non-physician
health personnel is rather high, and it is considered
that by trainings intended for the groups which the
rangementstobemadebythemanagementsespecially
for the individuals who work in shifts or at the units
workedfor.
Keywords:Healthcareworkers,sleepquality,Pittsburgh
sleepqualityindex,TheEpworthsleepinessscale
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
TEZÖZETLERİ
YO UNBAKIMÜN TELER NDE ÇALIŞANHEMŞ RELERDEHASTAGÜVENL KÜLTÜRÜNÜNBEL RLENMES
DETERMINATIONOFPATIENTSAFETYCULTUREOFNURSINGSTAFFININTENSIVECAREUNITS
ZühalYILMAZ
ErciyesÜniversitesi,Sağ lıkBilimleriEnstitüsü
HemşirelikAnabilimDalı
YüksekLisansTezi,Temmuz2014
Danışman:Yrd.Doç.Dr.SongülGÖR Ş
ErciyesUniversity,GraduateSchoolofHealthSciences
DepartmentofNursing
MSc.Thesis,July2014
Supervisor:Asist.Prof.SongülGÖR Ş
Bu çalışma yoğ un bakım ü nitelerinde çalışan hemşirelerde hasta gü venliğ i kü ltü rü nü belirlemek amacıyla
yapılmıştır. Araştırmaya Erciyes niversitesi Sağ lık
AraştırmaveUygulamaMerkeziYoğ unBakım niteleri
ileKayseriEğ itimveAraştırmaHastanesiYoğ unBakım
nitelerinde çalışan ve araştırmayı kabul eden 316
hemşire alınmıştır. Araştırmanın verileri anket formu
ve Hasta Gü venliğ i Kü ltü rü Hastane Anketi aracılığ ıyla
toplanmıştır. Araştırmada etik kurulonayı,kurum izni
ve araştırmaya katılan hemşirelerden sö zlü ve yazılı
oluru alınmıştır. Araştırmada elde edilen verilerin
normal dağ ılımına Shapiro-Wilk testi ile bakılmıştır.
Verilerin değ erlendirilmesinde yü zdelik dağ ılım ve
Mann-Whitney Utestikullanılmıştır. lçeğ ingü venirliğ inin belirlenmesinde Cronbach alfa katsayısına bakılmıştır. statistiksel değ erlendirmede p<0.05 anlamlı
olarakkabuledilmiştir.
Yoğ unbakımlardahemşirelerin%13.6’sıhastagü venliğ ini tehdit eden bir durumla karşılaştıklarını; bu durumların%48.8’nidü şmeler,%16.3’ü nü ilaçuygulamalarına ilişkin hatalar, %16.3’ü nü hastane enfeksiyonları, %11.6’sını tıbbi ekipman ve %7.0’sini ise tedavi
ihmali ve iletişim kaynaklı hatalar olduğ unubildirmişlerdir.Hemşirelerin%88.0’ıson12ayiçerisindehiçbir
olayrapor bildirimi yapmazken, çalıştıklarıbirimi hasta gü venliğ i konusunda “Kabul edilebilir” (%43.0) dü zeydeolarakdeğ erlendirmişlerdir. Hastagü venliğ ikü ltü rü hastane anketini oluşturan 12 alt alan içinde en
yü ksek katılım“ niteler içinde ekip çalışması” alt alanına, en dü şü k katılım ise “Hataya karşı cezalandırıcı
olmayan yanıt” alt alanına ait olmuştur. Ayrıca hizmet
içi eğ itim alan, kadrolu statü de çalışan, işinden memnunolanvehastagü venliğ iyö netmeliğ inibilenhemşirelerin hasta gü venliğ i kü ltü rü hastane anketi alt
boyutlarına verdikleri olumlu cevap yü zdeleri daha
yü ksekbulunmuştur.
Sonuçolarakyoğ unbakımhemşirlerindehastagü venliğ i kü ltü rü nü n geliştirilmesi için kapsamlı eğ itimlerin
verilmesi, daha kapsamlı ve uygulamalı çalışmaların
yapılmasıö nerilmektedir.
The present study was conducted to determine the
patient safety culture in nurses working at intensive
care units. In the study, 316 nurses who worked at
intensive care units of Health Practice and Research
Center of Erciyes University and Kayseri Education
and ResearchHospitalandwhoacceptedtoparticipate were recruited. Data of the study were collected
with questionnaire form and Patient Safety Culture
Hospital Questionnaire. Ethical approval, institutional
permission and verbal and written consent from nurses were obtained. Normal distribution of the data
was checked with Shapiro-Wilk test. Data were
analyzedwithpercentages and Mann-Whitney U test.
Cronbach alpha coef icient was used for reliability of
thescale.p<0.05wassetasstatisticallysigni icant.
Intheintensivecareunits,13.6%ofnursesstatedthat
theymet witha situationthreateningpatientsafety, of
these situations; 48.8% werefalls, 16.3% were mistakes about drug administration, 16.3% were hospital
infections, 11.6% were about medicinal equipments
and
7.0%weremistakesabouttreatmentandcommunication.Of thenurses,88.0% havenotreportedany
case within the last 12 months, they evaluated their
unit as “acceptable” about patient safety (43.0%).
Among 12 sub-dimensions of Patient Safety Culture
HospitalQuestionnaire, the highest agreement was on
“team work in the units”, the lowest agreement was
on“non-punitiveresponseagainst mistake”. Also, positive answer percentage towards sub- dimensions of
Patient SafetyCultureHospitalQuestionnaire was higher in nurses who received in-service education, worked with permanent employee status, were satis ied
withtheirjobandwhoknewpatientsafetylegislation.
Consequently, comprehensive educations in order to
improve patient safety culture of nurses working at
intensivecareunitsshouldbegivenandmorespacious
andpracticalstudiesshouldbeconducted.
Anahtarkelimeler:Yoğ u nbakım,hastagü venliğ i,hemşirelik
Keywords:Intensivecare,patientsafety,nursing
ÖZET
ABSTRACT
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
67
TEZÖZETLERİ
RAKETSPORLARINDAKİSPORCULARINFİZİKSELVESEÇİLMİŞTEMELMOTORİKÖZELLİKLERİNİN
KARŞILAŞTIRILMASI
THECOMPORISONOFRACQUETSPORTSPLAYERS’PHYSICALANDSELECTEDMOTORSKILLS
ÖzdemirATAR
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
BedenEğitimiveSporAnabilimDalı
YüksekLisansTezi,Mayıs2014
Danışman:Doç.Dr.HürmüzKOÇ
ErciyesUniversity,GraduateSchoolofHealthSciences
DepartmentofPhysicalEducationandSport
MSc.Thesis,May2014
Supervisor:Assoc.Prof.HürmüzKOÇ
ÖZET
ABSTRACT
Bu çalışmanın amacı, raket sporlarındaki sporcuların
Theaimofthisstudywastocomparethephysicaland
selected motor skills of athletes performed racket
sports.Volunteerswhichwere14Tennisplayersand12
BadmintonplayersstudiedcoachingeducationdepartmentofPhysicaleducationandSportCollageofErciyes
University were participated volunteerly. Age, Body
height, Body weight, Body Mass Index, Flexibity,
Handgrip, reaction times, Vertical Jump, Anaerobic
Power, upper extremity velocity, Static ve Dynamic
Balance, Agility and sprint parametres were measured.DatawererecordedbySPSS16.0packageprogram.
One-Sample Kolmogorov-Smirnov test was performed
for distribution normality of data. Unpaired t test was
performed for comparison between branches.While
statistically difference was not found at Age, Body
height, Body weight, Body Mass Index, Dynamic Balance, food reaction time, vertical jump, handgrip and
agilityparametres(p>0,05),Statisticallydifferencewas
found at Static Balance, Hand reaction, Flexibility and
sprint parametres (p<0.05) Also, Statistical difference
was found upper extremity velocity parametres
(p<0.001). As a result of the study, it was found that
somephysicalandselectedmotorskillsofathletesperformed tenis and badminton, was shown similarity. It
wasthoughtthatdifferenceofphysicalandsomemotorskillswerebasedondimensionsofbothsportareas
andmaterialswhichwereusedsuchasracquetandball
Beden Eğ itimi Spor Yü ksekokulu, Antrenö rlü k eğ itimi
bö lü mü nde eğ itim alan 14 tenis ve 12 badminton ö ğ rencisi gö nü llü olarak katılmıştır. Çalışmaya katılan
neklik,PençeKuvveti,Elveayakreaksiyon,Dikeysıçrama,Anaerobikgü ç,Harekethızı,StatikveDinamikDenge,Çeviklikö lçü mleriyapılmıştır.VerilerSPSS16.0adlı
paket program ile kayıt edilmiştir. Verilerin normal
dağ ılım için One-Sample Kolmogorov-Smirnov testi
kullanılmıştır. Branşlar arası karşılaştırmada Unpaired
t testi kullanıldı. P<0.05 değ eri anlamlı kabul edildi.
Çalışmayakatılangö nü llü lerinyaş,boykilo,VKI,Dinamikdenge,Ayakreaksiyonu,Dikeysıçrama,Anaerobik
gü ç,PençekuvvetiveÇeviklikParametrelerindeanlamlıfarklılıkbulunmazken(p>0.05),Statikdenge,elreaksiyonu, Esneklik, Sü rat parametrelerinde Anlamlı farklılık tespit edilmiştir (p<0.05) Ayrıca, Kol hareket hızı
veharekethızıparametrelerindeanlamlıfarklılıktespit
edilmiştir(p<0.001).
Sonuç olarak, Tenis ve Badminton sporlarıyla uğ raşan
rinin benzerlik gö sterdiğ i gö rü lmü ştü r. Benzerlik gö s-
mintonsporlarındakifarklısahaö lçü lerindenvekullanılanfarklıö zelliklerdekimateryallerdenkaynaklandığ ı
dü şü nü lmektedir.
Anahtarkelimeler:Tenis,badminton,motorikö zellikler
68
Keywords:Tennis,badminton,motorskills
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
TEZÖZETLERİ
PROTONPOMPAİNHİBİTÖRÜKULLANIMININBLASTOCYSTISHOMINIS’INGÖRÜLMESIKLIĞIÜZERİNEETKİSİ
PROTONPUMPINHIBITORSEFFECTONTHEINCIDENCEOFBLASTOCYSTISHOMINIS
EtemHIZALER
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
ParazitolojiAnabilimDalı
YüksekLisansTezi,Nisan2014
Danışman:Prof.Dr.İzzetŞAHİN
ErciyesUniversity,GraduateSchoolofHealthSciences,
DepartmentofParasitology
MSc.Thesis,April2014
Supervisor:Prof.Dr.İzzetŞAHİN
ÖZET
ABSTRACT
Kontaminesuvegıdalarlafekaloralyollabulaştığ ıbilinen Blastocystis hominis insanlarda en sık rastlanan
bağ ırsakprotozoonlarındanbiridir.B. hominisenfeksiyonunda gö rü len birçok semptom, başka nedenlere
bağ lıolarakortayaçıkangastrointestinalsistemsemptomlarıilebenzerlikgö stermektedir.
Gastrointestinal sistem hastalıklarında sıklıkla kullanılan proton pompa inhibitö rlerinin (PPI), mide pH’ nı
yü kseltir ve bu B. hominis kistlerinin mideden daha
kolaygeçişinisağ layabilir.BunedenlePPIkullanımının
B.hominisenfeksiyonunuartıracağ ıdü şü nü lmektedir.
Blastocystis hominisisoneofthemostcommonintestinalprotozoa,knowntobetransmittedbycontaminated
water and food through fecal oral path. Many symptomswhichareseeninB. hominisinfectionshowsimilaritieswiththegastroinstestinalsymtomsonesarising
frommanyotherreasons.
Proton pump inhibitors (PPI) used in Gastrointestinal
MerkeziHastanesiGastroenterolojipolikliniğ inebaşvuranvePPIkullanan100hasta,kullanmayan100hasta
ve sağ lıklı kişilerden oluşturulan 100 kişilik kontrol
grubuü zerinde,PPIkullanımınınB. hominis’ingö rü lme
sıklığ ıü zerineetkisiniaraştırmakamaçlıyapılmıştır.
Çalışmamızda ele alınan araştırma gruplarından; PPI
kullananların % 24’ ü nde, kullanmayanların %5’ inde
vekontrolgrubunun%8’indeB. hominissaptanmıştır.
PPIkullanangruptaB. hominis gö rü lmesıklığ ıistatistiksel yö nden anlamlı dü zeyde yü ksek bulunmuştur
(X2=8.883,p<0.001).
Protonpompainhibitö rü kullanımıB. hominisgö rü lme
sıklığ ınıetkilemektedir.Çalışmamız;PPIkullanımıileB.
hominis’ in gö rü lme sıklığ ının incelenmesi bakımından
Blastosistosis’inö nemliveolduğ unundeğ erlendirilmesigerektiğ idü şü nü lmektedir.
Anahtar kelimeler: Blastocystis hominis, gastrointestinal
sistem,protonpompainhibitö rü ,nativ-lugol
mayfacilitatestomachpassageofB. hominis.Therefore,
theuseofprotonpumpinhibitorsisthoughttoincreaseofB.hominisinfection.
This research has been performed with 100 patients
who used PPI, 100 patients who did not use PPI, who
were all admitted to Erciyes Universty Research and
Practice Hospital Gastroenterology Department and a
control group of 100 volunteers; in order to evaluate
theeffectofPPIusageonB.hominisinfectionincidence.
Amongresearchgroups,wedetect B. hominisin%24
ofthePPIusers;in%5ofthenon-PPIusers;in8%of
the control group. InPPI using group, B. hominis inci2=8.883
p<0.001).
TheusageofPPIaffectstheincidenceofB. hominis.Our
between the PPI usage and B.hominis infection. We
suggest to consider whether Blastocystosis is imporrointestinaldisorders.
Keywords:Blastocystishominis,gastrointestinalsystem,protonpumpinhibitor,native-lugol
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
69
TEZÖZETLERİ
ROTASYONELVERESİPROKASYONHAREKETİİLEÇALIŞANÜÇFARKLINiTiEĞESİSTEMİİLEYAPILANKANAL
TEDAVİSİYENİLEMEİŞLEMİNİNAPİKALDENTAŞANDEBRİSMİKTARINAETKİSİNİNDEĞERLENDİRİLMESİ
THEEVALUTIONOFAPICALLYEXTRUDEDDEBRISUSINGTHREEDIFFERENTNiTiSYSTEMSWORKINGWITH
CONTINUOUSROTATIONANDRECIPROCATIONINENDODONTICRETREATMENT
AsiyeNurDİNÇER
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
DişHastalıklarıveTedavisiAnabilimDalı
DoktoraTezi,Temmuz2014
Danışman:Doç.Dr.ÖzgürER
ErciyesUniversity,GraduateSchoolofHealthSciences
DepartmentofRestorativeTreatmentandEndodontics
PhD.Thesis,July2014
Supervisor:Assoc.Prof.Dr.ÖzgürER
ÖZET
ABSTRACT
Bu çalışmanın amacı tekrarlayan tedavilerde H-tipi el
eğ esinin, Reciproc, ProTaper ve Mtwo aletlerinin apikalden taşan debris miktarı ü zerindeki etkisini değ erlendirmektir. Çalışmamızda 60 adet çekilmiş insan
mandibular santral ve lateral dişleri kullanıldı. Dişler
Reciproc sisteminin R25 eğ esi ile şekillendirildi, guta
perkakonlarveAHPluskanalpatıiledolduruldu.Daha
sonrasındadişlerrastgele4grubaayrıldı(n=15).Grup
1’de ProTaper Universal Retreatment eğ eleri ile kanal
dolgusu sö kü ldü kten sonra ProTaper Universal F3 ve
F4 eğ eleri ile ileri şekillendirme yapıldı. Grup 2’de
Mtwo retreatment eğ eleri ile kanal dolgusu sö kü ldü ktensonra30.06,35.06,40.06eğ eleriileilerişekillendirme yapıldı. Grup 3’te Reciproc R25 eğ esi ile kanal
dolgusu sö kü ldü kten sonra ileri şekillendirme R40
eğ esiileyapıldı.Grup4’teGates-Gliddenfrezlerive35,
30, 25 numaralı eğ elerle kanal dolgusu sö kü ldü kten
sonra 40 numaraya kadar ileri şekillendirme yapıldı.
Taşan debrisin toplanması amacıyla cam tü pler kullanıldı.Camtü plerkanaldolgususö kü mü ö ncesivesonrasındatartıldıvearadakifarkhesaplanaraktaşandebrisağ ırlığ ıbelirlendi.Ayrıcatekrarlayantedavisü releri
not edildi. Taşan debris miktarı ve tekrarlayan tedavi
sü releri açısından gruplar arasında anlamlı farklılık
bulunmaktadır (p<0.05). Taşan debris miktarı değ erlendirildiğ inde Reciproc grubu istatistiksel olarak anlamlı olmak ü zere diğ er gruplardan daha az taşmaya
neden olmuştur. Mtwo, H tipi ve ProTaper grupları
arasında istatistiksel olarak anlamlı farklılık yoktur.
Tekrarlayan tedavi sü resi değ erlendirildiğ inde ProTaper ve Reciproc grubu H tipi ve Mtwo gruplarına gö re
istatsitikselolarakanlamlıolmakü zeredahahızlıdır.
The aim of this study was to compare the amount of
debris apically extruded during endodontic retreatmentusingHments. Sixty freshly extracted human mandibular incisor teeth were used in this study. All samples were
Anahtarkelimeler:Apikalekstrü zyon,retreatment,reciproc,
Mtwo,ProTaper
Key words: Apical extrusion, Retreatment, Reciproc, Mtwo,
ProTaper
70
-perchaandAHPlussealerbefore
randomly assigned to four groups (n=15). In group 1,
tes-Gliddenbursand35,30,25Hration Hdebris collection. Glass vials were weighed before and
aftergutta-percharemoval.Additionally,timerequired
forretreatmentprocedureswererecorded.Therewere
extuded debris and required retreatment time
(p
amountofapicalextrusionthanothergroups.Thereis
Taper groups. Time results showed that ProTaper and
MtwoandH-
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
TEZÖZETLERİ
TEKRARLAYANTEDAVİLERDEÇÖZÜCÜKULLANIMINAPİKALDANTAŞANDEBRİSMİKTARIÜZERİNEETKİSİ
EVALUTIONOFAPICALLYEXTUREDEDDEBRISINRETREATMENTUSINGDIFFERENTSOLVENTS
BurhanCanÇANAKÇİ
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
DişHastalıklarıveTedavisiAnabilimDalı
DoktoraTezi,Temmuz2014
Danışman:Doç.Dr.ÖzgürER
ErciyesUniversity,GraduateSchoolofHealthSciences,
DepartmentofRestorativeTreatmentandEndodontics
PhD.Thesis,July2014
Supervisor:Assoc.Prof.Dr.ÖzgürER
ÖZET
ABSTRACT
Buçalışmanınamacı,farklıkö kkanaldolgupatları(AH
Plus, Tubli-Seal) ve guta-perka ile yapılmış kö k kanalı
dolgularının yenilenmesinde farklı pat çö zü cü leri
(Resosolv, Endosolv E) ve guta-perka çö zü cü /
yumuşatıcısının (Guttasolv) kullanımının, apikalden
taşandebrismiktarıü zerindekietkisinindeğ erlendirilmesidir. Çalışmamızda 90 adet, yeni çekilmiş, alt santral ve lateral insan dişi kullanıldı. Dişler Resiproc
The aim of this study was to evaluate the weight of
apicallyexturededdebrisinretreatmentofrootcanals
rastgele6grubaayrıldı(n=15).Grup1,2ve3,AhPlus
kanal patı ve guta-perka, Grup 3, 4 ve 5 ise Tubli-Seal
kanalpatıveguta-perkailesoğ uklateralkondensasyon
tekniğ i ile dolduruldu. Dişler etü vde %100 nemli ortamda ve 37 ºC'de 2 ay bekletildi. Daha sonra bü tü n
ö rnekler Myes and Montgomery’nin tarif ettiğ i debris
toplama şişe sisteminin bir değ işkesine yerleştirildi ve
kanaldolgularıProtaperRetreatmenteğ elerikullanılarak sö kü ldü . Sö kü m işlemi sırasında çö zü cü olarak
Grup 1’de Resosolv, Grup 4’de EndoSolv E, Grup 2 ve
5’deiseGuttaSolvkullanıldı.KontrolgruplarıGrup3ve
6’da ise çö zü cü kullanılmadı. Kanal dolgusunun sö kü lmesinden sonra Resiproc #40 .06 NiTi eğ e sistemi ile
Seal)andgutta-perchawithdiffentsolvents(Resosolv,
EndoSolvE,GuttaSolv).Inourstudy,90freshlyextracted, human mandibular santral and lateral teeth were
used. All teeth was preaperad with Resicroc #25 .08
NiTisystem.Allspecimenswererandomlydividedinto
6groups(n=15).InGroup1,2and3,rootcanalswere
-percha and in
-Seal
sealerandgutta-perchausingcoldlateralcondensation
technique. All specimens were stored in 100% humidityand37°Cfor2months.Thenallteethwereplaced
ofthesystemthatMyersandMontgomeryhaddescri-
RetreatmentNiTisystem.Duringretreatmentprocedure,inGroup1Resosolv,inGroup4EndosolvE,andin
Group2and5Guttasolvwereusedassolvent.Incontrolgroups(Group3and6)nosolventwereused.After
ö rnek başına 20 ml distile su kullanıldı. Boş ağ ırlığ ı
daha ö nce tartılmış olan cam şişeler, içerisindeki sıvının buharlaştırılması için 5 gü n boyunca 68 0C’ki etü v
used for each specimen. All the pre-weighted glass
bottleswerestoredinanincubatorat68 0Cfor5days
toevaporatethemoisturebeforeweighingthedrydeb-
Anahtar kelimeler: Tekrarlayan tedavi, apikalden taşan
debris,çö zü cü
Keywords:Retreatment,apicallyextrudeddebris,solvent
debris miktarının ağ ırlığ ını ifade etmektedir. Ayrıca
kö kkanaldolgusununsö kü lmesivekö kkanalınıntekrar şekillendirilmesi sırasında geçen sü re kaydedildi.
Taşan debris miktarları karşılaştırıldığ ında AH Plus
kullanılan gruplar arasında istatistiksel fark bulunurken, Tubli-Seal kullanılan gruplarda Grup 4 ile Grup 5
ve6 arasında fark tespit edilmiştir (p<0.05). Tekrarlayan tedavi için geçen zaman değ erlendirildiğ inde ise
AHPlusgruplarıarasındaenkısasü reGrup1,sonra2
ve 3 gelirken, Tubli-Seal gruplarında ise en kısa sü re
Grup4’tegerçekleşirken,onuGrup5ve6takipetmiştir
(p<0.05).
peration periods were recorded. The weight of the
extracteddebrisresultsshowedthatinAHPlusgroups,
therewerestastiticallydifference.InTubli-Sealgroups,
therewerestatisticallydifferencebetweenGroup4and
5-6. Time results showed that in AH Plus groups, the
shortestresultswereinGroup1,than2and3.InTubliSealgroupstheshortestresultswereinGroup4,than5
and6.
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
71
TEZÖZETLERİ
FRAJİLXSENDROMLUHASTALARDAFMR1GENİNDEKİ3'LÜTEKRARARTIŞSAYIMUTASYONLARIN
BELİRLENMESİ
IDENTIFICATIONOFMUTATIONSWITHINCREASEDNUMBEROFTRIPLETREPEATSINTHEFMR1GENEIN
PATIENTSWITHFRAGILEXSYNDROME
YasinADA
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
TıbbiGenetikAnabilimDalı
YüksekLisansTezi,Temmuz2014
Danışman:Prof.Dr.MunisDÜNDAR
ErciyesUniversity,GraduateSchoolofHealthSciences
DepartmentofMedicalGenetics
M.Sc.Thesis,July2014
Supervisor:Prof.Dr.MunisDÜNDAR
ÖZET
ABSTRACT
FrajilXSendromu(FXS)(OMIM300624);mentalretardasyonların etmenleri arasında Down sendromundan
sonraikincisırada,aileselmentalretardasyonlariçinde
ise birinci sırada yer almaktadır. Toplumda ki sıklığ ı
erkeklerde yaklaşık 4000'de 1 ve kadınlarda yaklaşık
8000'de1olduğ ubilinmektedir.Hastalığ ın%98-99'uX
kromozomuü zerindeyeralanFrajilXMentalRetardasyon 1 (FMR1) genin 5' ucunda translate olmayan bö lgesindeki(UTR)CGG(sitozin,guanin,guanin)tekrarınıngenişlemesininveanormalmetillenmesininnedenidir. %1-2'si ise gendeki delesyonlar ve nokta mutasyonlarıoluşturur.
FXS'nda klinik bulgular mental retardasyon, belirgin
kulaklar, uzun ince bir yü z, davranış bozuklukları, pubertal dö nemdenitibaren makroorşitizm ile karakterizedir.
FXS'dan sorumlu gen Xq27.3'e lokalize edilmiş FMR1
adıverilen38kbbü yü klü ğ ü ndeve17ekzoniçerenbir
gendir.Gen,5' ucundaCpGmetilasyonbö lgesivebirinci ekzon'un translate olmayan kısmında CGG ü çlü tekrarları içerir. Yaklaşık 4.4 kb bü yü klü ğ ü ndeki mRNA
70kDa'lukbirproteinsentezler.FMR1proteini(FMRP)
çeşitli dokularda ifade edilen ve nö ronal ve zihinsel
gelişimiiçingerekli,mRNAbağ layıcıbirproteindir.
CGGtekraruzunlukları~5-~44arasındaolanbireyler
normaldir yani etkilenmemişlerdir, ~45 - ~54 arasındaki tekrarlar "gri bö lge" denir, ~55 - ~200 arasında
olan bireyler premutasyon yani FXS taşıyıcısıdır. Premutasyon bayanlarda olursa bir sonraki jenerasyona
aktarılırken mayoz bö lü nme esnasında CGG dizileri
artarakbireyegeçer"bunaantisipasyondenir"buşekliyle bu sendromun kalıtımı diğ er X'e bağ lı kalıtımlı
hastalıklardan farklı kılar. 200 ve ü zeri CGG tekrarı
Fragile X Syndrome (FXS) (OMIM 300624) ranks in
secondplace,afterDownsyndrome,amongthefactors
FXSileilişkilendirilir.
Buçalışmada,FMR1SizingPCR(ABBOTT)veSNPDE-
retardation.Itisseenabout1in4000amongmenand
1in8000amongwomen.ThefragileXmentalretardation 1 (FMR1) gene at the 5' non-translated region
(UTR) CGG (cytosine, guanine, guanine) repeat expansionandabnormalmethylationarethecausefor98-99
%ofthediseaseonXchromosomewhile1-2%aredue
todeletionsandpointmutationsinthegeneforms.
retardation,prominentears,along,thinface,behavior
disorder,andmacroorchidismsincepuberty.
The gene responsible for FXS is called FMR1, which is
localizedonXq27.3and38kbinsize,andcomprised
of17exons.Thegene,whichisatthe5'regionandthe
-translatedportion,
includes CGG triplet repeat. mRNA in size of approximately 4.4 kb synthesizes 70 kDa protein. FMR1
protein (FMRP), which is expressed in various tissues
required for neuronal and mental development, is an
mRNAbindingprotein.
CGGrepeatlengthof~5-~44isconsiderednormal,
meaningthatindividualsarenotaffected,whilerepeat
lengthof~45-~54iscalledas"grayzone".Individuals with repeat length of ~ 55 - ~ 200 are thought to
have premutation, meaning that they are FXS carriers.
If premutation occurs in women during meiosis division, then it is transferred to the next generation of
individualsthroughincreasedCGGsequences.Thisis
called"anticipation".Thisformofinheritancemakes
this syndrome different from other inherited X-linked
diseases.Individualswith200ormoreCGGrepeatsare
neden olan FMR1 genindeki CGG trinü kleotit sayısı ve
metilasyondurumuincelendiveyaşortalaması7.5olan
50çocuktan40erkekçocuğ un%15'ındefullmutasyon,
%2.5'inde premutasyon, ve 1 erkek çocukta ise size
mozaisizmi bulunmuştur. Toplam 9 kız çocuğ unun %
11.11'inde full mutasyon gö rü lmü ştü r. Full mutasyonlarınhepsidemetillenmişolarakbulundu.
tedwithFXS.
Inthisstudy,byusingFMR1SizingPCR(ABBOTT)and
SNPDETECTIVEFragileX(GML)kits,CGGtrinucleotide
number and methylation status in FMR1 gene, which
causeFXS,wereexamined.Outof50childrenwitha
mean age of 7.5, 15% of 40 boys had full mutation,
2.5% of them had premutation, and mosaicism was
found in one boy. Full mutation was observed in
11.11%of9girlsinthestudy.Allmutationswerefound
tobefullymethylated.
Anahtar kelimeler: FMR1 Geni, Frajil X Sendromu, Xq27.3,
MentalRetardasyon,CGGü çlü tekrarı
Keywords:FMR1gene,theFragileXSyndrome,Xq27.3,MentalRetardation,CGGtripletrepeat
72
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
TEZÖZETLERİ
DİZOSTEOARTRİTİOLANBİREYLERİNBELBÖLGESİNEUYGULANANZENCEFİLLİBÖBREKKOMPRES
UYGULAMASININAĞRIDÜZEYİVEFİZİKSELFONKSİYONLARAETKİSİ
THEEFFECTOFGINGERKIDNEYCOMPRESSAPPLIEDTOWAISTREGIONUPONTHEPAINLEVELANDPHYSICALFUNCTIONSOFINDIVIDUALSWITHKNEEOSTEOARTHRITIS
SibelŞENTÜRK
ErciyesÜniversitesi,SağlıkBilimleriEnstitüsü
HemşirelikAnabilimDalı
DoktoraTezi,Temmuz2014
Danışman:Prof.Dr.SultanTAŞCI
ErciyesUniversity,GraduateSchoolofHealthSciences
DepartmentofNursing
PhDThesis,July2014
Supervisor:Prof.Dr.SultanTAŞCI
ÖZET
ABSTRACT
Romatizmal hastalıklar arasında dü nyada en yaygın
olarak gö rü len dejeneratif eklem hastalıklarından biri
olanosteoartritinenö nemlisemptomuağ rıdır.Buçalışma, diz osteoartriti olan bireylerin bel bö lgesine yedi
Themostimportantsymptomoftheosteoarthritiswhich
is one of the most commonly seen degenerative joint
diseases among the rheumatic diseases is pain. A randomizedcontrolledstudywasconductedinordertodetermine the effect of ginger kidney compress applied to
waistregionfor30minutesforsevendaysuponthepain
levelandphysicalfunctionsofindividualswithkneeosteoarthritis. The study was conducted with 124 patients;
43 being assigned to ginger kidney compress
(intervention-I) group, 41 being assigned to hot compress (intervention-II) group and 40 being assigned to
control group. Ethical approval and informed consents
were obtained. The data were gathered with patient description form, Visual Analogue Scale (VAS)-Pain and
WOMAC Osteoarthritis Index. The forms were adminis-up)andattheend(7th
day,secondfollow-up)ofintervention.Theintervention-I
group received ginger kidney compress while intervention-II group received hot compress and control group
received no intervention. At the end of 7-day intervention;facetofaceinterviewsweremadefortheintervention-I group and the intervention-II group while control
groupreceivedphoneinterviewsandformswereadministered again and p value of less than 0.05 was consid-
selfonksiyonlaraetkisinibelirlemekamacıylarandomize kontrollü çalışma olarak yapılmıştır. Araştırma, 43
-I),41sıcakkompres (mü dahale-II) ve 40 kontrol grubuna alınan 124
hasta ile yü rü tü lmü ştü r. Çalışmada kurum izni, etik
kurul onayı ve bireylerden gö nü llü olur formu alınmıştır. Araştırmada veriler, hasta tanıtım formu, Visual
AnalogSkala(VAS)kullanılaraktoplanmıştır.Formlar,uygulamanınbaşlangıcında(birinciizlem)veuygulamanınbittiğ igü n(7.gü n
-ikinciizlem)içerisindeuygulanmıştır.Mü dahale-Igru-II grubuna
sıcak kompres yapılmış, kontrol grubuna ise herhangi
bir girişimde bulunulmamıştır. Yedi gü nlü k uygulama
sonundamü dahale-Ivemü dahale-IIgrubuileyü zyü ze,
kontrol grubundaki bireylerle de telefonla gö rü şü lerek
formlaryenidenuygulanmışvep<0.05değ eriistatistikselolarakanlamlıkabuledilmiştir.
AraştırmakapsamınaalınangruplararasıbirinciizlemdeVASları puanlar arasında bir fark bulunmazken ( p>0.05),
ikinciizlemdegruplararasıVAS-Ağ rıveWOMACOsteo-
selolarakileridü zeydeanlamlıbirfarkolduğ usaptanmıştır (p
kompres grubundaki bireylerin VAS-Ağ rı ve WOMAC
res ve kontrol grubundaki bireylere gö re daha fazla
azaldığ ı ve bu farkın istatistiksel olarak anlamlı olduğ u
belirlenmiştir(p<0.001).
masının, sıcak kompres uygulamasına gö re daha etkili
olduğ u,VASrınıazalttığ ı,dizosteoartritlibireylerderahatlamasağ ladığ ıvehemşirelerindizosteoartritlibireylerdekolay-
relik uygulaması olduğ u saptanmıştır. Bu sonuca gö re,
dizosteoartritiolanbireylerdeağ rışiddetiniazaltmave
kompresuygulamasınınkullanımalanlarınınarttırılmasıveyaygınlaştırılmasıö nerilmektedir.
Anahtar kelimeler:
-up;therewerenodifferencesinterms
of intergroup VAS-Pain scores and WOMAC Osteoarthritis Index scores (p>0.05) while in the second follow-up;
therewerestatisticallyimportantdifferencesintermsof
intergroup VAS-Pain scores and WOMAC Osteoarthritis
Index scores (p<0.001). Following the analyses; it was
foundoutthatVAS-PainscoresandWOMACOsteoarthritis Index scores reduced more among the individuals in
whom ginger kidney compressions were made as compared to those in the hot compress group and control
(p<0.001).
Insum;gingerkidneycompressweremoreeffectivethan
hotcompressanddecreasedVAS-PainscoresandWOMAC Osteoarthritis Index scores more and led to a relief
amongthepatientswithkneeosteoarthritis.Therefore,it
was concluded that ginger kidney compress could be
usedbynursesasananthroposophicnursingpracticefor
thepatientswithkneeosteoarthritis.Itisrecommended
thatareasofusageofgingerkidneycompressshouldbe
popularized and investigated in order to decrease pain
severity and increase physical functions among the patientswithkneeosteoarthritis.
Key words: Knee osteoarthritis; pain; physical function;
gingerkidneycompress;nursing
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
73
TEZÖZETLERİ
PERKÜTANKORONERGİRİŞİMYAPILANHASTALARDAFEMORALBÖLGEYEBUZTORBASIUYGULAMANIN
AĞRIÜZERİNEETKİSİ
EFFECTOFICEBAGAPPLICATIONTOFEMORALREGIONONPAININPATIENTSUNDERGOINGPERCUTANEOUSCORONARYINTERVENTION
SevdaKORKUTBAYINDIR
ErciyesÜniversitesiSağlıkBilimleriEnstitüsü
HemşirelikAnabilimDalı
YüksekLisansTezi,Temmuz2014
Danışman:Yrd.Doç.Dr.GülsümNihalGÜLESER
ErciyesUniversity,GraduateSchoolofHealthSciences
DepartmentofNursing
MSc.Thesis,July2014
Supervisor:Asist.Prof.GülsümNihalGÜLESER
ÖZET
ABSTRACT
Araştırma,perkü tankoronergirişimyapılanhastalarda
femoral bö lgeye buz torbası uygulamanın ağ rı ü zerine
etkisini belirlemek amacıyla yapılmış randomize kontrollü deneyselbirçalışmadır.
Araştırma çalışma kriterlerine uyan deney grubunda
52,kontrolgrubunda52olmakü zeretoplam104hasta
iletamamlanmıştır.Veriler,araştırmacıtarafındanHastaTanıtımFormu,SayısalDeğ erlendirmeSkalası(NRS)
veYaşamBulgusuTakipFormukullanılaraktoplanmıştır. Deney grubundaki hastalarda kateter çıkarılmadan
ö nce femoral bö lgeye 20 dakika buz torbası ile soğ uk
uygulamayapılmışvekateterbuztorbasıkaldırıldıktan
hemensonrakliniktesadecebuişilesorumlubirhemşiretarafındançıkarılmıştır.Kontrolgrubundakihastalara ise kliniğ in standart uygulaması yapılmıştır. Bu
standart uygulamaya gö re kateter, gö revli hemşire tarafındanfemoralbö lgeyeherhangibiruygulamayapılmaksızın çıkarılmıştır. Hastaların deneyimlediğ i ağ rı,
kateterçıkarılmadanö nce,kateterçıkarılırkenvekateter çıkarıldıktan sonra hemşire kateter bö lgesine basınçuygularkenolmakü zeretoplamü çkezdeğ erlendirilmiştir. Kateter çıkarılmadan ö nce ifade edilen NRS
puanı “NRS1”, kateter çıkarılması sırasındaki “NRS2”,
kateter çıkarıldıktan sonra hemşire kateter bö lgesine
basınç uygularken ifade edilen NRS puanı ise “NRS3”
olarakdeğ erlendirilmiştir.
Çalışmada etik kurul onayı ile bireylerden yazılı bilgilendirilmiş olur alınmıştır. Verilerin istatistiksel analizindetanımlayıcıistatistikler,ki-kare,Mann-WhitneyU
testi,WilcoxantestiveFriedmananalizikullanılmıştır.
Deney ve kontrol grubundaki hastaların NRS1 puan
ortancalarının birbirine benzer olduğ u belirlenmiştir
(p>0.05). Deney grubunda NRS2 puan ortancası 4.0
(3.0-4.0),kontrolgrubundaise6.0(4.0-7.0)olaraktespit edilmiş ve gruplar arasındaki fark istatistiksel olarakileridü zeydeanlamlıbulunmuştur(p<0.001).Ayrıca deney grubundaki hastaların ağ rıya verdiğ i davranışsaltepkilerkontrolgrubundakihastalardananlamlı
ö lçü dedü şü kbulunmuştur(p<0.05).
Araştırmanınsonuçları,perkü tankoronergirişimyapılan hastalara buz torbası uygulamanın femoral kateter
çıkarılmasınabağ lıgelişenağ rıyıazaltmadaetkiliolduğ unu gö stermiştir. Bu nedenle, bu hastalarda ağ rının
kontrol altına alınmasında hemşirelik girişimi olarak
buztorbasıuygulamasınayerverilmesiö nerilebilir.
The present study is a randomized-controlled, experimental research conducted to determine the effect of
icebagapplicationtofemoralregiononpaininpatients
undergoingpercutaneouscoronaryintervention.
The study was completed with totally 104 patients
being52inexperimentalgroupand52incontrolgroup
who met the inclusion criteria. Data were collected
Anahtarkelimeler:Perkü tankoronergirişim,femoralarteriyelkateter,ağ rı,soğ ukuygulama,hemşirelik
74
(NRS)andVitalSignsMonitoringFormbytheresearcher.Coldapplicationwithicebagwasdonefor20minutes before removing the catheter to experimental
groupandthecatheterwasremovedonlybythenurse
responsible for this process in the clinic immediately
aftertheicebagwasremoved.Standardproceduresof
the clinic were applied to control group. According to
the relevant standard procedures, the catheter was
removedbythenursewithoutanyapplicationtofemoralregion.Thepainexperiencedbypatientswasevaluated for three times being prior to catheter remove,
duringcatheterremoveandaftercatheterremovewhile the nurse was pressing upon the catheter region.
“NRS2”andaftercatheterremovewhilethenursewas
nedas“NRS3”.
Signed forms of consent for the study were obtained
frompatientsaftertheethicscommitteeapproval. Descriptive statistics, chi-square test, Mann-Whitney U
test, Wilcoxon test and Friedman analysis were used
forstatisticaldataanalysis.
Experimental and control groups were found to be similarintermsofmedianNRSscores(p>0.05).Median
scoreofNRS2wasdeterminedas4.0(3.0-4.0)and6.0
(4.0-7.0)inexperimentalandcontrolgroups,respectiwith an advanced level (p<0.001). Also, behavioural
experimentalgroupthancontrols(p<0.05).
Study results demonstrated that ice bagapplication to
by femoral catheter remove in patients undergoing
percutaneous coronary intervention. Therefore, local
icebagapplicationmayberecommendedasanursing
interventionforcontrollingpaininthesepatients.
Keywords:Percutaneouscoronaryintervention,femoral
arterialcatheter,pain,coldapplication,nursing
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
TEZÖZETLERİ
40-60YAŞGRUBUKADINLARAUYGULANANAYAKREFLEKSOLOJİNİNVAZOMOTORYAKINMALARVEYAŞAM
KALİTESİNEETKİSİ
THEEFFECTOFFOOTREFLEXOLOGYAPPLIEDTOWOMENAGEDBETWEEN40AND60ONVASOMOTOR
COMPLAINTANDQUALITYOFLIFE
EbruGÖZÜYEŞİL
ErciyesÜniversitesiSağlıkBilimleriEnstitüsü
HemşirelikAnabilimDalı
DoktoraTezi,Temmuz2014
Danışman:Prof.Dr.MürüvvetBAŞER
ErciyesUniversity,GraduateSchoolofHealthSciences,
DepartmentofNursing,
PhDThesis,July2014
Supervisor:Prof.Dr.MürüvvetBAŞER
ÖZET
ABSTRACT
Buaraştırma40-60yaşgrubukadınlarauygulananayak
This is a randomized, placebo-controlled study which
was performed in order to determine the effect of foot
ne etkisini belirlemek amacıyla randomize, plasebo
kontrollü bir çalışma olarak yapılmıştır. Çalışma Çuku-
ğ i’ne 22.02.2013-22.02.2014 tarihleri arasında başvuran 120 kadın ile yü rü tü lmü ştü r. Çalışmanın yapılabilmesiiçinEtikKurulonayıalınmıştır.Mü dahaleveplasebo grubundaki kadınlara 6 hafta sü re ile her bir seans
25dkolmakü zerehaftadaikiseans,toplamda12seans
uygulama yapılmıştır. Mü dahale grubuna araştırmacı
ayakmasajıyapılmıştır.Araştırmadaveriler;tanıtımve
değ erlendirme formu, visual analog skala, menopoza
ö zgü yaşam kalitesi ö lçeğ i ve sıcak basması gü nlü ğ ü kullanılarak toplanmıştır. Elde edilen veriler ki kare
testi, t testi ve Mann Whitney U testi ile değ erlendirilmiştir. Tü m testlerde istatistiksel ö nem dü zeyi 0.05
olarakalınmıştır.
Plasebo grubundaki kadınların uygulama ö ncesi sıcak
basması, terleme ve gece terlemesi puan ortalamaları
sırasıyla 8.1, 7.1 ve 6.9 iken, uygulama sonrası 5.7, 5.0
ve 4.3 olarak belirlenmiştir. Mü dahale grubunun ise
uygulama ö ncesi sıcak basması, terleme ve gece terlemesi puan ortalamaları 7.5, 7.3 ve 6.9 iken, uygulama
sonrasıbudeğ erlersırasıyla3.3,3.2ve2.3olarakbelirlenmiştir. Sıcak basması, terleme ve gece terlemesi
puanortalamalarıherikigruptada,uygulamaö ncesine
gö resonrasındaazalmaolmuştur(p<0.05).Ancakuygulama sonrasında mü dahale grubunda bu ortalamaların
plasebo grubuna gö re daha dü şü k olduğ u ve gruplar
arasındaki farkın istatistiksel olarak da anlamlı olduğ u
belirlenmiştir(p
grupta da uygulamalar sonrasında uygulama ö ncesine
gö e iyileşmegö stermiştir (p<0.001). Cinsel alanda ise
mü dahalegrubundaanlamlıbiriyileşme(p<0.05)gö rü lü rken plasebo grubunda iyileşme gö rü lmemiştir
(p>0.05).
Bu çalışma sonuçları menopozal dö nemdeki kadınların
vazomotorsorunlarınınazaltılmasındaveyaşamkalitegö stermiştir.
Anahtar kelimeler:
malar,yaşamkalitesi,hemşirelik
on vasomotor complaint and quality of life. This study
wasperformedwith120womenwhopresentedtoBalcalıHospitalofCukurovaUniversity,MenopausePoliclinic between 22.02.2013 – 22.02.2014. The ethical approvalwastakenfromEthicsCommitteeinordertoperform the study. The application was performed to womenintheinterventionandplacebogroupsforaperiod
of 6 weeks, twice a week for 25 minutes for each sesıntervention group was performed by the researcher
andnonre performed by trained assistant researcher. The data
form,visualanalogskala,menopause-
luated by Chi-Square test, t-test and Mann Whitney U
takenas0.05.
hes,sweatingandnightsweatsVASscoremeansofrespectively, 8.1, 6.9 and 7.1 on the other hand after the
intervention,5.7,4.3and5.0onthewomenintheplacebo group. Additionally It was detected that prior to in-
score means of respectively 7.5, 7.3, and 6.9 on the other hand after the intervention, 3.3, 3.2 and 2.3 on the
tingandnightsweatsscoreavaragewasdecreasedafter
interventioninbothgroup(p<0.05).
However, after the application score average in the interventiongroupwas foundlowerthanthatintheplacebo group and, the difference between groups was
p<0.001).The
meanscores ofthevasomotor, psychosocialand physical area which is the sub-group of MenopauseQualityofLifeScale,improvementwasdetectedonthe
both groups after the application (p<0.001). In the
for intervention group (p<0.05) no any improvement
detectedforplacebogroup(p>0.05).
effectivetoreducevasomotorsymptomsandtoincreasequalityoflifeinmenapousalwomen.
Key words:
qualityoflife;nursing
Sağlık Bilimleri Dergisi (Journal of Health Sciences) 2014 ; 23 (2)
75
Download

2014 yılı mezunları tez özetleri - Sağlık Bilimleri Enstitüsü